1DZ3A

Domain-swapping in the sporulation response regulator spo0a
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
123
structure length
123
Chain Sequence
SIKVCIADDNRELVSLLDEYISSQPDMEVIGTAYNGQDCLQMLEEKRPDILLLDIIMPHLDGLAVLERIRAGFEHQPNVIMLTAFGQEDVTKKAVELGASYFILKPFDMENLAHHIRQVYGKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain swapping in the sporulation response regulator Spo0A.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Response regulator
molecule keywords Stage 0 sporulation protein A
total genus 39
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2000-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dz3A00
5TQ0A 3FGZA 2KYRA 4P98A 4IGAA 2RJOA 3MIZA 3JTEA 1BDHA 1DRJA 3LOPA 3O2QB 1USIA 1Y1LA 4YGXB 4EYQA 3NNNA 4MGEA 4Q6BA 5EWMB 4EYKA 5KC8A 4RK7A 1FQWA 2NZVG 5KQMA 1D2AA 4LE0A 4LZLA 3JPYA 3KHTA 1QP7A 1ZH2A 3QLVA 3RVLA 4TN5A 2PUBA 2QXYA 2LP4Y 3B2NA 5DTEA 5JS2A 4ZMSA 3E3MA 1W9HA 2GBPA 5IUKC 3FFTA 3H1GA 3BBLA 3LTEA 3T6KA 1ZN2A 3RVJA 4O1IA 4RK4A 1NXTA 2AYZA 2FXIA 5DKFA 4Z4EA 2FMIA 4RS3A 2IYNA 2E4YA 2FKAA 4FB4A 1EFAA 3RVKA 5GQSA 1TVMA 1JYFA 2PAFA 1Z13A 2QZJA 4W5TA 2IKSA 2R48A 1QMPA 3DBIA 1USKA 4O5AA 1TMYA 4KFCA 3OO1A 4N0QA 1DBWA 4NQRA 3DGEC 1EWVA 1PUXA 4LE1A 4RXTA 3FFWA 4YWHA 3RH0A 1XWWA 3D8UA 5BR1A 2FTKE 3LUCA 4Q7EA 4JAVC 2XDYA 1LJLA 5HQJA 5C5CA 4IILA 2FMFA 1MVOA 3A0RB 1VLZA 2B1JA 3EODA 1L5ZA 3H6HA 1Z16A 2JB9A 3KYJB 3CRNA 5KWSA 1F4VA 3NNSA 2QR3A 5FBKA 2WJAA 2PUDA 3CG4A 2FMKA 4W5NA 5F64A 2NZUG 3KLOA 1CEYA 3SAJA 3HDGA 3GRCA 4F8JA 1LBHA 4RY9A 3TX6A 3C3WA 2HPHA 2GI4A 1K66A 4MYRA 4KMRA 1E6KA 4DN6A 3NHMA 4D74A 3HVRA 3O1HB 2E4WA 2JVJA 5IEBA 3VNBA 1PNTA 4DQDA 2NUBA 2PUAA 1NXOA 3HZHA 1P2FA 4MAAA 2X7XA 1FFGA 2P9HA 1UDRA 5FWYB 1ZGZA 3TD9A 1U8TA 2CHEA 1FFWA 1YMUA 2IPAB 3C3KA 4YLEA 2FEWB 5KQGA 3MM4A 4LDAA 1NATA 1CHNA 1A04A 1DC8A 3H5IA 1JFTA 4WXEA 3KTOA 1QPZA 5TQ2A 4G0XA 4OBBA 3F6PA 2LBPA 4RY0A 1B00A 4RV5A 5JNUA 3IDOA 2JRLA 4N76A 3JVIA 4FE7A 1D5WA 4Y9TA 2PJUA 1VKRA 2HSGA 3NBMA 3P9YA 5TPZD 3ROFA 2IPNA 3OLXA 3IP9A 1YTUA 3GT7A 3HV2A 4XARA 5T7BA 3GA5A 4KQ9A 5IUJC 1DCKA 4RY8A 2R4QA 4HNSA 1FFSA 3URMA 1JWLA 3L6UA 3OQMA 3EGCA 2CD7A 1J56A 3RVRA 1E6MA 3Q9SA 4HNRA 1JLKA 1DC7A 3EAFA 1BDJA 2GX6A 3UKJA 4MS1B 2PE5A 3UUGA 1OXBB 3MA0A 1ZY2A 3N8IA 3M9WA 3LMKA 3Q7RA 1ISSA 3O2SB 4KQCA 4G86A 1BVHA 2A9QA 3KCNA 4WUTA 4RZSA 3IP5A 3KYIB 1E6LA 5C5EA 1U04A 3GV0A 3A10A 3I5AA 4XASA 3O1JC 5D2CA 3S99A 2JBAB 2PUCA 4G0YA 2QSJA 3H5WA 2MSWA 1SXHA 2OENG 1YK0A 3OMWA 2R25B 1GCAA 1MAVA 4XXHA 2WY2D 4H3KB 2MYNA 5BRJA 4NV3A 4MS4B 3HDVA 2WWVD 1BAPA 3MYYA 3H5VA 4L4UA 4MPTA 4QYMA 2O20A 4ZMRA 6CHYA 2IOYA 2HQOA 4Z9BA 5FBHA 1DP4A 3I42A 4RWEA 1Z25A 2L18A 1M2FA 4EVQA 4MS1A 2W42A 3EQ2A 1D1PA 4RKQA 1DCMA 1DBPA 4EYGA 2PLNA 2A9RA 3QX8A 1OXKB 2L2QA 3NHZA 3HEBA 4EVSA 3M9XA 4OTZA 3T95A 1DZ3A 2VK2A 4G0OA 4MR7A 1DJMA 5FWYA 3HSYA 1QNLA 5KC9A 4PICA 3LUJA 5GOTA 2F8TA 1D4ZA 5JNRA 3NNDA 3CZCA 4LX8A 3IP7A 4F06A 2A9OA 1Z2EA 3Q7TA 1NXWA 5EWLA 4RU1A 2NT4A 5KI6A 5JNVA 2A9PA 1USGA 3QX9A 3OLYA 5IBQA 1JYEA 1LK0A 3K9CA 3N0XA 4W5QA 4KV7A 4KPYA 3HK2A 1JDPA 1NXXA 1YS6A 4RK6A 1HEYA 4Z4HA 3QLUA 4Z4CA 1YVUA 3HM9A 4IMIB 2Q5CA 5E3JA 3Q7SA 1RZRA 3QLTA 5FWXB 3OLZA 3CU5A 3QLVC 1QQAA 1U2QA 4JB0A 1JX6A 4MQFA 3IPCA 4HYEA 1JDNA 5EWLB 5TQJA 2PUGA 4NCBA 3HO1A 3KKEA 3EDCA 2QU7A 2OQRA 4P1ZA 5CNJA 3SNKA 3DLBA 3EQZA 4YRZA 3H75A 4GPAA 4KK3A 1M5TA 2FLKA 5ABPA 4MQEB 1EAYA 3DZDA 3H5OA 1KRXA 1MB3A 4OLBA 3O21A 3Q41A 3CZ5A 5DCLA 1JH9A 4PE5B 3RVNA 3DLHA 3OLWA 5IEJA 3MMNA 5IX8A 1QO0D 1ZDMA 5TQ2B 4YCSA 4KNYA 3O2JA 1RXEA 2FVYA 1YMVA 4RKRA 2LUOA 2E4VA 4JB2A 2TMYA 3SM9A 3CTPA 1QKKA 3LUKA 4JP1A 4MS3B 4Q6WA 4RK5A 3M6MD 3I09A 4QICA 7ABPA 1D1QA 5IUNC 2P4UA 1NXPA 1Z17A 2FN8A 1E2BA 1Z18A 2HJ9A 3RVQA 5HM6A 3EJWA 5DLEA 1Z2DA 3MQ4A 4IRXA 4QYWA 5HSGA 5DGCA 3N0RA 3LKVA 3N75A 4KZKA 1QP0A 1ZHHA 1U0SY 4MR8A 2AYXA 2FQWA 1SXGA 1Z26A 1ZITA 3C3MA 4WT7A 3ROTA 4Z4IA 2HQBA 2LPMA 1ISRA 3KG2A 4PYRA 4MLCA 3SY8A 2JBAA 4L85A 4MQFB 2QW1A 4YP9A 4N41A 3LKBA 1PEAA 1ABEA 3E61A 4G0MA 5ED4A 3H1FA 5FWXA 3JVDA 3C97A 4E7PA 1JHZA 4H60A 4PZ0A 3OQOA 3O1IC 3QELA 3TB6A 4IMJB 2ID9A 2GWRA 5PNTA 1BDIA 2WRZA 3CLKA 3LUGA 3HXMA 1NTRA 4WWHA 5HKOA 2FEKA 2VYCA 1AB5A 1XHEA 2PMCA 2VUIB 2V0NA 4ML3A 4RXUA 4G0ZA 5BQ3A 1P8AA 3T38A 3N53A 4TLLB 6ABPA 1T34A 1Z15A 2H3HA 3O74A 5CNMA 4Z0NA 4Z99A 3N6VA 2RDMA 4MR7B 2LIVA 5TPWB 3D02A 1DRKA 1K68A 3OMXA 3FFXA 4RDCA 1ABFA 1KMIY 1TJYA 2CHFA 3RQIA 4EUKA 2ID7A 3KLNA 1VPWA 4QPJC 1ZH4A 3GL9A 4KRFA 5EWJA 2IPMA 3F73A 4F11A 1JL3A 1YS7A 3FDFA 2E4UA 4W5RA 2PL1A 3IPAA 3QELB 4YV7A 3F7NA 4G0QA 4ZJPA 4ZYLA 3OO0A 3K4HA 5EWMA 3TO5A 5JNTA 5JS1A 1YIOA 4N47A 1EWTA 2M98A 2MSLA 5B3JC 1Z12A 1PHRA 1SRRA 2RJNA 4MR9A 5CNKA 2HQRA 4NICA 2FQYA 3H1EA 4MRMA 1A2OA 4LRQA 2MSKA 3DGFC 4S04A 3GWGA 2DRIA 1ZESA 3HUTA 4YS6A 2E4ZA 4KREA 5KQLA 1SD5A 3O75A 4DADA 4G97A 1GLGA 1URPA 5TE9A 3KJXA 2GKGA 4PEVA 1EHCA 1GUBA 3C6QA 4WZZA 4JASB 4LDZA 1FSPA 3N0WA 2MYUA 1RNLA 3QEKA 1QP4A 3MF4A 1MB0A 1QO0A 4UHKA 1PNRA 3LUDA 4O1HA 4ETNA 1WETA 3CFYA 3UK0A 1APBA 2WMYA 3QK7A 2NT3A 1VRVA 1ZVVA 3F6CA 4EVRA 2MYTA 2E4XA 3KS9A 4ETMA 3RVOA 1EWKA 3ILHA 4MS4A 2CWDA 1XHFA 1GCGA 4E7OA 4LE2A 4WXMA 5TQ0B 3SG0A 4XFKA 3W9SA 3LUFA 4MR9B 4MQEA 1MIHA 4MR8B 3H5TA 1P6QA 1JBEA 3LUHA 2PUFA 4H3HB 1JF8A 2WJWA 2YHAA 3JY6A 2F8SA 2J48A 3CKMA 3JS5A 3Q15C 3QEMB 4JA2A 4TLMB 5JNSA 3FMVA 1GUDA 2R47A 3GBVA 4S05A 2JCGA 4EY3A 1ZGGA 5CNIA 3QLUC 3BILA 1LJUA 1S8NA 3G85A 5EWJB 4ETIA 3L49A 4B09A 5IULC 2JVKA 2IPLA 3HUUA 5TPZA 2FSPA 5CHYA 1U2PA 4OG2A 1DBQA 4Z9AA 1W25A 1CYEA 4M88A 1TM2A 2FW0A 1RPJA 3QEMA 4XAQA 4D6YA 4EGSA 4F12A 3OQNA 4W5OA 3OM0A 1LBIA 3RVSA 4HNQA 8ABPA 2QV0A 1PEYA 3LUAA 2PL9A 2I6FA 2PKXA 1A0OA 3CNBA 5B3JA 1RXIA 4G0PA 1YK1A 3G1WA 2M1ZA 3HJFA 4UHJA 3KSMA 3H6GA 2L19A 2RGYA 4IF4A 3HS3A 3T8YA 4MS3A 4YR7A 2BGGA 4RK0A 1RZRD 2MYPA 5I4CA 3CHYA 2B4AA 3GBPA 5BRAA 4OLAA 5IC5A 5KQPA 4TMYA 1AB6A 5JNWA 3ILYA 3TMYA 9ABPA 3OLVA 3OM1A 3LFTA 2JVIA 4Z4GA 1C4WA 2FEPA 2QVCA 3EULA 1P6UA 2PUEA 1BA2A 1JFSA 1SXIA 1F51E 1DG9A 3CG0A 1M2EA 2WB4A 3R0JA 4N0PA 5T3YA 1DCFA 2L17A 2VUHB 4MLDA 4EYOA 1C0EA 2YHBA 3HCWA 1NXSA 4RXMA 2FQXA 1NY5A 4FE4A 1M5UA 2ZWMA 3I45A 3JPWA 4MRMB 4KVFA 3RVMA 2IDMA 4NCAA 4GNRA 2FMHA 1KRWA 4N03A 4D6XA 2ZAYA 4Z4FA 3BREA 3IP6A 3RVPA 1NXVA 4RK1A 3VNAA 1I3CA 2FLWA 4F3TA 1L5YA 3H5LA 3A3KA 4RSMA 4JOQA 4KK4A 1IIBA 1R8JA 3CS3A 1H9CA 2JK1A 3GYBA 3A0UA 1TLFA 1JFVA 4ZPJA 2FN9A 3BRSA 1QQBA 2H0AA 5TPWA 4CBVA 4OATA 1KGSA 1ZAYA 3BRQA 2QVGA 4XLTA 3SQNA 2N9UA 4YO7A
chains in the Genus database with same CATH superfamily
3IKVA 2M6RA 4YFVA 3QLJA 4XGIA 2O0MA 3PHLA 3GHYA 2HBZA 4P98A 3OAAA 4YCBA 3AJ9A 3GI1A 3Q6IA 4RCYA 3VNQA 4IIBA 5JG7A 3D3EA 1A71A 4EHLA 1N2ZA 4EEZA 1FFEA 1GN8A 5I9NA 4OGWA 5EJEA 5AK6A 3PC2A 4XPIB 2JFVA 1BX3A 1T8UA 2H7XA 1E1YA 1P1FA 1S02A 3JQDA 2ZULA 4LA4A 3TRIA 3VDXA 2X77A 4R2LA 4TYQA 3PYLA 1VKHA 2C5SA 2QRUA 1E1CA 1FW8A 5JS2A 4IOJA 3C48A 3HBJA 3ZWQA 4E31A 3FFTA 3N8DA 1G2IA 1NN1A 4PX9A 4REOA 1RACA 1ZN2A 3Q4GA 4DCMA 4TXJA 1ZC3A 3ZY5A 1FMFA 3EDOA 1Q14A 3PQFA 1DT5A 4H7HA 5AVKA 4URFA 5FFNA 2QA5A 2KE5A 4OCZA 3SYRA 4Z7NB 1M0EA 4DTCA 3F6EX 4CG0A 4DM7A 4W5TA 3O7MA 2IS4A 1KZHA 4N9QA 1VG1A 1XR3A 3EZ9A 2YRWA 3PENA 4G5QA 5F1KA 2VP2A 1ZKDA 3EDMA 3K6RA 5C32A 5EMKA 3D1JA 2YWRA 4ZO9A 2Q7DA 1T10A 3QXJA 4BLQA 1V6SA 2QL7A 2PT9A 1OX4B 4FMDF 3H8WA 4LRSB 1LDBA 4ZALA 3VYSB 4EG6A 5I45A 1W0JD 3V97A 1GG9A 2QX8A 1Y3CE 2H9AA 2Q9AA 4UHEA 4WK4B 4ZD6A 2QZZA 4YGYA 5LA6B 3WYGA 3ZCPA 3L4JA 4I4LA 4ALLA 2AC4A 1MVOA 1MOSA 1P7VA 2DC1A 4NAVA 4MW2A 4B6JA 1DC4A 4X1OA 1JEDA 2R4TA 4B7AA 3NNSA 8ADHA 1Z4MA 3L6CA 5L6LB 2JF0A 1UDCA 2NZUG 4JUAA 1B6GA 3RBVA 1VIDA 3EC7A 2CFRA 5LU9A 3K71B 1L4UA 4HWGA 4GI3A 2W2LD 3IESA 3PUIA 4DY6A 4LYDA 1M6WA 1OXSC 3GFVA 1SCNE 1VHWA 5AVOA 1NVDA 3IXLA 3QRWA 1E96A 2OA0A 3VDRA 3RFFA 5FPQA 2NXJA 1PR4A 4IHJA 2QJWA 1ZRSA 3KQOA 3VH4A 4B40A 2BEUB 2OMEA 4X63A 1J90A 3MNFA 3R8FA 1E20A 1X7ZA 4B3FX 1QWOA 4HNAB 1ZGZA 5IAJA 1M67A 2Q9CA 3T9AA 1PL6A 1YZYA 2G8NA 3M7IA 5DX8A 3MBOA 5BPFA 4DG8A 1CUSA 1XCBA 3FUUA 4K6GA 5EGNA 2JHCA 3K30A 2AG5A 4FX2A 2H63A 1C4OA 1KYYA 1RKVA 3LE8A 3MFYA 1GZSA 1H4TA 1BJRE 1YOBA 1SVNA 1NVXQ 1WE2A 3U1VA 4RV5A 3W8DA 2P6NA 4RTQA 2OO3A 1PK7A 2Q1SA 2VHUA 2VTVA 2ACWA 3IDOA 4JZKA 3TTYA 4RTKA 3DOHA 2NAFA 3HXQA 3B7PA 1NLFA 1RTTA 3FPJA 2G1JA 1KDRA 1Y5MA 4NBLA 4JLMA 3HXOA 1RI4A 3IP9A 3G5UA 3OLXA 4J3FA 2ODBA 1ODKA 3GG9A 4RVNA 4TLDA 5H70A 2VSQA 4DEYA 2PKQO 1U0HC 2XEDA 5FWNA 4EF5A 1G20A 1I4EB 4UTZA 2AZ4A 1AN0A 5IUJC 2JGIA 3GLGB 3RRMA 1ADFA 1QS0B 3C3JA 2V5UA 4WXRA 5L6MB 4OLFA 2VQFB 1WP9A 1XTQA 3DW3X 4DBVO 3D6FA 3EWSA 3P9SA 3A3PA 5AW0A 4W7SA 3ASVA 2YVKA 1DC7A 3EAFA 4UCWA 3PD0A 1VDZA 1T0BA 3N8IA 2CNLA 3BXHA 1LW6E 2J0VA 1QGOA 4AXXA 3OZDA 1LBEA 3VR3A 3COSA 1R18A 3HEMA 4C4AA 1M6VB 1ZK1A 3FI9A 1LK5A 1H5NA 1NASA 4XASA 1KVTA 1QHYA 1ODCA 2HMYB 3GH1A 3DUFB 3HCPA 4CTNA 4EI2A 5EHZA 1TEVA 2VLIA 1U0GA 2JEZA 3ABIA 3OMWA 1DJNA 4BRWA 2CE7A 2OUIA 3HZZA 1DU4A 2KJQA 3RTBA 1LNQA 3TKLA 2VHTA 4CR8A 4KIUA 1OH6A 1USWA 3DDCA 3GPCA 4H3KB 1XU9A 1VHLA 1U0LA 3OT1B 4QVGA 4OOEA 3KUUA 3VUEA 3L1JA 1CQIA 1QWSA 3TSAA 4DFDA 4DPKA 1SXQA 2E85A 2JIRA 5FFMA 2HU8A 2PT5A 3L6EA 1X38A 4X6XA 3KYCA 1X3LA 5LZ5A 3WLNA 4CMGA 4QGHA 1D8TA 2X7HA 4EL0A 3ETDA 3NM6B 4LJRA 4LCJA 4J8PA 5FBHA 1PYDA 3P7MA 4TSRA 1J9ZA 2C8KA 1J70A 5KEIA 4A8PA 2VTDA 1ICEA 1M2FA 2YXEA 2YZKA 3F8SA 4K81B 2VI5A 4Q3OA 4ZANA 4EVQA 2GB4A 3PXCX 1KMHA 2PVCA 3GRAA 4QAQA 4I3GA 4NOKA 3WK8A 2ESRA 2P30A 1R4NA 3L3BA 4Q03A 5YASA 3VR6H 3M9XA 1GFZA 3CCCA 3D3WA 4OTZA 2RK6A 4A2QA 1Y3FE 3MAJA 5LIRA 1Z6TA 3FCOA 2JZCA 1MIOA 5FT9A 4B9EA 5ITSA 2FZ4A 3DYIA 2AMLA 3EEYA 2AZXA 1E69A 1WJGA 2UAGA 4CR7A 3UJBA 2B4TO 1TTQB 2I3AA 4MRNA 4UU1A 4DNOA 5KC9A 5HWSA 3MTGA 5JNRA 1ICIA 5K09A 3IJRA 4TV9B 4RTSA 3EPJA 4NFYA 2AN9A 3MMXA 1ETHA 1H23A 1YZNA 2QTLA 2ZIZA 4DQKA 3DE6X 3Q7TA 1BXRB 3GUUA 3PI7A 2GRAA 2GM3A 1OLSA 1OWPA 2ZI5A 4B6GA 1RWXA 5JNVA 2D54A 3W1VA 3ZU5A 1DEHA 3TUJC 1Z73A 3JZAA 4R6XA 4AYTA 5EFZA 2IGTA 3UMVA 2A88A 5FHQA 1YVEI 2H31A 1X7XB 3N0XA 3DYBA 3OICA 1TCCA 3D4IA 4FGZA 4XIFA 3UOWA 4HNVA 2H52A 2FW7A 5AKYA 5ARDA 2KS6A 3BDVA 4GP9A 4BQQA 3VH3A 1NWHA 4FNMA 5JFGA 4IIUA 1NSFA 2HWUA 2CDCA 4C7MA 4RULA 5KTRA 1Y6ZA 1C3XA 2Q5CA 1I80A 2EEZA 3CRQA 3T1YB 3DUWA 1JPUA 1BU8A 1QV6A 4FONA 5F73A 4D26A 3OCUA 4I4NA 2W7TA 2R97A 1ZNXA 4WJZA 2CMGA 4CMEC 2MSCB 4NH0A 1BMQA 2DQKA 3SNKA 3TRFA 5BWBA 1IEQA 1M2WA 3EIUA 3Q3HA 3DZHA 4KK3A 3EAQA 4DWWA 2AEFA 4EA7A 2FMTA 4TV8A 3H5OA 1E66A 3OFKA 2FN7A 1XDZA 5FXMA 3GT3A 3E1KA 4OLBA 3IL2A 4Y98A 3FNGA 1X1QA 3HLYA 1P72A 2IYWA 1VLHA 3EVEA 4Z49A 1O94D 4TKUA 5I7RA 1PHPA 2R7KA 1NR5A 3K0BA 1YUMA 2FVYA 4BAUA 1SU4A 2IH4A 3LX5A 1KP3A 5FP0A 2TMYA 2VNHA 1GGEA 2B1GA 3O3OB 4QICA 4X5OA 5JV5A 5HIMA 5IUNC 4GFDA 1VCOA 2J5XA 2IYTA 1T5LA 1Y89A 3VVCA 3WNQA 4DUYB 5ETJA 3EQ7A 4LN1A 4URUR 2WFZA 2GYWA 3DFUA 2P4HX 3SZUA 1AGPA 1U80A 4INZA 3LKVA 1A9ZA 1PGPA 4PM4A 1H5QA 3UAYA 4J0IA 4MR8A 4RMNA 4L28A 1WMAA 2BHSA 1Z26A 3IBSA 5FJJA 1QGAA 1ZD9A 4UMVA 1JQBA 4YAKA 3GFFA 3PDJA 5HHTA 1DAGA 2BONA 4XIIA 2GN6A 4F3KA 3CT6A 4MV9A 4L85A 1Q20A 5CU7A 1Y4UA 2YW9A 2ZOSA 1VSBA 2CSXA 2BTQA 2W6QA 5FLEX 1JECA 1BWRA 2D4AA 3K9QO 3BXGA 2IPOA 1EK0A 1YR8A 3BD9A 4NLLA 4A2PA 1GQSA 1TYEB 2JFGA 2XUDA 4PTLA 4WZBE 1BDIA 5G1NA 1M34B 2XB6A 1OC4A 5FAXA 4XWKA 3U3DA 4DJAA 4DB4A 1ND5A 1XHEA 2VQ6A 3PC8C 3E3NA 4QLAA 4RXUA 1S0UA 2PU7A 4WGFA 2FN3A 1X1AA 4QEZA 3WWEA 1KH2A 1MA3A 4A5SA 3WI7A 1NZJA 2JFBA 1JEEA 3PQ2A 4FP9A 4PG5A 1H4SA 3LD9A 4L8WB 1M66A 4MI1A 4S1TA 4Y9DA 4WKOA 3TW6A 4ZAGA 1ZJWA 4KOEC 4B85A 1U7ZA 3U1BA 1WA5A 3WKBA 2AR9A 2IZ7A 2QPLA 3X1ZA 5A2QA 2NG1A 4MLZA 2JRCA 1VPWA 4QPJC 3VR4H 3N3AC 1XZKA 1SKYB 4WD3A 3ZX5A 4CKZA 1C8VB 4MHOA 2VHWA 3WL7A 3EVDA 4IICA 2CVZA 2M6LA 3Q0IA 3C1UA 5IHXA 3K7EA 3RE1A 5ALZA 3PLNA 2V5VA 4JQZA 4KQ6A 3OO0A 3B20A 1BGWA 1JT9A 3GZ4A 4U7GA 4ARVA 5IVDA 2P4QA 3OQPA 1VE9A 3K5IA 3WAJA 1Z0DA 3E9MA 1NR1A 1ZM3A 3EN0A 2VPWA 1JV2B 1FZQA 5LLSA 3W78A 4PLFA 1N2CA 3FTFA 1BVRA 4UVEA 1FNSA 3V7YA 1Q3HA 3AV0B 1S9DA 1CIPA 3ROKA 2B9VA 4NMLA 4HNGA 5GONB 3L5OA 4TTJA 2ATIA 1LPBB 2IOFK 4DADA 5B55A 2O5CA 1VI2A 4C89A 4HS9A 4BE7B 4V03A 2O3RA 2WSLA 3L04A 5IBRA 4Q4AB 2DM6A 2J46A 3D7SA 2O6LA 4OHYA 5JYEA 1W93A 4AKIA 5BSTA 3L5KA 3STWA 2PYZA 1QP4A 3B1ZA 2H2AA 3C4VA 3M6FA 3L0PA 4HH1A 2XGJA 2ZU6A 4JLPA 4KR9A 5IF9A 3C24A 3LTNC 1UKAA 3GMIA 3JSXA 4B9AA 1KIMA 1FRFS 2VP3A 2X9QA 3ST7A 4CLOA 1FS4A 2CF5A 3P4XA 4LJ9A 1U0EA 3EZXA 4UMFA 3GUZA 3SBOA 2HF9A 4D3ZA 2DFPA 1DTWA 1WZUA 3C7CB 2FFHA 3JQPA 1VPTA 1LVHA 1FYWA 2PPLA 3WLIA 4V39A 4GKVA 4QPZA 1QQTA 2E4AA 4YRTA 4BVFA 4IG9A 4PHHA 4L76A 1DHTA 3OKAA 1UAYA 1MIHA 4MUJA 3AP1A 2GLTA 3FOCA 1IIRA 5DN9A 3T34A 2PA3A 3BA6A 3DV0A 3TZKA 2QIPA 1W47A 1SQ0A 4KE6A 4ALJA 2XMZA 2EFJA 4WY5A 4AY2A 2OECA 3O31A 3PRYA 4LVNA 1NU6A 2ZBQA 2NO9A 4JI5B 4DIEA 1SFRA 3ASZA 3GA0A 4FGLA 1UDXA 2H51A 3RU9A 4KJZA 1VDMA 1C29B 2O7SA 1PGNA 2I33A 1A9PA 4ND2A 5IF3A 5EJ8A 1OXUA 2WF9A 3VO2A 2YV5A 2HEGA 1IM5A 4MP6A 2OM2A 2AN4A 3DVLA 3T3MB 3DV0B 1VB5A 4R05A 4OF4A 2OKGA 4R2HA 1W25A 3LLVA 4FT2A 4UPDA 4UHFA 1AT1A 3TNYA 2UYYA 1JXOA 3MTIA 5AW4A 4FMCF 2PO5A 3N2ZB 3NCHA 8ATCA 4U7HA 3JRXA 3HKBA 2GXUA 5ENZA 1QLJA 1XMJA 1FYXA 2V7WA 4JEUA 5D84A 5LNK6 2JJMA 4HFNA 2O50A 2VSFA 3LA8A 3Q8MA 3SKXA 5T4BA 3DKVA 1BRMA 1C1XB 2JIZD 2CB0A 4JFRA 2RHJA 4UHJA 2P9ZA 3WGVA 2KB0A 4TV8F 4I6JA 3HS3A 3OIFA 1GYRA 1RLOA 3PVZA 4IMRA 1P7ZA 2TYSB 3PQEA 3VYWA 3AUJB 3H9EO 3DE2X 4JT8A 4K9SA 3IMCA 2GZ3A 3CHYA 5K2MA 2B8JA 4CDRA 1Z35A 4KBFA 5BRAA 2VJCA 3OESA 5HVNA 4MV0A 4DM3A 3F8TA 3DCIA 2WINI 3ORSA 5H4HA 3ZU3A 1UPBA 5DHUA 3ZDFA 1KMHB 1JUDA 1OFUA 2A0UA 2FK8A 2JVIA 3DP9A 1ENZA 4R3UC 1F38A 1C4WA 4HUQB 3ZE1B 4JK3A 5H9WA 5I48A 1BA2A 1X3SA 4X8HA 1XJCA 2A5JA 3SXUA 4U2EA 2YIMA 3CG0A 4LQ4A 4BGUA 4DAOA 5HZGA 4PYJA 4XRRA 4N0PA 3L8ZA 4DXAA 4E6EA 1JRLA 1E58A 3ZQKA 5DMHA 5F7ZA 4YRLA 1BE1A 4JUCA 1NDQA 1UBEA 4B2IA 5KYXB 1GA4A 1A5BB 3OT1A 4O4LF 3P2MA 1OGYA 4GKAA 5AVSA 3I4FA 4X7BA 4JGIA 1AO3A 1I9CA 4WCVA 4E4RA 3L43A 4RMIA 3KT8A 2NTJA 1QHHB 1RHJA 2P8SA 1X14A 1D1SA 3ONFA 2F48A 1S2LA 5CG2A 2BLNA 1L5YA 1GQYA 4FDLA 1RM3A 3ZXXA 4UAVA 4ENVA 4BNHA 1IZZA 3ZIAA 2QLBA 4D7AA 2IHYA 4UU7A 2W6JD 5DT2A 1KZ9A 4L2IA 1V3VA 3QNWA 3LCUA 3VSDA 4EPRA 5AW1A 1O0CA 1QQBA 3V46A 1TECE 2XQFA 4DLVA 2O48X 1PF7E 2W4IA 1PG5A 4HCJA 4R8MA 2DWQA 3PPXA 3PHGA 4YLYA 1YASA 3ZHBA 2PHZA 1TPYA 1IVYA 2QVZX 2QNBA 3TFWA 3J81k 4Z53A 1U3CA 1V8FA 1ZYUA 3BFVA 1NFFA 4YT2A 1BCRB 5JQWA 2I4NA 1N9GA 2Y3IA 3CUYA 4IGAA 4QAJA 1QJ4A 3CF6R 2AJLI 3V8NA 4TWAA 5LP6B 2CXRA 2I7CA 2OTCA 2Q5FA 1HE1C 3ICOA 3LRTA 4YGXB 4CQJA 4EYKA 3QW4B 1R12A 1JQAA 4JP2A 4LZLA 1CJTC 2HCBA 3EEQA 4RGYA 3MMSA 3G2LA 4GW3A 3E9QA 4ZAWA 2P2NA 3PL1A 4HR7A 5BNWA 2JI4A 1XLVA 3G0HA 1J25A 2AOTA 4JYBA 3AL3A 1YDHA 3BBPA 1QR6A 2PX0A 2ZITA 1BKDR 4LQDA 4BDTA 2AZDA 2JDIA 3KAPA 2FW8A 1JFRA 2J87A 1ZONA 3FLMA 1JXAA 1BIFA 4JCCA 4Y6RA 5F2KA 5HR5A 1T3ZA 4KMOA 3B9QA 1GOTA 4RK4A 2PA0A 4R2WA 3W2EA 4FYPA 1UC9A 3TLXA 3DOCA 1JR3A 1JXMA 3GPLA 4UJ3A 3DLTA 3VOAA 5TMEA 3B5JA 1KEEB 1DX9A 3WOVA 4IO0A 5FR2A 4O5AA 1LBQA 4DMKA 4GEGA 3M34A 4LJSA 4NX2A 3ADCA 3LP6A 1UAGA 2QY9A 4N0QA 5TMPA 1OSNA 2J3LA 1J5XA 3RI3A 3NLLA 3COVA 1EVQA 4QO8A 4BX8A 1RMYA 2F1OA 2OKCA 1AKVA 4HQNA 4I1VA 4YWHA 3NWBA 3ZYCA 5BN1A 5FOQA 5ERXA 2DYKA 4RJKA 4KN5A 3U40A 3ZQ4A 1AN9A 4IILA 3BZWA 4INJA 1K4MA 2WD7A 1VG8A 1VHJA 5ALLA 3LGSA 3H1PA 5AJVB 5LP1A 4JBXA 2XMQA 3ELWA 5KWSA 4CTJA 3ENNA 2P2CA 4IIVA 4BVHA 5U9CA 4D9HA 4QBFA 5AKJA 3THXA 3BMQA 1ILEA 5CJPA 1UKYA 5FJIA 4FWTA 3QEJA 3W3AA 3ER6A 2RB4A 3MWGA 2W6OA 5TVGA 4D3SA 5AIBA 3N2EA 3R7DA 3O26A 3MTAA 1A4IA 3C3WA 1ZPDA 1K66A 4TMTA 2XA9A 1L4YA 1X9IA 1Z4IA 4RKYA 1Q1ZA 2G77B 3V8EA 1OH7A 4OQNA 2V0CA 2IITA 3B48A 1PNTA 1LV7A 3P4YA 4FW8A 2NUBA 3D4BA 4QOJA 3UK7A 5J2TF 1Q3KA 1DIOB 3H42B 2FZ5A 4OQXA 3ACDA 3EZGA 4QUJA 4TSKA 3TSYA 1CQXA 2Y05A 3SS7X 4CMAA 4NYJR 2CHEA 3PC8A 3RC9A 2QE7D 1V3UA 1EHIA 5BYBA 1E3IA 2H0RA 4X1KA 1DC8A 1A04A 1FJ2A 1GUAA 1VCHA 2WKQA 3CT4A 4WZAA 1KH3A 3M6AA 5JT1A 3QNUA 1IZ0A 2C7BA 1E2PA 2L0XA 3VO9A 1QOQB 1SKAA 3CBQA 4CCSA 5HS4A 2BZGA 2FGKA 2WFMA 1GQRA 4EDHA 3U60B 3H1BA 4PFSA 1ZI9A 1L7AA 1JTVA 3KELA 4BNDA 1QBGA 4ERXA 3R5JA 2FEXA 1F14A 3LBNA 1A9YA 1GU7A 2H2WA 3DBLA 1DCKA 4CN9A 3RSHA 2QLNA 3ULKA 1DEAA 4NRDA 2VTBA 1YZGA 1QYXA 1ZD5A 4RO0A 4DWVA 3LRXA 4B8YA 4JYZA 1V9SA 3IEKA 3EGCA 5TARA 4O4HB 3DZKA 2BLLA 1WW2A 3PE4A 4RDHA 3RVRA 2GPYA 1N5RA 4J94A 3SSAA 3UKJA 4YRBA 4OSPA 4HUTA 1C4XA 3ROGA 2FPPB 5ALMA 1ZU5A 3E9NA 3FROA 4G86A 2CDBA 1NRXA 1DEOA 1XL1A 3HB7A 3SOZA 1PW7A 3PFIA 1R4MA 3HJGA 1VRWA 2FR1A 1PFWA 3EK2A 4PPGA 2FG5A 2P67A 2Q8QA 4IV0A 1CUJA 4BN0A 3UGQA 3SJZA 1JIKA 1H93A 4XX0A 1L9KA 1ZOLA 2MSWA 3OWOA 3WNVA 3EASA 3KIPA 4ARBA 2VDWB 3ONVA 3ESDA 4NK4A 4KQFA 3DZBA 1I3OA 3FLEA 3KP1A 3ZTYA 3TIFA 5HQ3B 1NJ8A 2H2IA 4C87A 1HT0A 1R5NA 2ETVA 3ZCQA 4HN9A 4PXSA 3DTYA 1YJQA 1P91A 4AJHA 4P7JA 1L2TA 4BO9A 3GG2A 4M21A 3R9IA 4C4ZA 2B6NA 1YL7A 3NOVA 3OI7A 4JLSA 4RKQA 4BUCA 4HVLA 1MJHA 4IUBS 4ZCMA 1RYDA 2YFQA 3SHTA 2JHAA 1VLVA 2B99A 1W6RA 2ORIA 1QHIA 2OVFA 1GU0A 2PKCA 4MYHA 5E7JA 5EXDA 3RIXA 1N6IA 3G0IA 2FG6C 3BJMA 3QVOA 4KQHA 5DYIA 1G8AA 3G7NA 3A3OA 4BMCA 3QI7A 3TTUA 3RS4A 3V3TA 3K0AA 1DC6A 1I6WA 1VMIA 4FEYA 5DHRA 4B31A 4BKOA 3V7WA 1Q7CA 4JLDA 1GTL1 2FRDA 5JATA 3AFGA 5LDGA 2ADMA 3WQQA 3GJTA 5B1SA 1U0OC 4DSNA 4F85A 5FOWA 4HLQB 4Y0NA 4BX9A 3A4MA 2BFOA 3VPXA 4EWLA 1WHTB 3BTUA 1T0HB 2Y0DA 4LJ5A 2R8YA 4ONEA 4Y2GA 2IZOA 4JVMA 1AMNA 4JBLA 2YY5A 1QV9A 1XDDA 5EIFA 1XKTA 4FFDA 3SDZA 4QVIA 2B30A 4IAOA 2A9PA 4A23A 2FJ0A 4ZT6A 2QMEA 5F21A 2GARA 1EI9A 2A84A 4HEJA 5JZMA 1DOZA 1KC3A 1J0AA 3C7DB 2C9CA 4PC2A 3VAAA 5AW2A 1JDPA 1ORDA 1SXJA 2RGGA 2V3WA 5JBQA 2FRXA 2JIMA 2GUGA 2NZJA 1C3OB 2RKWA 4ZEXA 5CXQA 3TOVA 4DDUA 3N8HA 3EDYA 1WDKA 5E3JA 3LX4A 3P26A 1ADYA 1SU7A 3TQRA 3RAFC 2Q5OA 3PDIA 3H2JA 1RTKA 3W8EA 1LPAB 2QM7A 1F4LA 4BJ3A 1TPZA 1J00A 1E9BA 4X8OA 3HGQA 4RW0A 5EWLB 1ZHFA 3V7UA 4PC7A 5HMLA 3CW9A 5JNLA 2FJPA 2HHLA 1HZZA 3K9WA 1I3LA 4GPAA 4B45A 3MT0A 2FOXA 4MQEB 3LQYA 1KJZA 1Z06A 3W05A 4QYIA 1FRZA 3QFFA 3EIFA 2QRVA 3RYFB 3O21A 1ZHOA 1HGXA 3HP7A 2QD3A 1ITZA 3ZCSA 3CE6A 3PR1A 3NHBA 3LVQE 1Z0AA 2EKZA 1RYYA 3ICCA 3VPSA 4DJEC 4LF9B 2EVWX 1RXEA 4MDYA 3WWDA 4BFWA 1D8AA 2I2XB 1PKEA 2NPOA 2H7VA 1OWOA 2LUOA 2R5NA 3DB1A 1JBKA 3NYRA 4BJHB 4BQIA 4HC4A 2NPIA 2IHUA 4RK5A 4JZYA 1YA8A 1ZJZA 5K3FA 2WNIA 3ZHRA 4URXR 4R8RA 4RKEA 1EVEA 4ZYWA 2BHNA 5HKKD 1WU7A 4K8RB 3SVLA 1O95D 1Z18A 2QRHA 1AQYA 3E9EA 4MIYA 2C84A 1M1NA 2VDJA 1GZVA 2I7TA 4HDKB 2ZJ6A 3NV9A 4D3FA 2QV7A 3IOYA 4G4SO 4IEIA 2ZCJA 2YMLA 3VJKA 5ALVA 5FQNA 5CLLA 1M1YA 3X3HA 1ZHHA 1GTMA 1NIJA 5AM3A 2V9PA 5LJLA 5IC6A 1G6OA 2P77A 3OJLA 3W34A 3QZUA 1E5XA 1ULHA 1E7RA 1NI3A 3WQSB 1UPTA 4IL5A 5AM1A 3LQ1A 5IASA 1F9EA 1S2NA 4FXPA 3SQOA 1O03A 1VIMA 4IJQA 1INLA 3ETNA 3PLRA 4ENRA 1G63A 2BBOA 3QV2A 3UW1A 5CW2A 5I7AA 2GCOB 3DZCA 2OLKA 2WVAA 4LHSA 3VNVA 2O1WA 2WM9B 3CGWA 1SIBE 3F9RA 4ZRMA 3TB6A 2N3ZA 1NN3A 1B8UA 1T4DA 3CLKA 3IE2A 3LYHA 4DLNA 1TVEA 1ORRA 3AESA 1HYEA 5DNAA 2OV1A 2EW8A 1PG2A 4E12A 5H16A 5BNTA 1TEHA 2HA3A 2J9XB 5EYPA 2CXOA 2I7DA 5ALFA 1CJKC 4YONB 3U4IA 1USVA 2CLFB 4A8TA 2C61A 3WJ2A 4LWZA 2WB2A 1Y4AE 3LWBA 2ORWA 3K2IA 3P9RA 4ZCTA 1T34A 6ABPA 2H3HA 2Y8EA 4P31A 1F5SA 4N3BA 3C7AA 2X41A 5C18A 4KWCA 1Q7TA 2WT4A 1DIHA 2YC4C 4WIAA 5BQXA 3U61B 5ALOA 1UDWA 1QFXA 4LV8B 2OSVA 1S5PA 3GRFA 4EUKA 4D9KA 1L3IA 2R2AA 2UYCA 2ZJZA 1JEQB 1TYZA 3UTDA 1BE0A 4A16A 4CKEB 1UEXC 4OYRA 2PKQP 3G0DA 2Z6VA 3FHCB 2QE6A 4ZTUB 3I62A 3FDFA 2I3GA 2I6XA 1QH1A 3MT9A 2H7YA 2BH9A 3IPAA 3NB0A 2W6IA 5D3QA 5DTRA 4CM8B 4ZJPA 1AIPA 3EPHA 2Z8YA 4ZOLF 5I7OA 2G88A 2ISQA 4FR5A 2DHQA 1GKKA 3UG6A 4O1MA 2R8RA 1XI2A 2VKQA 5GWXA 2PMKA 4HDOB 4DARA 2PQMA 1YCHA 2GO1A 3KVVA 4G89A 2QTVB 2YWEA 3AEUA 3A1WA 2CVQA 5IC4A 3BL8A 3SC6A 2DRIA 4F60A 5GAJA 1EVLA 2HSDA 3AHFA 1S1MA 1YDGA 4KREA 1VHDA 1A7AA 2AXNA 2PLRA 3NH9A 4Q3KA 4LXXA 3DL4A 1C14A 1RYNA 2V7QD 5F1OA 4R4JA 3R3UA 5CEFA 1CV2A 1JKIA 1VL0A 1ZIYA 1R16A 3P9XA 4DANA 3VSBA 1P2SA 3KVOA 1L5WA 4PO9A 2X6TA 4CYMA 2OLEA 4W7HA 1SOWA 1CR4A 4XJXA 4ZEMA 1XDGA 4ZZ2A 4C6RA 1GGMA 4AW9A 5FRDA 4XLZA 4HAWA 4J90A 4ETMA 3PV0A 4GPEA 3WLFA 2HC9A 4URVR 3SN6A 1RRFA 2BEUA 4ZDIA 1XRNA 3M5PA 3JRWA 3RRNA 4I9GA 1Y9EA 4B17A 4MR9B 3KQVA 4Q9NA 4PAMA 4V24A 4DR3B 2OESA 1AXEA 5EQFA 2V98A 4NJEA 2EL7A 2H4YA 1T9DA 3CNEA 1PZNA 4KI0A 4TYPA 3GR6A 4ZQGA 3FMFA 5AJXA 4QG3A 5EJ6A 1C1DB 1GUDA 5HKBA 1CUEA 1H3EA 1OX6A 2FETA 2A0XA 2P5UA 4CL0A 5LXTB 4RF4A 5AKIA 1JLLB 3U2QA 2L69A 1PJSA 4DVJA 1MB9A 2ZTMA 4AKEA 2DR3A 1KSGA 3L1VA 4O2BA 4PYMA 3WWPA 4REQB 4CIWA 1QIJA 3D1LA 5CHYA 3C5EA 3D6TB 3K35A 4OG2A 4TM7A 1FFCA 2ODNA 3F5DA 3I0NA 4RD6A 5LA6A 1J24A 1ZOOA 5IN4A 4CFZA 1JJBA 1QYRA 1RBZA 1IL0A 2Q2NA 3HUEA 5E1OA 3H8SA 3OUZA 1O57A 6GPBA 2BH2A 3DOOA 3ETEA 1WX1A 4XVUA 1CZKA 3URKA 3X1XA 1DARA 4ZU1X 5A0FA 1Z7YA 1EQ2A 4NIMA 2I03A 2VNKA 4GR4A 1A0OA 1RXIA 1V35A 1S2MA 3R7FA 3K0FA 3GXBA 4G0PA 1HUQA 3IC5A 4S1VA 3KOXA 5BNZA 5EHIA 1HLGA 3HR8A 1P0IA 1WIWA 2XHZA 4JP3A 1L4GA 4NS1A 3D2CA 4QUGA 4BUZA 1XEXB 4LJKA 3QKSB 3FTDA 1W52X 2Y77A 1Y9AA 3JAWB 4MHSA 4G1UC 1CB7A 1RRPA 3KXDA 3MVEA 4I14A 1XCPA 1GNPA 4MV4A 5DTJA 5EERA 3L0BA 2A9KA 1B0ZA 1KBQA 5AHOA 2QBYA 1KZ4A 2H4ZA 3QTBA 3F97A 2CCJA 2ISCA 2H5JA 4JOCA 2XQVA 3CLRD 1MJFA 2DWCA 5LBIA 2Z2YA 5AXDA 3U0VA 3ZXIA 5B6IA 5CAEA 4F04A 3NBZC 4ESVA 1KS2A 3QYPA 4PRZA 1C0EA 3CX4A 1PGQA 5SYAA 2XRYA 4NU8X 2G4LA 5GJVC 4QWMA 1TM7E 4GXNA 5E3IA 1X7DA 2WSSD 2YOHA 3CKLA 1FNDA 3I04A 4J2OA 1LLUA 2GVNA 4LQCA 4H6WA 4UTRA 1MJNA 2HBYA 2PV0A 3MOIA 4MWGA 4EKIA 3LYLA 2B98A 4WZBA 3U3KA 4MEBA 3WQBA 2GPAA 2GYUA 1YBAA 3LGXA 4C0LA 2J4FA 2FMXA 2BMDA 3QUBA 4LJ6A 5EQDA 3T99A 5C8ZA 4BCCA 4ZPJA 2YTZA 3IHWA 4Q34A 2G0TA 5CPBA 2YMQA 4WEQA 3KQQA 3PU6A 2D7DA 1XZCA 3AUUA 3JR3A 1WQ4A 3MZ0A 4EEXA 3JASB 4HH4A 5EMHA 4AJ1A 4M8KA 5L3SB 1PT7A 2EFDB 4MV8A 4YCCA 2C4WA 3BORA 3F6RA 3TW0A 1WBDA 4E33A 1ZK3A 4W6QA 4AZ0A 1U02A 3FDXA 4Q9IA 2V6MA 4J3NA 5K8TA 4HB0A 4B3MB 2C04A 3G6KA 3DA8A 3I37X 1EBUA 2C9DA 4Q66C 4XCQA 2HFJA 2PZKA 4H4CA 2XEXA 2RI6A 1KHHA 4XX0B 3TEFA 3LV8A 3GVXA 1FUIA 3AEYA 4IX1A 1QZTA 4WN9B 4A8JC 4DQXA 1H8HD 3B3FA 3Q72A 2ZIFA 3UFXA 4E0BA 5K0EA 1TCBA 5TY0A 1V8PA 1WTCA 1B1CA 3OZRA 3GCGA 4UBLA 3FNRA 3ITDA 5AR1A 5K8UA 1CT9A 4WVFA 1A69A 4D0NA 3H1GA 1XP8A 1ISFA 3AXTA 4PFQA 1RYEA 4AWAA 3HCCA 3NW9A 4GMHA 4AF7A 5JWRA 1GJRA 4ZOLA 4BFVA 2WWIA 2FX5A 3EFOB 3IIKA 4CEHA 1O3YA 1P1HA 5ECYA 4F4FA 1X0XA 1Q6YA 4MVJG 2RGBA 1TL7C 2EBFX 2PAFA 2VIIA 5K7SA 1XZIA 3M3HA 2OILA 3KETA 3ODPA 3DO6A 2DFLA 4NULA 5BNFA 2KWIA 3DGEC 3DVQX 3WL8A 4LNUA 4P34A 1IVNA 3FFWA 1Q92A 1E9AA 2YKGA 1XD2A 2ODTX 2K4MA 3WWYA 5MDHA 4B2YA 1SVOA 4IR7A 3CX7A 2KLBA 4LOIA 5A5GA 3CIFA 2ZJAA 1D2GA 4D9CA 1Q77A 1G64A 2C59A 1FNNA 4M0DA 2WUFA 4H0FA 2EP7A 2EATA 4PLHA 4OAQA 2PV7A 3KEMA 4WZAB 2GMWA 5TX7A 2WJAA 3KQPA 1XTKA 2EERA 3W5UA 2Q50A 3TFQA 4BP8A 3OZWA 4DR6B 2BYTA 4F8JA 3VRHA 1QVZA 3OD5A 2CXNA 1Y3DE 2I2WA 3BH6A 4N12A 3TMKA 3WLLA 4DLPA 5K8CA 2PGJA 4F5EA 1FEZA 2YFHA 4U6QA 2FE1A 1YA4A 1HT3A 1E4VA 1UJ4A 2YR0A 3UWSA 3FA2A 2IF0A 2G9UA 1SVIA 2OM6A 2VF2A 2OGZA 5F1YA 5K1ZA 2QPAA 4YCMA 2B3TA 3IELA 3PXAA 3VNBA 5IMBA 4DSAA 3R0VA 3H2HA 2ZTLA 4I8XA 4XM0A 1F0PA 4LOAA 1FQJA 4AJ2A 4EQZA 4YDQA 1OH5A 4WK0B 4OAPA 3L8CA 4FYHA 3WFIA 1YT5A 4CDGA 1GN9A 1K0FA 1CXZA 3ZJTA 5LB4A 1YVDA 3EE6A 3G6WA 3N5KA 5FEMA 1XXHE 1JQ3A 1H0HA 5FPKA 1XNRB 2L42A 1U8XX 3A2KA 1PZXA 1E1NA 2ZRJA 2W8BB 2KBEA 3V55A 3HI4A 4UATA 3TCXB 3LL7A 4K0KB 3BSFA 4MMYB 2OEPA 4AMBA 4B6SA 3ZZNA 4E5KA 2BR3A 3WNDA 3WDLA 4U2GA 2K7FA 3VYVA 4F46A 2VXOA 4FKZA 5K20A 2OUKA 4HGOA 4NK5A 1E1DA 2IKQA 4AY5A 1IBMB 3BAZA 3I53A 2AKEA 1IY9A 1LX6A 3GT7A 1Z33A 3WQRA 4B73A 5KHLB 3UB3A 3FSRA 4C0KA 2ZB7A 2WU4A 4RY8A 5FDFA 3AL2A 2LKDA 3LC1O 2D06A 2K2QB 2WUDA 3IYLW 1QYVA 3PHIA 4K0RA 4JKYA 4W5WA 4ZTBA 4ERNA 4F7WA 3DO5A 4IBOA 2BGJA 2XWBF 3WA7A 1ZGBA 3GJ4A 4HNRA 5DN6A 4US1R 5DPMA 4QM6A 1ISIA 2YMMA 3OJWA 5JE8A 4NS4A 3FWZA 1Z5OA 1VJTA 2Q4OA 4XR4A 2J7PD 5T64A 4O0MA 4PZAA 2CW5A 3WGGA 4TWRA 5G0WA 3TNDA 3KYIB 2DSTA 4U0JA 1GQQA 2ZIXA 1PL7A 1HO3A 1Y1PA 2OCIA 3A10A 3O1JC 3RIGA 3DF9A 3UM9A 1JHRA 2QRVB 2QSJA 3H13A 1O54A 1FFAA 5CBPA 3DDOA 3GLKA 3RRZA 3Q8KA 3B85A 4G5FA 5GV7A 2J7KA 2W2OA 4M0CA 1XOIA 2XUAA 1PR2A 1CQZA 3EGWA 3CURA 1WQ1R 3QHPA 4O8CA 4JT2A 3BHJA 4G8CA 1VOTA 4ACAA 5JRZA 4OMFG 4ZMRA 5FI0B 3MAAC 1JH8A 5HX7A 3CV3A 3BJZA 3PI6A 2PMFA 1E94E 1JHYA 1SR8A 4G67A 2W42A 1PJQA 4FZRA 4I2NA 4JLAA 3VDQA 3W4KA 4I66A 3QPWA 2YYYA 3PVSA 3A9UA 1E5LA 3AJ8A 2L2QA 3IKMB 4FR2A 1NBWB 2CNDA 3L0DA 3RS8A 2V6JA 5LP6F 1LF5A 4GOKA 1SHJA 1X13A 3ZHVA 3AKDA 3EIOA 4CTKA 3P27A 2QTMA 4PAOA 4PG8A 4NEHB 4MICA 4HWKA 1VE7A 4K7JA 1ZX1A 1FTQA 1JHMA 5H3HA 2F8TA 1X1RA 2Y1CA 4NENB 3PQ7A 2Q7OE 4MRSA 1ENPA 3OCCA 3Q7PA 5JSUA 3AEXA 2BKXA 3BGWA 4EMUA 4HWTA 2BFCB 3ZI4A 1SXJE 2Y0PA 4OL9A 4PF1A 1G6Q1 2JGFA 1LDYA 5EKXA 1USGA 4X7PA 5EP3A 2G1KA 4G5YA 4QJ4A 1TZBA 1NGSA 1XV5A 1Y1SA 5FL7D 4E09A 5AKEA 1LRLA 5F33A 4MW7A 5DIFA 5BSUA 4IZ6A 5KX5B 2H4WA 1J2TA 3FPKA 3EZLA 3JYNA 2BFAA 4PNZA 1YKFA 4Y18A 4E4TA 1TA4A 3OEEA 4YRSA 1CR0A 5D5QA 1OE0A 2B21A 1L3CA 3CN9A 3FRIA 4K9QA 4CMBA 4D4IA 1CETA 4YRQA 4KB5A 1Z2NX 1YHYA 1A8PA 1XELA 2R5WA 4BZWA 3HM2A 1TFUA 1E79A 2D0IA 1J9EA 2QSZA 2W2KA 3EGDB 1KOFA 4ND5A 2RGUA 4G4GA 2V7BA 4O0LA 3BPSA 1R0YA 1ZC4A 3A4VA 3NDJA 1Z4LA 2I4IA 5HFJA 2E49A 1QZZA 4CQMD 2QLLA 1P61B 1VJCA 2E55A 1YZVA 1QG6A 5D51S 4BNFA 2GT1A 1F2TB 7REQA 2QRMA 1RPNA 2IEZA 3DEZA 3H04A 2CZCA 2FLKA 5ISMA 2H4FA 2E1RA 1CCWA 2W4MA 2TS1A 3M6WA 2E6UX 4HD8A 4WNAB 5GINE 3HKBB 4MV6A 4DG5A 1MOPA 3A06A 4Q39A 1GCUA 5LU8A 3IDFA 1DINA 1DTEA 1GA6A 3I72A 3O2JA 4M1WA 3NOXA 4N7RA 4O4IA 2ZRGA 3MUEA 4WY2A 2J0EA 1F2VA 7AT1A 2R84A 3L18A 3JSAA 3QVGA 2P65A 2HRDA 3GLVA 3OPVA 5FBWB 2AOTB 2Q4BA 5TGDA 1PQPA 3T3HA 4ZCLA 3ANNA 1XQ9A 8OHMA 2C5LA 3R8XA 4ZO4A 2ZT6A 1D1QA 2C1EA 2X9LA 1KO5A 4PCVA 3VX3A 2Z4TA 3KTDA 2QZ9A 3CJQA 3P5SA 4RIEA 4UDXX 1L7XA 2V4UA 3AR8A 1K4KA 2O2IA 1GGFA 3MRTA 1EVYA 3FYDA 3DT6A 2NTNA 4RTLA 2NZ8A 4QQRA 4RSGA 1WZIA 1N9ZA 4Z4IA 5JFTA 721PA 1V2GA 1XLTA 3PNKA 1FFXB 3LM8A 4QTTB 3QX3A 1FVOA 4QVKA 4EAAA 1PIWA 1U5BA 1XYGA 3CF4G 1EJBA 4G2NA 2JBAA 1C3JA 2QTWB 3SX4A 1ZISA 1YIDA 2ZBGA 4Z0TA 5IT9A 1L7NA 1ABEA 3E61A 1RYBA 3AF3A 4MYTA 4AL4A 1PWEA 4QELA 5AVJA 5TVKA 2HSZA 2IVZA 3OA0A 4WLVA 3LDAA 2BKAA 1E1CB 2ZYVX 3O1IC 4CM8A 1X1EA 4PC1A 8AT1A 1FPQA 5G02A 3RUDA 2IHJA 3FOWA 3CGGA 1TAQA 2GASA 3RSQA 5AI0A 3L7AA 5F12A 4X20A 1NJGA 2JI9A 2I2BA 3MINA 2VSNA 1RXSA 2PX8A 1G16A 1P4AA 1ZH6A 2OHIA 3C5CA 4JUBA 2OZEA 3KKZA 3K4PA 5UKDA 4Z9FA 4CMEA 1JLRA 3BQNB 4YP7A 2W2MA 2HPAA 4HB4A 3REQB 3Q0EA 4YALA 2VUUA 3FHJA 3VR4D 1K68A 1Y98A 3FFXA 4RS4A 1RM4A 1L4MA 1W85A 1N0WA 3QVMA 4WOBA 1N1GA 1Z0FA 2HK9A 1NNLA 2XTAA 3GNQA 1BXZA 4YAWA 1TZ2A 4KRFA 4GIBA 4TL8A 3DCYA 3DPIA 5I9SA 1OA1A 1J1ZA 4IEEA 4Q5IA 2PGXA 3I2KA 1FP4B 2E4UA 3A1CA 1ZN8A 4HZIA 4QOEA 4LYYA 1PWYE 4YAJA 2I4OA 3OCYA 4KTVE 4V02A 3VHQA 5JS1A 4I1OA 1MEOA 1YIOA 3G9ZA 2XADA 2GZSA 4MRAA 4BKQA 5BQOA 4M1EA 2RH9B 5FWDA 3ZQJA 1Q7EA 1L1EA 2XE8A 5DGIA 1TJ4A 4E51A 4TQGA 1LDGA 2QUIA 4Z86A 5FLYA 5JVDB 2ZU0C 5AW5A 1G8JA 2VHVA 4LRQA 1ZUIA 4Z2YA 2Y71A 1YDWA 2VBFA 4I1UA 4MX8A 3MGAA 2GJKA 5A4AA 3LQFA 5AQEA 4AKTA 3O75A 4MI6A 5EESA 4NC9A 1XEWY 3LWNA 3IUSA 1SOAA 3SC2B 3NAGA 4YYEA 5IJXA 3SSMA 1RWKA 4YMUA 1IK6A 1QB8A 5IDVA 3F78A 3K5WA 4FD2A 1GP2A 3PA8A 1QTNA 4QBHA 3K9NA 3LLCA 3NAQA 3OTHA 4DJTA 4NBUA 1M9NA 1KEWA 4BB5A 2K5UA 1QO0A 2ZFUA 4ETNA 5L4LA 1LZKA 2IE8A 4E5PA 4R68A 3H7AA 2JA2A 3L0SA 5CCBA 4H6VA 1IPEA 4CM9D 4MJXA 5FBVB 1ZVVA 1FMJA 3MJDA 1WOYA 2X3UA 3MWFA 4BMXA 2XVYA 3SQMA 4AK9A 4C4SA 3CPHA 3B1FA 4RYLA 3FZGA 4BO2A 1OXTA 1T91A 3ZY3A 1T5HX 3RRBA 4CE6A 1AK9A 5HUQA 3Q1LA 1RQRA 5TV2A 3ITKA 3IO5A 4K9KA 4MR8B 2IYAA 4PN7A 2HHAA 1W48A 4YJ2A 4CEJA 3F3KA 1PDVA 1TF2A 4HJRA 4BQPA 2C07A 4PPYA 3ZJ5A 3PGKA 1AUPA 2EZ9A 3B1KA 4MVJF 2XUQA 3CKMA 3TZEA 4OREX 4UBOA 2O19A 4U39A 1WWKA 2F90A 4X91A 3HU2A 1R9NA 4GGPA 4BNJA 4OBEA 1BS1A 3ZBTA 3CW2A 1TCUA 3K4QA 3A6FA 4EYEA 5DNCA 5HFNA 1T9GS 2B35A 1K9VF 5MFZA 4IFEA 1E9EA 1IE3A 2AJTA 3CW8X 2GAIA 2WKRA 1TMGE 4Q4AA 5AXCA 4PZDA 5JPIA 1GGJA 1QTRA 1VYTA 2ECQA 3BMNA 1TM2A 3MCTA 2QRGA 2FW0A 4F1KA 2O8BB 4XAQA 1N3LA 4BNNA 1T36B 1G21A 1P0PA 1TD9A 1WTAA 4ZO6A 4KE9A 5EJ2A 2Z56A 4KPFC 4M0PA 3IAM1 1FMTA 1ZIXA 1LNZA 3TAXA 2EFEB 5BXQC 2I4TA 4ND1A 2ONCA 3COZA 5I3ZA 1J5EB 5JDIA 3G1WA 5DFAA 1MG0A 3PVCA 4P8RA 3SJUA 3UBTA 2OGSA 2G40A 5DHAA 5CTJA 2SCUB 4LZWA 2FRDC 2I9PA 1FSSA 1YXMA 2Z2JA 3MMZA 4UPEA 3GK3A 4YR7A 3T7SA 3C6ZA 5T6MA 1EXWA 2IZ0A 2YNMC 4RUKA 3BFPA 3RIEA 3OZUA 4UXJA 1S96A 1Q5PA 3EFHA 2HGZA 4HAIA 5IC5A 2EU8A 5BSFA 3WGIA 1E9VA 2VHJA 3TI9A 9ABPA 3OM1A 3LFTA 5BT8A 1E3JA 1N6HA 2Z8YM 1TUIA 3AEUB 4GZ3A 3L7NA 1KZ1A 1RWVA 4GDFA 5IDQA 3HP1A 2VK1A 4ZOQI 4RKFA 4D8UA 3MBIA 2YHBA 1EZZA 3DWIA 1MF7A 5D00A 3ZIDA 4Z1OA 2BP7A 4URWR 4A6XA 2ZB8A 3MIIA 3P96A 4MRMB 2C4VA 3IKTA 2VDWA 4WLEA 5BMOA 3K5HA 1IN5A 5L3SA 2CGEA 3GEGA 1L4KA 4AKHA 3L7JA 4LNHA 5G4LA 4TQAA 2ZRKA 4W8OA 3LC7O 3E9YA 3CKYA 2C9BA 2JI6A 2EIXA 2O1EA 2QVXX 2DKNA 3PHBE 4QEDA 3W77A 2OVBA 3LHDA 1AZSC 4YRIA 3GRVA 3NWJA 3WGTA 4PYNA 3GLHA 2IJGX 1ISGA 3A4NA 1DLJA 4C2AA 5JJCA 4DJDC 4AO7A 3QYJA 3JQGB 1XIVA 4L7VA 1F17A 4GG1A 1NOKA 5HNKA 1T3LA 2LKCA 4Z54A 4EO7A 1NUUA 4EDFA 2WYVA 1QPBA 1G2QA 1O94A 2W48A 2ZS9A 2FQ1A 3L1IA 4KLCA 5DI9A 4RVOA 4WDQA 4BBZA 1NYTA 1YJBA 4PO8A 2B4YA 3TSZA 3BM5A 3FNIA 5E6SB 4F4CA 3DCJA 4QBGB 4ESEA 3RR2A 2JJ2D 3LOPA 1VG9B 4N82A 4N65A 2IW3A 2ZBFA 3FG9A 3JQ7B 4P7KA 1ZCFA 3QPCA 5AOCA 5JSZA 4QJIA 4RA9A 1JA9A 5G40A 5HKKA 1OBFO 2H11A 3FR8A 3E7FA 4L9RA 1KQNA 4IO1A 1KL7A 1YR6A 4AZSA 4F2HA 1P17A 1KJIA 1JLSA 1KXJA 1RJFA 2WIKA 4XPIA 3T3EA 4ZT5A 2LP4Y 3KJIA 3V48A 1JKXA 1IHUA 1CLUA 3R3JA 4JBYA 4HT3B 5C5DA 5EIAA 1K4YA 4B3JA 1H4VB 2O07A 1D2HA 3E7XA 4I1SA 5LJIA 3RSCA 2FWNA 4GT1A 1DFHA 3CH5A 3WL6A 3ZLVA 1G8SA 1ACLA 1C9YA 2FPIB 1ZXLA 4MGKR 5GQSA 4FB4A 2WV9A 2QLTA 4LWOA 1B15A 2A4KA 3K8OE 1Z7EA 2DH6A 1LC3A 1PT9A 2XVMA 4JJ7A 4JOSA 4Q93A 4YT5A 4B6OA 1SQSA 4II3A 4X7MA 1ODJA 1OV6A 1T35A 1VCNA 2WTNA 2QK4A 2ZJFA 3DE3X 3FLBA 3HVUA 4BC1A 3KKKA 5BSGA 1EWVA 2CBGA 4RPCA 3WYFA 4EW3A 2XECA 1XVVA 4D25A 2NU7A 3ABQB 4XWYA 2HN9A 1COZA 5EIWA 3UB4A 1N8KA 1LJLA 2XMBA 3RK4A 2VJLA 3E48A 4KIWA 1RRKA 2Q2VA 1VLZA 2GF9A 3EODA 3T7AA 1E1RA 1P5ZB 2G25A 1TF7A 2PBFA 1Z16A 3H6HA 1WUYA 2AG1A 1JI3A 3H2KA 4OLJA 4DMLA 2VNSA 3PC7A 1JFFB 3I52A 4FMDB 5ALYA 5KOHA 1C30B 3U7QA 3CG4A 1EUDB 1EP1B 5F64A 1Y8AA 1M8KA 4UQOA 1YZLA 1CUUA 1NVEA 2A33A 2C9YA 3QVTA 5J2TB 1QIMA 2HYDA 2O7QA 4UTPA 4ND8B 1Z82A 3P45A 3WBKA 3AI1A 4MPJA 2VAXA 1JYSA 4ZYTA 3V80A 3NIWA 5DULA 3IEPA 2OC9A 3F96A 2HIGA 1IBRA 1DO2A 1UDAA 3RTAA 1N5IA 1YUNA 3VH2A 3WLQA 3AVVA 2GXSA 3R40A 5I7FA 1HR0B 2VJKA 5AIAA 4YJ2F 4W99A 2DEUA 4WKPA 5F52A 1XVIA 3BEDA 4B4WA 3UJ6A 3ZDBA 1P5RA 2ALJA 2C0PA 2AF3C 2NO7A 1G41A 1IJKA 2XJ4A 3PG5A 5FR1A 5LUBA 1R5OA 5AW8A 1AKRA 5KYTA 5TQ2A 3PFCA 4OYLA 1I4DD 4DCTA 1IQRA 1ISJA 3CRZA 3F6PA 3E53A 4B6FA 1SN7A 2XDQA 2ONKA 1B00A 3PQ4A 4MNTA 4DQVA 1PR6A 2FV8A 2AFRA 2JAXA 3PHJA 1E1RD 2EC5A 4CT4B 3BIFA 3A25A 4LXUA 2XWPA 1H2EA 3I5UA 3MCWA 3ROFA 1XPOA 1N75A 3UPTA 3OFNA 2FH5B 4LV6A 5CXUA 1ONNA 2MSDB 4RVSA 4N5NA 3HV2A 3GLFE 1CFJA 2WLTA 2GHIA 2DP4E 2O2GA 5T7BA 4MB2A 1EJ0A 4URZR 1Q1AA 1E6EA 2GFQA 3K0AB 3INRA 2F9LA 4FPXA 4KI7A 2X0KA 5C8XA 5LCXA 4H59A 4BTVA 1KIFA 1NZDA 4EH1A 3GHHA 1JLKA 5KDOA 1DIBA 3EGDA 3PGMA 1BDJA 3FRHA 3JATA 2GZDA 2IY8A 2Y66A 2C8LA 3CQ9A 4NH4A 4RMJA 4ROSA 5CFZA 1P74A 3O2SB 2EJUA 4WFIA 1O7JA 2FCAA 4HS4A 2CL7X 3NP7A 4RLFA 3V8RA 5I4KA 4LFAB 1WSAA 3RYCB 2EKBA 4D4MA 4G01B 1UT8A 3CZPA 3EXHC 4G1FA 1MEEA 4IZHA 4U2BA 4BU1A 4CL3A 3S99A 2HLDD 3IBTA 3LC0A 1QE0A 4LI3X 2BY4A 5BWLA 2V3VA 1W5EA 3GIWA 3DE4X 4MCHA 3I73A 1DOAA 1OKKD 2GD6A 3EZ7A 4DR5B 1YK0A 4JV5B 1G3QA 3D0OA 1HI9A 3HL4A 3NTXA 2FEMA 2ZVQX 3A6KA 2ZETA 4AJLA 1REQB 3RHTA 2HJVA 3L0IB 3ND6A 4FIZA 2WY2D 3VAZA 4YRDA 2ONZA 4B80A 1LRJA 5EZYF 3HKEA 1VL1A 4OP1A 1CWUA 1D2MA 1BVUA 1CDZA 1EH5A 1LTQA 1KJNA 2E37A 3DOEA 1GA1A 2OBFA 3C1TA 3MLAA 3NASA 1I7NA 4GBGA 4GVXA 3Q11A 3O8QA 4HDSB 2YJTD 2CFTA 3RVDA 4E6PA 1ZM4A 1CUBA 4PYLA 1GPNA 3DXZA 3GLIE 3O82A 3TTWA 3E1SA 3OMLA 4BGVA 2NMVA 2LCFA 2RGDA 1I7PA 4GUAA 3RDPA 1KHTA 2P7HA 1R9GA 5G4KB 4LF8B 1R64A 4V3CA 3JYOA 2BCEA 4B7ZA 2GERA 3TFOA 4R16A 3QF4B 2FRVA 1L5HB 1JVNA 3OD1A 5AK3A 3NHPA 1U6IA 1WKCA 3DT9A 1RIFA 1ZNQO 2HY7A 3HSYA 4M9UA 3GCWA 4CG1A 4GQAA 2ZI6A 3WR5A 4BNDB 4PSDA 2ZPUA 3VBEA 4D46A 5I6DA 4FOSA 4MIOA 2GFIA 3FYTA 1I94B 3OOJA 3PA6A 1QAOA 1CUDA 4KXMA 3UH1A 4BP1A 2AXEA 2TMKA 1OYWA 1Y5IA 5E9QA 1UZLA 2HRRA 2WJYA 3LXRA 1T9GR 4HMQA 5IVHA 1L5HA 4CMIA 3BF8A 3JVVA 1JEOA 3ZE9A 3D3WB 3FY4A 2DMRA 3VNSA 4NPAA 2ZAMA 2G4CA 2D5AA 4X6LA 4E07A 2D1YA 4D44A 3KSDO 4P2GA 1SELA 4C5AA 5A5VA 2ZYWX 4LJLA 4MRPA 2BR5A 2Q6LA 4DLXA 1ISHA 3NHUA 4GMFA 3KQWA 4X7RA 3WAKA 1DKPA 4DNPA 3FZNA 3SS9X 2C9OA 1WS6A 3SZ3A 4B32A 4EJMA 4NBSA 2R6JA 1UH5A 2J5BA 1XRPA 4GMGA 5JU6A 5JSYA 9LDTA 2D3WA 1SKQA 2WP8J 3KKEA 1ZK2A 4PAWA 4YJGB 4Q9KA 2Q3LA 4D96A 4YRZA 1TUBA 3H75A 5CGZA 1SH7A 5LNK1 5M29A 2JLVA 3VR5A 2HJGA 2I9KA 3SYNA 2R9VA 2FPKA 1EM6A 2HX1A 1J09A 2NXWA 1YHNA 5GZ1A 3A14A 3FGOA 2GBGA 1M2HA 2OZPA 4LRYA 3Q87B 4ITUA 1WHSA 4LOLA 2P3OA 3MRVA 5TT0A 4N6NA 4L1KA 4MPPA 4HAZA 1YMVA 2DGDA 4L15A 1GPUA 1CIJA 4C7OA 4G41A 1CY8A 3SLKA 1Q0HA 3O8RA 3JQAA 3BD8A 2P5TB 3DS8A 4NJEB 3U49A 1BGVA 4C7KA 2ZIGA 3WMWA 5EVJA 1X39A 2F1IA 1DRWA 1OLOA 4F6RB 1X80A 4J2TA 1F0KA 1EU1A 3WV4A 4LSMA 2F67A 3S29A 1E2BA 1SVMA 4Q4CA 1CE8B 3D3QA 2G04A 4LXTA 2Q1YA 3VPBA 2PRIA 5DGCA 2JKYA 1N1EA 5D85A 1KO7A 3AILA 2GGSA 2P69A 4JN6B 4R98A 1KS9A 3PNOA 1O87A 3SQXA 3FJ1A 1U0SY 3AI7A 4NZOA 5FTKA 1ZJ6A 5KWEA 4EF4A 5TIIA 5DNVA 5J23A 1HDGO 1POXA 1OFVA 2FR0A 5JQGB 1NFRA 5AJYA 5HM8A 3PNBA 2XDQB 3E2IA 3SYMA 2BEVB 2QB5A 3AEKB 3TIGA 2XZPA 1IB0A 2QY6A 3VDNB 1SG6A 4D5EA 2JGRA 5C4GB 2XOKA 3VU9B 1WZCA 3WLAA 3I6BA 4RDXA 3O94A 3TWOA 3WHPA 4BEJA 3VR6D 3C3XA 4E7PA 3AW9A 4B3CA 4C9BA 3GLHB 4IY1A 1E18A 1NW8A 3ENQA 4FE3A 4ZWNA 5PNTA 1EB9A 4UULA 4OKIA 3WLPA 3HQ4O 3HXMA 2VAWA 2QVLA 5AO9A 4ZRNA 2QL5A 4BEWA 2BMJA 5C1DA 2HT1A 2V45A 3GRKA 1ZZGA 3O8NA 5BV0A 1VYUA 1N7JA 4US0R 4OK6A 4KXUA 1P1CA 4KH1A 1SA0B 2XW6A 3L7IA 3O74A 4FYIA 4JJ6A 3N6VA 1I13A 4MQFA 2E9SA 2PPVA 4MR7B 2LIVA 4FD3A 2XBUA 1A2KC 1DS6A 1WY5A 5KNCH 3ZJVA 3HYCA 4OJYA 1FU4A 3B53X 1BMDA 1AMOA 1Q7GA 3ZLBA 3MB8A 1TJYA 1U0NA 4U7TB 1HTBA 4XGKA 4ZVQA 2VAPA 3E35A 3TQQA 5E9AA 2IYUA 3C70A 1CUGA 1MOZA 2XOXA 4IOLA 4M6WA 4C05A 3RREA 2Q2QA 4KQXA 4F4IA 1SQ6A 1ZL0A 3R6DA 1I2DA 4ZVVA 1QVWA 1VPEA 2DAPA 4G3XA 3VVMA 4DNFA 2XOKD 3CLTC 4CLHA 3WJ7A 4Z5XA 3OQ6A 4AICA 1ZI8A 3GJ6A 2P4SA 3VX4A 4B74A 1S4MA 4H7FA 1GVHA 3L8YA 5B3JC 2DTDA 4ENQA 1GDTA 3K9GA 1ESEA 1NKSA 2J85A 1Y42X 3AF5A 4NJMB 2VHXA 3AY0A 2FP3A 2J9ZB 1T0JB 4JC0A 4Q1BA 4WK2B 4DRZA 4TVKA 3M83A 3OPNA 3NYQA 3S55A 1O58A 3VC3A 1N2JA 3O9ZA 3W1EA 4RTOA 1NQUA 2E4ZA 4GS5A 1LFDB 1LU9A 1O6ZA 3MW8A 1RQXA 4X60A 5CITA 3OU7A 1QQ5A 3JYLA 3AM5A 5IN5A 4XDGA 3SHVA 5K3SA 3AIOA 3G59A 3QJYA 4B7XA 3NVAA 2OCBA 4JBGA 1KI6B 1HLDA 1WF6A 1F6BA 3IUYA 1YSCA 4QNRA 5HE9A 1LQUA 4ZDJA 4MKHA 4UHKA 5JC1A 2C5HA 2W2LA 3AR7A 5AM0A 4H17A 3VMFA 2F17A 4N18A 1NBMD 3GVPA 4R01A 2YV4A 3NM4A 2BOVA 4DQ0A 3KS9A 3FI0A 3FPGA 3NOQA 4B6QA 4U4AA 4HZUA 1E2HA 1XHFA 3S2UA 3D8BA 4MUYA 4LDRA 3AF2A 3QU4A 3BTVA 3DKRA 3S40A 3SG0A 2II6A 4JQYA 2XV1A 5HK8A 3JQBC 2G63A 2QZSA 1OXVA 2Z3ZA 1MQ9A 4YJKA 4DYHA 4BBAA 3ZI0A 3TXAA 1WV0A 1Q2XA 3UAVA 1OMOA 1P62B 5EHNA 4DMUB 2B7CA 4U9IS 4N3AA 3OIGA 3AKCA 4MP3A 2AF4C 2R47A 5MGBA 1XVTA 4TT8A 4AJNA 4B35A 5IZCC 4UM7A 4PO3X 1C3LA 4KR3A 1T2AA 4BFUA 2IP1A 2DWOA 2BM1A 2WWRA 1DTSA 5TPZA 1G3IA 4LXQA 2RHDA 2KSQA 2GS9A 1U2PA 3LY7A 4UEWA 4KW7A 4Z9AA 5NULA 3ROEA 2CUZA 3T35A 2VDUE 3KJZA 4WY8A 1NY6A 3OZEA 5IYZB 3QA3E 4KYIB 1W36B 5CFQA 4KCGA 5ICEA 3MJVA 4WMLA 4HH0A 2Z9BA 3S1SA 1FNCA 4XUGB 2H00A 2IHTA 4NV1A 5FEUA 1TM1E 4BBPA 2R8BA 1K6XA 1VRCA 1R4AA 1S1CA 4TV9F 1PYGA 1XQYA 4HL6A 1D6SA 4Q3AA 1G7TA 1U3DA 1WBJB 4TS3A 3RRFA 3VTAA 4DLZA 1K88A 5BR7A 1AH2A 1EXVA 2PXCA 3N0TA 4PQYA 5DTIA 1RWMA 1J06A 5KTKA 2G70A 2MYPA 3R24A 1C9KA 1MQSA 5AVXA 3TJZA 3H9UA 5E1BA 4IKOA 2AFHB 2R1TA 3KJQA 4PZ9A 4C30A 5KWJA 3AEKA 1I4TD 4CMHA 2WTBA 4JROA 2RH8A 1ULTA 3M5WA 3LK7A 1J49A 5JANA 3I30X 1AXGA 1NVVQ 4OYYA 2BGNA 3R0JA 1R3UA 1POWA 3BF7A 3M89A 2HGSA 5KYYA 5DHSA 5KOYA 2YL2A 2YN0A 3FBWA 2HV8A 3LXMA 1U5AA 3AM3A 4RXMA 1N92A 1IUNA 4JJ4A 1BFKA 1O95A 1G5RA 1GIAA 2ES4A 1J99A 1ZEJA 2C4KA 3LT0A 1N3BA 1U4SA 2OZKA 3PDIB 4EY8A 3VC7A 1JKJA 5LZ2A 3G2IA 5D6OA 3VZQA 2OQVA 1TLLA 3UNXA 3AHJA 3CZMA 5TEWA 1TW3A 3LSTA 1TIKA 4HOYA 4RK1A 1RFLA 3FJYA 4BBJA 2Q07A 3K1ZA 4I4CA 2VH5R 1HT2E 2FA9A 3ND5A 4OPMA 1M2GA 5BN4B 2JK1A 4JJGA 1IXZA 2GQ0A 3KWLA 1UF9A 3D6UA 3IJ5A 4IH9A 4I55F 4XLLA 3W2GA 4EKNB 1A97A 1VI5A 1X9GA 2BCJQ 3G49A 3OX4A 4X61A 2VNIA 4ZAXA 4BNZA 5K0JA 4C2TA 2G82A 1QIEA 1WXDA 4CZ2A 4XLTA 3IOEA 4L6CA 3G8AA 4U6NA 4M7WA 2FSSA 2LW7A 5AFSA 1FS6A 3IMKA 5JXJA 3U7GA 1MZVA 4BNGA 1ZR2A 5IJ0A 3LK6A 5BXYA 1RAIA 4QBTA 2X0EA 4QRHA 3SHWA 3COYA 3ZGOA 2W6MA 4UNNA 4O3MA 1JSZA 1W4LA 2Z5LA 4PLVA 2I3DA 1G9TA 1FJXA 2QDKA 4FZ3A 2QT0A 4C0WA 3AOEA 1USIA 1Y1LA 3G9XA 3PEVA 1GT91 4KITB 3GFRA 3LQQA 3KL4A 4WESA 4YRJA 2OCDA 1RS0A 1L5NA 4LE0A 2Q4EA 3L06A 2ZIEA 3IKJA 3PJGA 2Q3JA 4G6ZA 4J16A 4UEJA 5B30A 1O77A 4F8YA 1QONA 1Z5GA 4IJWA 3K09A 3C6XA 3FCUB 1RP1A 4P4LA 4Z0PA 5IUKC 3ZWVA 5BN4A 3BBLA 5BUQA 3QBVA 5CFMA 4NHOA 3NXSA 3ZGZA 2N46A 2WJVA 4O1IA 4LYHA 3FSGD 2GJSA 2E4YA 3ZGNA 4I50B 1TKAA 4AJ4A 1ABBA 4JQSA 4F5YA 5FIUA 3P97A 4LGCA 3RVBA 4AUEA 2J6HA 1NTOA 1XAJA 1JHAA 5P21A 3HCDA 1E7YA 4GGMX 1P9WA 2GBFA 2O3UA 2PUJA 2EDCA 4M8NE 4BVBA 3CUVA 1NBHA 4X65B 4Y2RA 1H69A 3E8MA 4W8GA 3MXTA 4WNCA 1E7SA 4DLAA 1XFDA 3L8GA 4OOFA 3ZDXB 4BMPB 4MI9A 3I64A 2O9JA 2QF7A 3B5IA 1GTSA 4Z9XA 2GPWA 4FGJA 4YPVA 4TYYA 1XT6A 2QN3A 4JI1B 4POAA 3H1TA 2Y6UA 3QUQA 3RIYA 5KNBA 5KUTA 3GRCA 3S2GA 5CB0A 2G0AA 1GTVA 3N87A 1YBFA 1JHVA 1U6KA 1BMFD 3GRUA 2R1VB 4E3ZA 2RKBA 2Q8NA 4MJ7A 2HWYA 4G07A 4FYJA 1OBHA 2DF8A 1HM5A 2P7IA 1EGAA 2E21A 3HHPA 3J7TA 3VKUA 5JAMA 4G2TA 1YBVA 3SEFA 1IOZA 1TAHA 1S9HA 4DGQA 4DQDA 4EKYA 4PHGA 4UAUA 3HZHA 3L0YA 5GGYA 2ADOA 3LF1A 4MTLA 2PH5A 1UT6A 5P8WA 4HPXB 5E7IA 4DDTA 4EQ6B 1YMUA 5L3QB 4PQGA 2HRCA 1ATIA 1XTPA 4NJOA 4QUAA 4J4BA 3DMGA 4LDAA 3MK31 4TLEA 2PRSA 3GP5A 4BGIA 4BO5A 4LHZA 4DIMA 5JALA 1CQPA 2UVQA 1L4EA 1VZ2A 1NBME 2OY0A 1HY3A 5DT9A 4ISBA 1OLUB 4YJHB 1ATZA 3MOGA 5JMOA 4WPGA 1MN6A 1A50B 1CYDA 2I54A 4Y9TA 1KETA 2Q3BA 1D6JA 3GDFA 3JQ7A 3QXGA 4RJIA 5JSZB 1Z6XA 1ZG3A 5HGJA 4U9HS 4Q47A 2BSAA 2VJYA 3BXOA 1EBBA 3E22A 3HVHA 2O2XA 3IIEA 4XUDA 1N7GA 4WBNF 5JZSA 2AKAB 1ACJA 4B3SB 5E6UA 4RETA 1J56A 5T67A 1HMPA 1UEJA 2VSOA 2OBNA 3WV5A 3R0QA 4JJ8A 2WZQA 3ESYA 1L5RA 1Y3AA 3D1VA 3M6LA 1YHZA 2G17A 4JELA 4WKBA 1CY7A 2JFPA 2OPHA 3MA0A 1ZY2A 3ES9A 1DMSA 4L4SA 4MAMA 4WKGA 4EW6A 3A70A 3KYCB 1NNUA 2FUEA 3QY0A 5C5EA 3SR3A 2J9FA 4X3PA 5D2CA 4CKCA 1MORA 1LLFA 1ZCBA 2FZGA 4D43A 4ZZ3A 4GUDA 1DJQA 2FW1A 2SHKA 4CLOB 4P3NA 5HZHA 5LBUA 2D2EA 3BGVA 4HFJA 3FM9A 5C7IO 2AUNA 4QREA 2WKPA 4ZGGA 3PPWA 5B37A 3UGKA 2V6BA 3LQRA 3E7WA 4MWTA 1GTJ1 1IAQA 2AYYA 3MG9A 3CLSD 3MS2A 4OQMA 5CK5A 3WRYA 1BAPA 1JDZA 2NU8A 1J8DA 4IHJF 4MPTA 4EJFA 2J4CA 1M6VA 4RIIA 3S1LA 2YINC 2IOYA 4WLFA 5JADA 2R85A 1BD3A 2AI3A 2VPTA 1SUPA 3QFSA 4DV5B 3OU6A 2ZI9A 2RCYA 1KTVA 1HTTA 3G17A 1TVKA 4EHAA 1NA5A 3LQ2A 4RL6A 1PV2A 3GEHA 2HHHB 4F9TA 1OXKB 4X85A 1PFKA 2CLOB 4G5OA 4M83A 5LPNA 1AK2A 2ODQA 2WFLA 4G4JA 2SICE 3TZHA 1Q91A 2VK2A 5EG5A 3L8MA 4CV3A 3VFDA 4D80A 1RZRD 4LXYA 4PS1A 5ILQA 4F91B 1OI7A 3QE2A 2JHGA 2CZGA 1JIIA 1VP3A 3R6WA 4FZVA 1T0PA 1YR7A 5GOTA 4FC6A 3MRSA 1EG7A 2VVTA 2H1FA 3D4PA 3UXMA 2IYRA 3MGKA 1EVZA 1Z5NA 3NM5A 5JI2E 2C7QA 2C83A 2BMWA 3FB4A 4M9SA 2OAQ1 4IV8A 1E2NA 1MXFA 4MDHA 3RYIA 5JUWA 1HMYA 2J41A 3Q3IA 1JG4A 1NXWA 4ECAA 3A2NA 4UUNA 5SICE 4I8IA 3INGA 3LQ4A 3MGGA 4RCVA 2LD4A 1J42A 3KB8A 1K0UA 3M2PA 4JR1A 2SKCA 4AJKA 3OLYA 1BROA 4QBKA 1T3GA 1S4QA 3WTCA 4C0QC 4C08A 3C3PA 2ZSDA 4CEIA 5E0OA 2O0KA 1QH1B 1M2NA 3VC2A 4BAGA 5TR9A 4I08A 1C0PA 1GAWA 4BP9A 5EGSA 2H59A 2ODEA 3QXCA 3OE1A 2CNBA 4EMTA 3BMCA 3HWX1 3S8YA 2YJ3A 4R51A 2WJPA 3Q7SA 5AKZA 2O8VA 5H8WA 4PZEA 2Q99A 4GOND 1DKOA 2CXSA 3TJMA 6Q21A 2Q41A 5ITZB 2AD1A 2GEFA 4BV3A 5EPOA 4DT1A 1EEHA 3VJLA 3WO0A 3WK5A 2XYHA 3BB4A 3RHZA 2G3YA 1K86A 4XVCA 3ZLTA 4KQKA 1HLFA 4LVCA 2BGWA 1FE8A 3UATA 1E3LA 1UBFA 5CP8A 3NHLA 4L5IA 2FLVA 1DAOA 1MB3A 4O25A 2Q9BA 1HQDA 2NGRA 1MV5A 4MV3A 3TMAA 1NJSA 3ZWOA 1GPKA 1P31A 3ZE6A 4LAFA 5K8LA 3EFOA 3NWPA 1UMBB 3GC6A 3OLWA 3OOEA 5DSTA 4CEHB 2Z57A 4A0QA 5LMNB 3NBKA 3RARA 1U8AA 1NJ6A 2H5EA 4KOAA 4BNVA 3KSBC 1O6FA 1U2TA 1KFCB 3PD7A 3LBHA 1R0KA 3HY6A 3T15A 5F4ZA 3R3WA 2MJLA 5F77A 3D6AA 1SJ9A 2VRBA 3ROMA 3H65A 2CC2A 1T6NA 1XXHA 2PSFA 3HXLA 3NC0C 2JFQA 4TOIA 1JAYA 2WUEA 4KG7A 3DFMA 1KDOA 2OXCA 2FDCA 3I4CA 4WXHA 3P71T 3DWFA 2BRUA 4RNCA 3MUNA 4EX7A 4MB6A 1IQ0A 4IH1A 4A2CA 3H6KA 4WFKA 1MRSA 4C3UA 4WOPA 1M1ZA 1X77A 1BEUB 4AP9A 1G55A 4HDKA 3ZV3A 5J59A 3N2GA 1YRAA 2IOQA 4BL5A 4D9MA 1L8XA 5A4JA 1QP0A 1MX9A 1M5RA 2AYXA 1Z5VA 3AIMA 3VMMA 1ZITA 2AS0A 3DQPA 3FMOB 3RS9A 4DCOA 1JH9A 3W5VA