1DZ3A

Domain-swapping in the sporulation response regulator spo0a
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
123
structure length
123
Chain Sequence
SIKVCIADDNRELVSLLDEYISSQPDMEVIGTAYNGQDCLQMLEEKRPDILLLDIIMPHLDGLAVLERIRAGFEHQPNVIMLTAFGQEDVTKKAVELGASYFILKPFDMENLAHHIRQVYGKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain swapping in the sporulation response regulator Spo0A.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Response regulator
molecule keywords Stage 0 sporulation protein A
total genus 39
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2000-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dz3A00
4RY9A 4Z4CA 4OBBA 4LRQA 3N8IA 5FWXB 3FFWA 4OTZA 2JBAA 3JTEA 4YP9A 1E2BA 3CNBA 5IUNC 1KMIY 2WWVD 4EVQA 4Z99A 1ZH2A 4YRZA 5HQJA 3F6CA 1ZAYA 1KRWA 4JOQA 1HEYA 2E4XA 1L5YA 3EAFA 3MM4A 3C3KA 3KS9A 3OLWA 2FSPA 3LUCA 4NQRA 4F12A 1PEAA 1BDIA 3MMNA 2MYTA 1C0EA 2JB9A 2L18A 4KNYA 2WJAA 3BRSA 1LJLA 4PEVA 2FMKA 3DLHA 2HSGA 2TMYA 1OXBB 5EWMA 4MGEA 1W9HA 2H0AA 3BREA 5KI6A 4ETNA 2NZUG 1NXWA 2FEKA 3CTPA 3S99A 1RZRA 3T8YA 4FB4A 4PZ0A 4D6YA 3RVMA 3GWGA 3M9WA 5D2CA 4EYQA 4KREA 2PUFA 1FFSA 1DBQA 4WUTA 3A10A 1SRRA 4MR8B 1I3CA 3EULA 1T34A 2A9OA 4L4UA 2GX6A 3UKJA 4H3KB 1U04A 1K68A 4RV5A 4JA2A 3RVLA 1MVOA 3H6GA 5IEBA 5T7BA 4DADA 2MYNA 3OM1A 2P9HA 2RGYA 2MSWA 3LKBA 5IC5A 1J56A 3KCNA 3DBIA 4ETIA 4EGSA 3TB6A 5TPWB 4ML3A 3N75A 2NZVG 2FVYA 3N0XA 3QK7A 4XARA 4LE0A 5C5EA 1VRVA 5TQ2A 1EWKA 3SAJA 2QW1A 3CLKA 4RDCA 5ABPA 3D8UA 4RZSA 3OO1A 1TM2A 4RXMA 5IUJC 2LPMA 1U0SY 3GL9A 3L6UA 2QV0A 4Z4EA 3HDGA 3OMXA 1GCAA 2OQRA 4MRMA 1YMVA 1DCMA 4RWEA 4MQEA 5DGCA 3O1HB 4MR9B 4H60A 3HO1A 3TMYA 2NUBA 5CNMA 3JPWA 4Z9BA 4QPJC 1SD5A 1Z17A 5CHYA 3SM9A 1JYEA 3T6KA 2OENG 1YVUA 2VYCA 4JP1A 1WETA 1F51E 3NHMA 1R8JA 2H3HA 4F06A 1QP4A 2JVKA 2PUBA 4IRXA 4PICA 1ZDMA 3E61A 4YCSA 3H5LA 3IP6A 5IUKC 1JHZA 3LUDA 2GI4A 2IPNA 2L17A 4MLDA 1SXIA 3A0RB 3LOPA 4Z4HA 5JNTA 4F3TA 3OLXA 3O2SB 2QZJA 4G0PA 4RK6A 1VKRA 3Q41A 2QR3A 5TE9A 2LBPA 1Z15A 3I42A 5GQSA 3DGFC 3H1EA 2PAFA 2QSJA 4MQFB 1D1QA 3FFXA 4XXHA 3OQNA 4W5RA 4P98A 3CKMA 2O20A 3HJFA 2FMHA 2M1ZA 5BR1A 4N76A 4PE5B 5HKOA 4Z4FA 3C3WA 5TQ0A 2R25B 3EQ2A 1LBIA 4WZZA 5JNVA 1AB6A 3RVQA 3JY6A 4KV7A 4TN5A 1E6MA 2FLWA 3C3MA 3QELB 2AYZA 5EWLA 1XHEA 1PNRA 1FQWA 3O2JA 3H6HA 2IPLA 3NBMA 4MS4B 4DN6A 5TPZA 4YR7A 5KQMA 1RXEA 3E3MA 2ID9A 3A3KA 3RVNA 4W5OA 5CNJA 5EWJA 4UHKA 4S04A 3QLVC 1GLGA 1S8NA 4MR7B 3MA0A 1P8AA 3L49A 3LUHA 1Z12A 2GBPA 3G1WA 1KRXA 4OLBA 1MIHA 6ABPA 1QNLA 4KK4A 1JFSA 2PUEA 1YTUA 1Z13A 2WMYA 2JRLA 5ED4A 3CU5A 5JNUA 1F4VA 2MYPA 2I6FA 4ZYLA 1ABEA 4ZPJA 3UUGA 4YO7A 3KSMA 1BAPA 1LK0A 1QMPA 3LTEA 4JASB 4ETMA 3O21A 3QX8A 2VUIB 1MB3A 1YS6A 3KKEA 3F73A 1YIOA 2VK2A 4KFCA 3GBPA 1YS7A 4WXMA 1OXKB 2Q5CA 1DP4A 2WRZA 4D6XA 2PE5A 4LX8A 4RXTA 2WY2D 4EVSA 4RK1A 3LFTA 3Q7SA 3KHTA 5KWSA 4HNRA 4MLCA 3RVRA 5BQ3A 1M5UA 4IILA 4HYEA 3MQ4A 3R0JA 2HQBA 1Z16A 5TPZD 5TQ2B 5IX8A 1FFGA 8ABPA 1A04A 1YMUA 2PKXA 5I4CA 4TLLB 2DRIA 4ZJPA 4YS6A 3QEMA 1LJUA 3ILHA 4LDZA 3KTOA 2JCGA 5FBHA 1ZHHA 1QP0A 4OATA 1NXPA 1M2FA 4MR9A 2RJOA 1U2QA 1USKA 3URMA 1VPWA 4RU1A 4RY0A 1U8TA 3GV0A 3TX6A 3OQOA 3CHYA 4RS3A 5KQPA 1PEYA 1QO0A 4MPTA 4D74A 3KG2A 3GBVA 3F6PA 3IP7A 3IP5A 3TD9A 4MS3B 4Z4GA 3C97A 5GOTA 1W25A 1DJMA 4MAAA 1EWVA 3QEKA 4G0QA 1XWWA 2FMFA 4WWHA 3N0WA 1DZ3A 4M88A 3RVJA 2LUOA 3IP9A 3MF4A 4XFKA 1YK1A 1GCGA 4KPYA 3RVOA 3IPAA 4G97A 5EWMB 4EYKA 1NTRA 1Y1LA 3O1JC 1RXIA 2NT4A 4YWHA 1E6KA 1MAVA 1IIBA 3HUUA 1DRKA 2M98A 4G0YA 3H5WA 1GUBA 2VUHB 4O5AA 1CHNA 1QKKA 5KQGA 5E3JA 2FXIA 1H9CA 3B2NA 2LIVA 2ZWMA 3HDVA 2MSLA 5TQJA 3I45A 4OLAA 3P9YA 4N0PA 4RKQA 3SNKA 3UK0A 1SXGA 3LUGA 3N6VA 4O1IA 1BDJA 2R47A 4KQ9A 5TQ0B 2JBAB 5KC8A 5T3YA 4H3HB 4IMJB 4MQFA 4NCAA 3D02A 1AB5A 1EWTA 1NATA 2FQXA 1QO0D 3Q15C 1UDRA 1NXSA 3Q7RA 4KK3A 4E7PA 4RKRA 1D1PA 7ABPA 4KRFA 1D5WA 5B3JA 5FWYB 1JX6A 1Z18A 4WT7A 5JS2A 3LKVA 4LDAA 4YGXB 5HSGA 4MS3A 4RK7A 3CS3A 3JVIA 3CG0A 2JVIA 2QVCA 3NNSA 3N0RA 4XAQA 1ISRA 1NXVA 2PUCA 1RZRD 4QICA 4LE1A 3T95A 1ZY2A 1KGSA 2A9QA 4EVRA 5DKFA 3W9SA 2CWDA 4Z0NA 5IEJA 3EQZA 4Q6WA 4FE7A 4F11A 2RJNA 1PUXA 1EAYA 1USGA 2A9RA 3LMKA 1TLFA 4G86A 4CBVA 5JNRA 3FDFA 2NT3A 1URPA 2FMIA 4KZKA 3O75A 3ILYA 3HM9A 3HXMA 1Z2DA 2B1JA 1CYEA 3H1FA 3NNDA 1DRJA 4ZMSA 3EJWA 3H75A 1QPZA 4Q7EA 4NV3A 3SQNA 2HQOA 3GYBA 2BGGA 1JDNA 4MS1B 4EYOA 3HS3A 4MRMB 4LZLA 2YHAA 3FFTA 2WB4A 1P6UA 3H5TA 3HZHA 4RY8A 1M5TA 5DLEA 3RVKA 4B09A 5IULC 1Z2EA 2QXYA 4RK0A 2E4YA 2KYRA 2PL1A 3BILA 3KJXA 3N53A 5F64A 3HK2A 5FBKA 1JLKA 3OLZA 3OQMA 3GRCA 5FWYA 4RSMA 4F8JA 1BVHA 1TMYA 1DC8A 2L19A 1B00A 3HEBA 1JH9A 2PUDA 2JK1A 2PUGA 3G85A 4YV7A 4P1ZA 4MR7A 1PNTA 4Y9TA 3QLTA 3ROTA 3ROFA 1ZGGA 1L5ZA 4TLMB 5EWJB 4E7OA 4HNSA 3LUJA 4Q6BA 1EHCA 4IGAA 2W42A 2B4AA 3Q9SA 4KMRA 4YLEA 2E4WA 2J48A 2FQYA 1U2PA 2IPMA 1A0OA 4MR8A 3H5OA 1C4WA 1NXOA 4FE4A 1Z25A 3LUAA 3I09A 4G0ZA 2FN9A 3NHZA 5CNIA 1JF8A 4S05A 2F8SA 2IYNA 3EDCA 3KYJB 1MB0A 1NXXA 2FEPA 3JS5A 3M6MD 5BRAA 3O74A 2ID7A 3HVRA 2V0NA 3FMVA 1TJYA 2PL9A 1USIA 4Z9AA 3NNNA 2E4VA 2R48A 3CFYA 1ABFA 1DBWA 5JNWA 1JL3A 1PHRA 4HNQA 5FWXA 1VLZA 2XDYA 3H5VA 3QELA 5EWLB 1D4ZA 1ZH4A 1BDHA 3JPYA 1DC7A 2R4QA 3A0UA 2CHFA 3TO5A 1ZN2A 1Z26A 2IOYA 3M9XA 4KQCA 2PJUA 4EY3A 1P6QA 3MIZA 4JB0A 5PNTA 3RVSA 1CEYA 1XHFA 3K4HA 2AYXA 4GPAA 3F7NA 4MS4A 5C5CA 3RH0A 3QLUC 3IDOA 3LUKA 1QQBA 2LP4Y 1GUDA 2N9UA 4DQDA 1ZVVA 2PMCA 1A2OA 3H5IA 2MYUA 3QLVA 3O1IC 3QLUA 2IPAB 3LUFA 2X7XA 2PLNA 3BRQA 3OM0A 5IBQA 4NCBA 3DLBA 2L2QA 1ZGZA 5DCLA 1JDPA 3K9CA 1NY5A 2FLKA 1RNLA 3KLOA 3VNAA 3VNBA 2YHBA 3MYYA 5KQLA 3SY8A 3EODA 4JAVC 4PYRA 2FEWB 2IDMA 1ZESA 1JFTA 2CHEA 5CNKA 3DGEC 3KLNA 3HSYA 1ZITA 5HM6A 4LE2A 2P4UA 4OG2A 1DBPA 5BRJA 1D2AA 1RPJA 4UHJA 2F8TA 3KYIB 3QEMB 2FW0A 4N0QA 4MYRA 3T38A 1QP7A 5TPWA 3I5AA 1DG9A 2FKAA 5JS1A 2FTKE 4G0XA 4KVFA 3GA5A 9ABPA 2E4ZA 3JVDA 1JBEA 2E4UA 3OLYA 4N47A 4GNRA 4RK5A 1APBA 4NICA 1FSPA 5B3JC 3IPCA 3Q7TA 4IMIB 2QVGA 3FGZA 4O1HA 2IKSA 3HV2A 4N03A 5DTEA 3RQIA 5KC9A 1DCFA 1JWLA 4MQEB 4TMYA 2WJWA 4XASA 3C6QA 6CHYA 1K66A 3H1GA 2FN8A 1JYFA 3BBLA 3GT7A 3O2QB 3OLVA 1SXHA 4JB2A 4MS1A 4QYWA 4RXUA 1EFAA 2HPHA 2FQWA 4G0MA 4IF4A 3OMWA 3SG0A 3OO0A 2A9PA 2GWRA 4XLTA 4L85A 5JNSA 3QX9A 2PUAA 3CG4A 4EYGA 4W5QA 1TVMA 3EGCA 1M2EA 4ZMRA 2RDMA 1E6LA 2HQRA 1LBHA 2MSKA 4W5NA 2JVJA 4WXEA 4QYMA 1DCKA 3DZDA 1P2FA 1YK0A 4G0OA 4Z4IA 3HUTA 4W5TA 4EUKA 2CD7A 1QQAA 3HCWA 2ZAYA 3CZ5A 3CRNA 3RVPA 3CZCA 1JFVA 1FFWA 4N41A 2GKGA 2QU7A 1NXTA 4RK4A 2HJ9A 1ISSA 1BA2A
chains in the Genus database with same CATH superfamily
5AK6A 4EJ6A 2Z6QA 5BNZA 4UDYX 4ITUA 1EB9A 5BW8A 1KYZA 5LQKA 1LW6E 4CM3A 3SKVA 4OPMA 4MA4A 3VTZA 1R8YA 4KQXA 3BH0A 1HOTA 2ZT7A 3N6RA 3CNBA 4TXLA 2CHUA 4HPWA 3U31A 4ADSG 3ER6A 5JS7A 4G0UA 4YT8A 5B2ZA 1GQYA 2ZIWB 4Q7QA 2UUAB 1ZKDA 2B5WA 3AUTA 4OHMA 3BS4A 4PCVA 1T8YA 2IXFA 3F6CA 4PNPA 4R68A 4YROA 3VPHA 4C6TA 4D82A 2G25A 4QQ8A 1RSZA 1ORDA 2OZLB 4O4IA 1B7GO 2FSPA 4BNVA 1JWBB 3A3NA 3E9YA 3KYDA 3MC1A 1BDIA 4J4TA 1Y4ZA 3EDQA 2J5QA 3NBKA 3DLHA 1CY0A 3BCHA 3KWJA 1OXBB 2VJOA 4AECA 2PSSA 2VAMA 5JXIA 3GLSA 3F2VA 3QJ5A 3Q1LA 2E4AA 2I2DA 2NM0A 2RAFA 1Y6JA 1S3SA 4C2AA 1G2IA 4YJ3F 4OHUA 1RABA 2HLHA 4IDOA 2AQKA 4ER7A 5J47A 4LWZA 1SUPA 1UDXA 1KVTA 1YCGA 2XNDA 3WHPA 1J8FA 2OT3B 4Q9NA 3WGJA 2COUA 3ZHUA 4JT9A 2XEDA 4X7BA 621PA 5JISA 3JAWA 3VH1A 1ESNA 1U7PA 1H2BA 1I32A 3GFFA 2I2CA 3ESRA 4II2A 5REQA 1YJBA 3RAJA 2GVNA 1BXRB 4I2NA 2ETXA 4M99A 1W49A 5J40A 1D4FA 3PC8A 4KYUA 3E58A 2WD7A 2YW2A 4N3AA 2EZTA 4KSCA 1ELOA 4ZGWA 3IH5A 2Z8YA 2GO7A 4AG5A 1LPNA 2VNJA 3HBAA 1NLUA 4F5DA 5HKLA 3B6ZA 4XUDA 4MV1A 3PR1A 1L5KA 3KCNA 2ZJ2A 2GN8A 5K0JA 4D9GA 2R68A 1DUVG 5HNKA 4YAWA 4PTLA 3HPQA 1YZNA 4LE0A 1MT3A 3QKTA 3CRZA 3ZW9A 4EFKA 5JASA 4LF8B 2DUMA 1YVEI 2QNBA 4ZOLA 2SECE 1R4MA 5TT1A 3FYSA 3WGIA 3NBXX 1P0PA 5CVDA 5H68A 3WIEA 3HFSA 2FXVA 1PQ4A 3HV0A 3ZV4A 3MQFA 4YMWA 5ALPA 4D26A 1GSAA 3TJZA 3FSRA 4U6QA 1TTTA 1RLOA 3OEEA 3ZG6A 4RWEA 5F3WB 3O1HB 3ITKA 4DCTA 3CPEA 3WK4A 2P6NA 2B0CA 5AFSA 4BAGA 3JPWA 5D5HA 5HMLA 4ZC8A 3BCSA 5DXFA 1Z17A 4RWZA 3SM9A 5IKXA 2CDBA 2OV3A 1OFHA 1HE3A 5CW2A 2Q3HA 2ZPTX 5DP1A 4PICA 3GVIA 2IU0A 1LQTA 1IG3A 2YXBA 2IHVA 5KWEA 3IP6A 5LQAA 3M6FA 4U7PB 3KQNA 2GK3A 1BFDA 4DR5B 1Y63A 2BLLA 3SZOA 3VX3A 4F3TA 2MSDB 1GPNA 2JJQA 2PKQP 1QLHA 2B5VA 1WF3A 3HCBA 3N3BC 4NBTA 4E1VA 4RK6A 4B7ZA 1SK8A 2ZULA 3RQSA 1X1CA 3HFJA 4LG1A 3OFJA 4ZI5A 4A5OA 3CRRA 4OHZA 1PUIA 1ST3A 1JEDA 1Y1SA 2BBTA 2IZ6A 1K7XB 5FOUA 3Q12A 5A6VA 3OQNA 2IBSA 5E9WA 3JQFC 5A9RA 4CM6A 3CKMA 4PGGA 3R75A 3F1KA 3QU2A 3UKDA 1U3DA 4J1SA 5HKOA 3HGQA 4GZ5A 4XGQA 4NAHA 3WRVA 3DTNA 4JKYA 4EWLA 2EF1A 1EFLA 2GHRA 2B8NA 3FRHA 4FNGA 3OHPA 1JAHA 2WOOA 4L4SA 4NU6A 1V5IA 2GETA 4RSGA 4WEOA 5U1PA 3RHFA 3QQPA 1YIAA 4R81A 4UJ5A 1OPRA 2AZTA 3ROPA 5L3VA 3P71T 3LT5A 1OXXK 4NFSA 3T12A 4MS4B 3CPSA 1JHOA 4YASA 3RWBA 3CZ4A 4BO7A 3HGMA 2JZCA 4MEJA 4KBFA 4LRSB 2ZDQA 3FZEA 1CY7A 1PR2A 2G17A 3HJHA 1GLGA 1ISMA 1M10A 1JLMA 2FSSA 2GD2A 2W6ZA 3NG1A 5HIMA 3W34A 4BV3A 4EAQA 2CC2A 3KEQA 4K3VA 4I50B 1RCFA 3M6IA 4K9OA 5GONF 3S0JA 3FCCA 1ZYUA 4EVIA 4MB2A 4RTMA 1EE9A 4LISA 4OLBA 2XGJA 1PR9A 3HCAA 3HKCB 5KJFA 4A7PA 1JEJA 4ACBA 2VXYA 3B70A 1N2IA 3JQEA 1E61A 1QJ4A 1TIKA 3CMMA 3L7OA 5BPHA 2B83A 4PBRA 4P7GA 1NQTA 2IXTA 4CKEA 2R1ZA 4QFBA 4RVHA 5LA6B 1BHO1 4FJ1A 3T1OA 2ZRQA 4PV7A 3P96A 3CW9A 3AR3A 2AEFA 4WV3A 2OLEA 4ZVRA 4F97A 3LTEA 1ZNWA 4ETMA 3ISTA 4BO4A 2SHKA 2QLTA 1QR2A 2CCGA 2H1VA 4CLEA 3WB1A 1GPDG 8GPBA 3R44A 4FFDA 4D6XA 4OQLA 4CIWA 3EVBA 3A37A 2JGDA 3ZE8A 4YP6A 1ZM4A 3BYZA 1ZJZA 3K30A 3QYFA 4AY6A 1VG0B 1MN6A 2JGDB 3TTVA 4YI3A 1PR1A 4QOIA 2V74B 5JPIA 2OFFA 1YR2A 2BR5A 2HQBA 3G88A 4QOHA 5AYVA 5ISMA 5K9ZA 3W8FA 3DOEA 1A04A 1OTHA 3BE6A 2BKEA 5B58T 4QPPA 5J5AA 1SU6A 1V1JA 5U4XA 1B6TA 2IP4A 4URXR 1BJRE 4LDZA 3KTOA 2JCGA 3F74A 2J87A 3GLKA 3GT4A 3Q2OA 4CE6A 1NXPA 1VHLA 3LHIA 3DUFA 4UBJA 5H02A 3AW8A 1OQAA 2YWCA 2G70A 4MUHA 4X0EA 4F2DA 1HMPA 2P6UA 5C1BA 3RYHB 2HD4A 1UUFA 3G0CA 4UBIA 1M8FA 2BMJA 3S8YA 4YCNA 4Z3OA 3UGJA 2UUBB 3ZV7A 2N3ZA 2Y1CA 3MHPA 3GEPA 4J6FA 2CGEA 4RETA 5KOJA 3EHEA 3R2JA 5B2FA 3AMVA 3NIFB 2XTNA 4I8XA 3VYUB 5AJZA 1FNBA 4TZKA 3D5QA 2R5FA 2QR2A 5FR2A 2O50A 1XWWA 3TAUA 1DZ3A 1PT9A 2PJDA 3F47A 5F2OA 1GLVA 1XTKA 2FZGA 2MSEB 4JI1B 3DWEX 4DSZA 2C96A 1GCGA 2PNFA 4TRNA 3RBAA 4KPUA 4MNTA 5ALNA 5CFLA 3QKUA 2RKBA 3P45A 2BFPA 1JNXX 2R85A 2Q0QA 4ZKDA 2BHTA 1W7AA 1CJUC 1Q22A 3B89A 1KE2A 1ONSA 2XB4A 4V3CA 2E55A 5ICCA 3DULA 2WSSD 2ZIZA 4FZRA 5A6SA 5K8CA 4Q4AA 4H16A 4HDMB 1SELA 2QK4A 1ZU5A 3GC6A 1EUYA 2IYVA 4YYZA 5JZSA 3N28A 4RL4A 3I9V1 1DCTA 1BDJA 3GLVA 2J45A 3LL7A 1GGEA 3DQQA 5CFRA 2DUNA 2YCBA 3SK0A 3SDBA 3JWEA 4WMLA 3D02A 3TZEA 5L6MB 2Q5OA 4EFLA 5K5EA 4NZNA 5LBUA 1RWOA 4KACA 1QO0D 4RD4A 5ALJA 1N6KA 4I4LA 1CF9A 5CX4A 2XODA 5BN3B 7AT1A 4GOOD 2X5KO 2OAEA 3PT5A 3HKBA 3WJAA 1FYVA 1AKQA 1MH9A 4ID3A 4CM5A 3TLYA 4QVIA 1CIPA 2Q99A 2XRYA 5IDQA 1A71A 3EWIA 5C52B 1WHSA 2WJGA 3NFRA 3LI2A 1E1DA 1YGPA 2YQ5A 3UKOA 4C08A 4KW7A 5TF4A 2C61A 1HETA 1WCWA 2B61A 3DEHA 3OX4A 1JH8A 4YDQA 2FFRA 1JSCA 1NVAA 1WDLA 2A9VA 2BF4A 1AKEA 2DWUA 2G9QA 2JHFA 3N6XA 3A04A 4M8SA 3WLLA 3NYQA 4BWYA 4UMDA 3WIDA 2GZ2A 3DMPA 3M4JA 1XA4A 2YZ7A 3BERA 4GUAA 2R66A 3LX6A 5HTKA 4EATA 3EQ6A 1BS9A 1GZ7A 4DSUA 3DE1X 3GO4A 4OUDA 1J9ZA 5KPDA 4TV9F 2HMYB 4B3RB 3TNDA 3TOXA 1AQNA 4QU0A 3THYA 1NVXQ 4OCZA 2K5UA 1GGFA 3JSAA 1JEEA 4GMKA 1WDWB 4V0SA 2PUWA 3SHFA 2GJ4A 2AKAB 3E2PA 2FX5A 3ZNQA 3ZR4B 3K20A 1Z4PX 2Q4EA 1DHRA 1ZCJA 1CD5A 2XNSA 2W2QA 3IQIX 1F8GA 3A4IA 4ND1A 4TTJA 2QQ0A 2F1IA 1DV1A 2KHZA 4INOA 3QWHA 4JUCA 1G5FA 2VYVD 1U9CA 1IVNA 4PC3A 3EFBA 1KZHA 1PL8A 3I4LA 3RROA 1YKGA 4QBHA 3OEED 3QVGB 1QLJA 1DFHA 3ZWQA 1A72A 5BSVA 3ZZTA 3HYLA 1W19A 1Y1PA 3FYCA 1KO5A 4YDSA 4CTNA 1T5OA 5G2OA 2BDUA 4BO9A 4BB9A 1P2TA 2PRSA 2XYPA 5E6UB 2F3RA 4PLFA 4S1PA 1MX9A 3EBLA 2JAOA 5H59A 5L3SB 3KU1A 1LNQA 1X7YB 3KWFA 3X1XA 5BV2P 3KKKA 1IN4A 2R7LA 2IYYA 1JIKA 3G85A 1E1QD 4FGUA 4LQ4A 2HZBA 4EF6A 2HJRA 4KLCA 4Q3BA 1N4AA 1N0VC 3SDSA 1AQ6A 2V4MA 4YJ3A 4E7OA 3VVLA 4BATA 3Q9SA 2WJZB 4IICA 2EG9A 4TV9A 4HEHA 4RBNA 4F9FA 4IQ0A 4MCJA 3CN7A 5IABA 2ADOA 1IB0A 1UC8A 1NXOA 1V6SA 2QL7A 3HA5A 1IXKA 4QJ4A 3SR4A 3UT5B 4B6GA 3VHLB 5CNIA 3H9QA 2KW5A 2WUWE 3E53A 3PZBA 1RXSA 4NFYA 2V6IA 2HOQA 2H63A 2IDJA 3DUWA 3ELYA 3V46A 5BWNA 2CDCA 2Y9MB 1FXWA 2Y05A 4O0LA 3ZYCA 1LSOA 4NBSA 3WNCA 2ID7A 2WA1A 2YWDA 5JSKA 5AIBA 1P9RA 2PLAA 1TJYA 4Z54A 3UPDA 3ZU5A 1XV5A 2CLEB 2VDLB 2W5UA 3NT4A 4R8SA 4BC0A 6PFKA 3KR9A 4I3GA 4DV3B 2D3WA 3MJDA 5JNWA 1WULS 5FBWB 1SKYB 1WBBA 4BUCA 2P9ZA 4ZIRA 5BXYA 3STHA 4DMRA 4N40A 2JFUA 5F5XA 1KJYA 2P5UA 1QK4A 5CHEA 1T2AA 2DE0X 2C2YA 1VDZA 2XQIA 4Q5IA 4CTKA 1KY5A 4QOGA 4ZDIA 1KA9H 1V1RA 4O8ZA 1KH2A 1JEOA 1RR6A 3OFKA 2VLIA 1T6BY 1PF7E 2NX2A 2XUHA 1W6RA 5DBEX 1PJZA 1Z6GA 5PNTA 3WGGA 1YS2X 5GZ1A 1GT91 1U11A 4MVWA 4R1NA 3X2EA 1UKVY 1TO1E 4G37A 2EVWX 4EABA 1K8QA 4YRKA 5CK5A 3JWIA 1TC2A 1FRZA 2OHHA 4IMPA 4TL8A 2KLHA 3GLHB 4ZYZA 1HE5A 3IX7A 3EGOA 3GFPA 3EOAI 1RQLA 3L7CA 3QKIA 3HEMA 1EP3B 1GTVA 4XM0A 2II6A 3EPHA 5EMNA 2DPYA 1VLLA 2E6KA 2KWIA 3DMTA 1I0ZA 2DT5A 2QE6A 3ABQB 3BD9A 1NY5A 4ARSA 3WQRA 5CG1A 2ZE6A 3KKZA 1XQXA 2IDMA 3PHHA 4RH0A 3PFHA 4Q48A 3K0AA 4DXDA 3WWDA 3I64A 3PQCA 1SXJD 3P0JA 3HSYA 2IODA 3B48A 1YASA 3BTOA 4JL8A 3M70A 4HGOA 2P30A 2W90A 3EVNA 3HO6A 4DQVA 1RPJA 1VMKA 5IDVA 1CE8B 3PC8C 2BFNA 3HCEA 1EESA 1MW9X 2OFXA 1QQ5A 3I5AA 4Y1EA 2D7JA 1YZ3A 2V8BA 1OGYA 1QJCA 3PFKA 4KPUB 1LW7A 4EG1A 1RFGE 2Y0BA 4KVFA 4N1AA 2QP3A 2ZGVA 5AVYA 4FP9A 2BJHA 1RWKA 4ALLA 1BHSA 2D2FA 3T7JA 1H1LB 1MOSA 1ZOPA 2A92A 3EF0A 1P5FA 3MRXA 3PITA 3THSA 3ZWBA 1XK7A 3PJGA 1E4YA 3GXOA 3SIPA 3T0FA 4XE5A 3WIUA 4XRGA 3IB6A 3LGXA 5D87A 3SSOA 2A5DA 3CNQS 4I81A 3L7AA 4BZZA 2PIAA 1PZEA 4DGSA 5K45A 5FOSA 1CS0A 3D6JA 4M86A 3RS2A 4HDNA 2BYTA 1YQQA 3LWBA 5E8JA 3G68A 2DQ4A 2HWWA 2YS7A 3ROMA 2R7KA 3RYHA 4TL7A 2ABWA 4WZBA 2H2IA 3SMVA 4IF4A 4MVJA 4FWBA 1Y5IA 4Y8VA 4YUVA 2WNSA 5AO9A 3JZFA 5L3QB 2ZJ1A 4I9HA 5FB3A 2C7OA 1N2CB 3KXDA 1UXKA 1QR6A 2QQ5A 4AG3A 1YJ8A 3RLFA 5ESWA 2BV3A 4O2BF 3SF8B 4GOLD 4O5OA 3H0CA 4QQNA 3FZNA 2H0QA 1PLKA 3G5TA 2ZRFA 4C6HA 4R2IA 5LL6P 1QZUA 2CYBA 1BWQA 4ND3A 4QYMA 2V7PA 3CW8X 4F6RA 3L4KA 4WH0A 1IK4A 4EUKA 2V1UA 1JFFB 2GAIA 3KQSA 4KBGA 1XP8A 2YICA 1VJ1A 3BIJA 4XWKA 4Q7KA 3U9LA 2GM5A 1MDFA 3CB2A 4POAA 4R3UC 4UAGA 2OP1A 3WLNA 5CDFE 2JCXA 3ZWXA 2P9CA 5J5VA 4PO8A 1GPJA 2HJSA 2LXNA 2VYND 2QZPA 1JJIA 4Z9FA 1I4OA 1JW9B 2G4VA 3EIXA 2GBCA 3E1SA 3HA7A 4OTZA 4JEIA 3UEOA 2Q1SA 3JTEA 3HDTA 4WXYB 3WK9A 4Q4HA 1ZJWA 1EK2A 3EXHB 1Z4IA 4A8JA 5BV0A 5JATA 3I04M 4PAGA 4AKHA 1LDEA 1Z35A 2CKMA 2A86A 3O93A 4TN1A 5F1OA 1OBCA 2CD9A 4E2FA 5JW6A 3PNPA 4PS1A 2B8WA 1B0ZA 4I50A 3WISA 2AC7A 3U1TA 4L8VA 3V8EA 3THWB 2CYCA 2WE7A 1YQGA 1NULA 4WI1A 1IHXA 1HKHA 1BO6A 2FW8A 3MMNA 1ZQ9A 5A4IS 2L18A 3NP7A 2J6CA 5HJ7A 2RAPA 5EP2A 3GGGA 4YMGA 5KMGA 4RMGA 5KI6A 1Q16A 2QROA 4RHYA 2CB0A 2ZJAA 4PGMA 5A3QA 1ZCZA 4LYJA 4YAJA 4KLRA 3L0DA 3LY5A 3CPHA 1GNQA 3Q5GA 1A9SA 2PZEA 5ALDA 3HJUA 3QWBA 1P74A 4HNHA 4C1BA 4B2LA 1KGDA 3KJIA 1UODA 2ST1A 3FNGA 4KO4S 3AV3A 4CM8B 1SC6A 1VTKA 4EECA 5A06A 3DB2A 4PHCA 4MGIR 1N5JA 3K8YA 1YZVA 3WVNA 4RKYA 4M8KA 3ZUGA 4ESHA 2EJTA 3K0FA 4KR3A 1UOQA 1K4KA 4BFCA 1Z88A 4WPGA 4AO6A 2KBEA 4L7QA 2K7FA 4M1EA 2NP6A 5LKAA 4F4IA 3RS9A 1J23A 1PVVA 4FYYA 1KL7A 4U8GA 4CJXA 3T4EA 4ZDKA 3FYTA 3C3JA 3PK0A 2QMOA 5LDGA 3SQMA 1QTNA 2E21A 3KNZA 4F4DA 1NBOA 5CVVA 4EB0A 1CUJA 1DEOA 2FVYA 2Y1GA 1R16A 1VE9A 5A03A 3CJQA 1C2TA 5E4FA 1VRVA 3G2LA 3L07A 2AW3A 2OAQ1 2XF2A 2G5TA 1WV0A 4XFJA 5CGQB 1MAAA 2NW6A 2O6HA 3PA6A 2BGNA 4RDCA 3T3EA 3RRFA 2E5LB 3S2IA 1AK1A 4PFKA 3T3HA 2LDXA 1XYVA 4TMFA 1E2GA 5BNWA 4WFIA 4ZRNA 5K6AC 4DR3B 4I9UA 4LI3X 4QXRA 3WQSB 1QWSA 2J3LA 2CNNA 1GA1A 1A7KA 3VR3D 1BDBA 4IO1A 2XQJA 3WJ2A 1O2DA 1LRLA 4DM3A 5JSUA 5KNBH 1NT2A 1Z6YA 5K3FA 1LGYA 4I3FA 3TBHA 3HO1A 1HT0A 4RGYA 4OB8A 2X86A 3WHIA 1CJSA 1CJTC 3GJYA 5K0SA 4MQMA 4J07A 2OENG 2VYCA 4ARVA 1A9TA 2MWMA 1B6RA 5EIEA 2YTZA 1V48A 3RSOA 5H3LA 4X66B 1D4OA 3LBNA 3M7IA 4KFUA 1S4QA 2HHLA 3AUYA 1IWOA 1FU4A 3DBRA 4P5DA 1J1ZA 3V4FA 1Z6TA 2JGMA 4X6XA 3FY4A 4FPXA 2WZCA 4HUJA 2Q62A 3OJLA 2NTEA 4YDHB 5K0BA 2O19A 4MHOA 1UMBB 5GWXA 3QFCA 3OEHD 1T8RA 3Q41A 4L6IA 3L0PA 1BDMA 4OJTA 1M8JA 3P9QA 4JS0A 1Z15A 4G0VA 3TIXB 4FYXA 4LHVA 4RTOA 4WIAA 4CV2A 4A8TA 3JVVA 4BCBA 4INAA 1M6YA 1T3LA 2C5EA 4IJWA 4O25A 4X45A 4QUKA 1NLFA 3RUHA 1G6HA 4CN9A 4JQCA 1RQPA 3C74A 4A4DA 4LF7B 3GBSA 3HJFA 3JZDA 4OFWA 3LFUA 3TNJA 1FX0A 1N2ZA 2OBFA 2RK4A 1QGDA 1S02A 4R1UA 2ZUTA 4RF3A 3KOUA 4DMGA 4QUJA 4I4IA 4ALJA 2PH5A 5C3MA 1E1CB 3KAPA 4DKJA 2JGEA 1QFJA 2POQX 2V5AA 2EFDB 2QU8A 3BB1A 1N8NA 3HE3A 1IPHA 4FFOA 1KJNA 4D99A 3WB9A 5JTTA 3QELB 1MQ8B 1KFEB 1J90A 1FQWA 4EJFA 1QOPB 2PXHA 1T3SA 2QSYA 4Y9RA 5KNDA 4FGKA 5F77A 4QUEA 3CCBA 3LP6A 3USZA 4AKTA 2PT5A 3T5AA 1FYEA 2RIRA 3LQQA 4S04A 4TMTA 4YRCA 3SLRA 1DS6A 5K01A 1JU3A 4YCCA 3CX4A 3CO0S 3PNBA 1QM5A 3I3OA 3QJYA 4X8LA 5F3RA 2Y93A 1WO8A 2WKPA 3R76A 3V8NA 4FKBA 4CDMA 3R8FA 3BK7A 1NQVA 4L75A 2RBKA 3WL4A 3BB4A 5DSXA 3RS5A 5HOEA 1Z13A 5JD4A 2JRLA 1DLIA 1P7PA 1PJTA 3M83A 1N3YA 4MUGA 4IIJA 4KXLA 3N7TA 3FWYA 4PZLA 2IYTA 1ABEA 1IONA 1DNPA 4FI3F 1QG6A 3ACDA 4UBKA 5DNDA 3KSMA 2BTQA 2ODQA 3DC2A 2C57A 3HYNA 4JITA 4QWMA 5CPBA 2NQ2C 1Q3TA 3IR5A 5KYWA 2H5LA 3FM9A 3P0EA 3DCJA 4DRXA 3W04A 3JQFA 1L7AA 3OUTA 4P33A 3G0HA 3EVTA 4DLLA 1YS6A 1I80A 4I4TB 4MRAA 1PL6A 2JH9A 3IUEA 3LQFA 2R62A 4WKOA 4TMVA 5HJ5A 1QIHA 2HK9A 2A58A 1VBMA 3KXKA 1U80A 2FLVA 3L7NA 4FYMA 4ZQIA 3I1JA 3RANA 3ELWA 2WY2D 1XDSA 3KOYA 3QXSA 3REQB 4YV2A 3EMBA 5CEEA 4YRQA 5AW0A 3H11B 3H1TA 2N42A 3DH0A 4Q3NA 4Z3KA 4M89A 2Q28A 4CCWA 4EX7A 3PEYA 1A8HA 1VKOA 1X86B 2ZS9A 3TI7A 3OT5A 3V1KA 3E84A 4F9TA 4I14A 4WJZA 1PJAA 3NT2A 3ECSA 4L50A 2VDJA 5H83A 1K7FB 1U28C 2REQB 5AI4A 4PPYA 4D02A 3ZUPA 3HB9A 3HCPA 3NBYC 5I8ZA 3CUYA 4AO8A 5LZ2A 1BMQA 4RU1A 3ADPA 5T4BA 5BW6B 1KI4A 2FJ0A 5FFNA 4MA0A 5I7RA 4EBBA 3AEXA 3UJPA 3AZQA 4GVPA 4GM4A 2EBFX 4YK7A 5TV2A 2WF7A 1NX6A 2SBTA 2VT3A 3PLRA 4H59A 5P8WA 3WK6A 3UY4A 2H51A 4I1OA 1P7ZA 1SUEA 2Q2VA 5ALZA 1CF2O 2EFGA 3E7XA 1V9CA 1OT3A 4URYR 4M88A 4V3BA 5COQA 3OOYA 1ZI8A 3UO8B 1MB4A 1X1AA 3AV0B 3BVPA 2FX2A 3AKYA 4QDZA 2XE7A 1P3JA 1CS4C 4FEEA 3IPAA 4JSRA 1R4AA 2JGFA 5AWFC 3O1JC 2IWHA 1CUFA 4EJSB 2GJSA 2Q3DA 3VR4A 2VDWA 2V7GA 3PKJA 5AHWA 4C43A 3H5AA 3C8HA 3SZLA 4E6EA 4YAKA 5JARA 5JSZA 2IH5A 1KI6A 4G0YA 4PAOA 2FW6A 2GN0A 1FEZA 2FUKA 3NUGA 3SYLA 2QLLA 5LU9A 2VN8A 2VT2A 3BIFA 1Y5NA 3AERB 3EXIB 1H9CA 5GM2A 4O3MA 1EUQA 4NCXA 1SA0A 1CIVA 1E1RD 1PO7A 2AHOA 4YO8A 5FUBA 5AJUA 2BGWA 4Y0VA 3FTFA 5EIBC 4REMA 5BVHB 1Q95A 2SNIE 2QS9A 1Z4KA 4DIDA 1B0AA 4UVDA 2JBAB 2Z58A 3QE3A 3K09A 3JQAD 2EIHA 2XBLA 4C0BA 1SB9A 5HM8A 3SPXA 2BEJA 2H59A 5LWQA 3STXA 5L7WA 1N6OA 2AZDA 4E7PA 1I7NA 5KHAA 3AVPA 3P2KA 4EA6A 2R44A 2X6QA 1R8XA 4YCAA 3FW1A 1SCUB 2X6TA 2O59A 5CB4F 4Q4JA 1Y3AA 2I71A 5FWNA 3CZMA 2NU7B 1SVIA 3IRUA 1TYZA 4MUYA 5FOTA 1YDHA 4M0KA 3MIIA 4WY5A 3NHUA 2ERCA 1FOEB 4GDFA 1XZMA 4NAVA 2M6SA 2Q5FA 4DBZA 2PUCA 2G1PA 4LE1A 2XB9A 1UPAA 1MEOA 4WOJA 2IUSA 2Z2ZA 3W5HA 5H70A 1USUA 4OB7A 3EIEA 4UNPA 5HIIA 4DR1B 2CWDA 2ASEA 2BI4A 5G3ZA 4BL5A 5C1OA 3I8OA 3C2QA 3LZDA 1NMQA 3ILVA 4NH4A 4P53A 5K3DA 4DCCA 3FPJA 1U2ZA 1YZYA 2YWHA 2AD5A 1T3HA 1NYLA 1FZTA 2O2GA 3QKSA 4XEHA 3K0SA 3UUFA 2XUZA 3PR2B 5F1PA 3O75A 4G5RA 4LN1A 4XX0B 5IBPA 1V8PA 3V42A 3W7BA 3H1FA 1NRJB 4HGPA 5L3ZA 4OP1A 2GTIA 2IP1A 1ZHOA 3FMOB 4Q1CA 1K4MA 4IFIA 4Q3KA 1OA0A 2HGSA 1QGUA 2PXXA 2IJGX 4X85A 3S1SA 4IRMA 2AUTA 4MYUA 5KJ1A 1B23P 1MH1A 3AVTA 2C8VA 2VF7A 4MS1B 1GU7A 3JX9A 4L5BA 4GC5A 1QYDA 2IH4A 3WYAA 1EI9A 1NNSA 3BAFA 2FWPA 4Q1AA 2YY6A 4IVQA 3F97A 2FPIB 1ULTA 4JJ4A 2G5GX 1MABB 4QRDA 5FLKA 5I9LA 5ICGA 3ZJTA 5J63A 3UZUA 1K6MA 3P9CA 3TBFA 1N57A 3D2AA 4HADA 1L7OA 4UMFA 4B4VA 3GCGA 4F9GA 3EZNA 2AR7A 1WHTA 4X6YA 4GQAA 4NC9A 3AB7A 1G21E 1JPUA 3OFNA 4IBOA 4N8EA 5DDIP 1S2IA 3G9TA 2PUDA 4DDVA 3MJTA 2XNHA 3OH8A 1HRKA 5KOJB 2JFXA 3HM2A 4ZZ1A 3TI9A 3KB8A 1U3CA 4JLOA 3L79A 1ODKA 4LSWA 1EHCA 2G1JA 4IGAA 3UHPA 2B4AA 1O96B 2Y1WA 3B9PA 3N87A 3Q8KA 5I9SA 4IWXA 3DL7A 1R50A 1G8YA 3VI3B 2Z2JA 5ALFA 2DY0A 4AKIA 1J0CA 1UMDB 1RAHA 4JBNA 1HFEL 2YVQA 4MJXA 4BFTA 2VLBA 4HAWA 2O14A 1XZJA 2YIMA 4NL4H 1QBKC 2P11A 3R7NA 1J1IA 1TADA 2HCRA 1O94C 4NONA 4P08A 3BE4A 3C7TA 3QHAA 1NQXA 4TWBA 3FCSB 3OY7A 5ALOA 2UZ0A 1XK6A 2DPGA 3LT4A 4CM9D 1HDYA 1H22A 4ZOBA 4EZEA 1X9IA 2GRUA 2OE2A 2VHZA 4G4JA 2D0PB 4KKVA 1L5LA 5BSMA 3DXXA 2AJDA 2QIOA 1VLZA 3NU1A 3KLMX 4NCHA 1D4ZA 1ZH4A 1E2JA 3C8ZA 1KYXA 3MCAA 4DRZA 5IZ4A 4F4CA 5H5JA 3ZHXA 2EZ9A 3U4DA 1AY0A 1Z45A 3KJNA 4QREA 1YJAA 1Y9EA 1U0FA 1TGYA 4M7RA 2ET6A 2J9RA 3F7NA 2M6RA 4YUWA 1YFZA 4Y2GA 3ZK7A 2VNIA 4IG4A 1T1GA 1T3GA 2J5KA 4HQKA 2H52A 3PD0A 5HFAA 2Q7XA 2R8XA 5KDOA 1KZGB 2AKYA 3N2KA 3A2NA 3OZ7A 3E22A 3O8QB 1C3JA 3IOYA 3QOYA 4R5MA 3VRHA 5HYVA 1ZR2A 1UOOA 4I08A 1DLJA 1HT3A 4TKVA 1KDYA 5JMTA 4HAUA 4DIBA 5JAUA 221PA 2DHDA 3A70A 3VR2D 5AJYA 2G07A 4G5GA 3IHLA 3V32A 2AI2A 2ZAIA 5GVSA 3DZBA 4XJSA 3MWDA 3BCRA 4FNOA 2E37A 2IUYA 3ZDCA 5IH7A 1Z5WA 1ZESA 3AY6A 2OXFA 4FIDA 3IVCA 2NPIA 4P0TA 3U7GA 4HUTA 2B99A 3QVXA 2FY8A 2C97A 1JXQA 1UK6A 3KPWA 2WFMA 1XP5A 1DBPA 1SD2A 2WFLA 4M22A 4OA5A 5DM2A 3ROEA 2JLXA 1FPQA 1ZK3A 1W9MA 2FW0A 2NQTA 4KQIA 4P4NA 2CUTA 3WKAA 1GVHA 4D0LB 1V11B 2DC1A 4RVFA 3KJEA 1WUJS 2AFRA 3NH6A 1CUAA 3ES9A 4HMQA 4PYMA 4TKLA 1N1DA 1UBLS 2HSWA 2XKAA 3VMMA 1E96A 4DKXA 3G7UA 3GROA 1N0IA 5C34B 4J0JA 1U3TA 1T9HA 1Z3IX 5AOCA 5CB8A 5JSFA 2CEAA 4DUZB 1B8NA 1TUGA 4MI6A 3TBKA 4A16A 1OLXB 4L07A 4HNAB 1VG8A 2C5HA 1YJQA 3AYZB 3OFVA 4R7TA 4YAOA 5KS2A 1BS2A 3ER9A 4UQOA 1AE1A 1COWD 1EZ1A 1V1MA 2ETVA 3DZJA 4X3CA 1E7SA 1OYYA 4HB2A 4XASA 2IE0A 3ST7A 2GEFA 4L15A 4LJ7A 1ECBA 1TUBB 4ZV4A 4MRMA 3KUUA 4YMVA 2BRUC 3LBYA 4KI7A 2FW1A 5DOZA 3ERCA 2EYQA 2A5FA 1MCZA 1IDN1 4QYWA 1CYEA 2HPHA 5EP1A 2JLYA 2Y3IA 4G0MA 5F33A 3WLHA 1SCKA 1ATIA 3BQ9A 2FPGA 2H06A 4EG4A 4KWHA 5HVNA 1EX1A 1H2AS 1X94A 5J4HA 1Q0RA 1SCDA 5BVGA 8AT1A 4CKCA 4WE3A 3MXTA 5T8KA 3AL3A 3A6LA 4C4SA 2JLVA 3W6OA 4CLOB 1TVMA 1FSFA 1TMKA 4KXMA 4DOMA 4M0LA 3FDZB 1YB1A 1SNYA 3A4TA 2QW0X 4WXEA 2JIDA 2V3VA 3M2TA 4AB1A 5IPFA 4Z4IA 4B35A 1QVRA 3UC9A 2ZRJA 2QTMA 3SYRA 2VZLA 3OETA 4EKNB 1GTG1 1JZTA 3PSHA 2DF8A 3OBBA 4D96A 4TTPA 1AD2A 2YL2A 1RTTA 1M7GA 1SUFA 3PUWA 4F7DA 4RK4A 4FYPA 2R4UA 4DCNA 4NIMA 1SCBA 3TJRA 3UMJA 1F8FA 4Z4QA 5K8TA 3DDSA 1QH1A 2BCEA 3P9PA 5DEOA 3F8WA 4PLCA 4G26A 1DX6A 1Z8HA 5AW4A 2ZT5A 1KMIY 1CP3A 2CZCA 2WP0A 2BSXA 2EJBA 1UH5A 2DLNA 5BNFA 3REOA 2YVUA 3L6RA 2A1TS 3X44A 3ZCUA 2Z1NA 1WQ3A 4ZN6A 3IIIA 1A9PA 1L5YA 2B6NA 3GRVA 4F12A 4B8ZA 4Y3UA 5HJEA 3PHGA 2O4CA 5EE3A 1G20E 1KIAA 1EU1A 1LI5A 1U1EA 4XTCS 3HG7A 1NW5A 4TL6A 4IDAA 2WJAA 3BRSA 2C04A 3ORYA 4YP1A 5HF5A 3VTFA 1XZLA 3PT9A 2ID8A 3ZOZA 1WXIA 3SIXA 4FZVA 4QNNA 3ZJUA 3E1GA 3ND7A 5BR8B 4CEHA 4K6GA 2C5GA 1H8EA 1VRWA 3OZCA 2UZ4A 2I1WA 1JKJA 4LA4A 3EXFB 3ZD8A 2OXCA 1PT8A 2QW8A 1HMYA 2ZI4A 3KZMA 2PM8A 1EHYA 1KU0A 3O0TA 1A5BB 2ZBVA 2P9JA 2ZZMA 1Z36A 2XDQA 5ENZA 4A0QA 3U3JA 1UEJA 5L4LA 5B3KA 4CF6A 1JECA 1OZHA 1I4EB 2GERA 4PFSA 4XH9B 3X3HA 4RJIA 1JHMA 3N70A 3TUZC 1OOEA 4HL6A 1M34B 3L01A 1YRWA 4JJ7A 3VDNB 1YE5A 5IWCA 5B1HA 1DIRA 1DQZA 2G63A 3OE7D 3AHEA 2X1MA 1R6TA 4J76A 4JA2A 1VGVA 1L1RA 2BFBA 3HY3A 3JZAA 2A35A 2MSWA 2ONYA 3ABZA 3R4CA 1NMEA 4KQKA 5FUWA 3WMXA 4MMXB 2WEKA 3TB6A 3I9NA 2OXIA 1AK9A 3LS2A 2AXQA 2ODWA 4MUBA 3C8MA 4UHCA 2P5SA 2CCJA 4A0GA 1SCNE 3DM9B 1JSXA 4M2LA 3DYVA 4RZSA 2WUEA 3FHCB 2Y77A 3BH7A 2Q1TA 5AVOA 2LPMA 4B7XA 4GZ6A 1NWHA 3C6KA 1LF0A 4ZZ2A 3GL9A 2GVZC 3HACA 3KOXA 4Z4EA 1K3UB 2X19A 3WGUA 4EG3A 1DCMA 3CURA 5K0EA 3P5BA 5JG7A 3WYBA 5C35A 1NI4A 4NWIA 2KJQA 1TAQA 1LI4A 4Z9BA 3D4BA 2W8BA 3H6KA 2FWNA 3OJEA 4GOND 1JG1A 4UMVA 2VZ0A 5FIUA 4RFSB 1IXYA 2XY4A 3V8MA 1R5JA 3PQ2A 2QHXA 4D0GA 3E61A 3F6EX 3UANA 1JHZA 2QZZA 2XUFA 2WPDA 5CA1F 4HDQB 1V37A 3AP2A 1J0DA 3WLTA 1HYHA 3B85A 2FN4A 2QN6A 5E7MA 1MA0A 1TRKA 3O2SB 4OJQA 4URWR 3IVRA 4RD0A 3DEJA 4CU2A 4BYGA 2QR3A 1QC5B 1G4AE 5TE9A 1MO2A 3UYLA 4WSOA 4RTQA 1CY6A 5FBRB 1EA5A 4CKBB 2QPLA 3QNUA 3H1EA 2CXHA 4BJ1A 1GZUA 4MQFB 5KNCA 4N39A 1Y1KE 2OCGA 3H8SA 2FSHA 1GZ4A 2A14A 4MYSA 3EZ9A 3OG9A 1Q0TA 4BY9E 1NBMD 3MW8A 3EDMA 2H1LA 2IEDA 1IZZA 2PS1A 4E94A 3QMPA 2IYOA 1KMNA 3C3WA 5IBCA 1A9RA 4A82A 2P0AA 2YVAA 4JI3B 2OGSA 4QGSA 2UZ1A 1JEYB 1EVLA 4FHFA 3Q3HA 2QT0A 5JANA 4D97A 1JA1A 1P33A 4QOSA 3TNYA 3P27A 2XZPA 2H9IA 3TLMA 4R71A 3M3DA 1Y3DE 4LNHA 3DBOB 2B35A 3DLAA 3DR5A 4KE7A 4TTVA 1XZEA 3M1IA 4DN6A 4RHFA 3CLRD 1IYZA 3O9VA 4G84A 2EHJA 5C8YA 1U94A 1QIKA 2HU7A 2W83A 3WKEA 2E0IA 4X64B 1CRZA 3B12A 2CFOA 3MA0A 1P8AA 4ARUA 1I5RA 4BQEA 3GWZA 2XWQA 1E7WA 3D8TA 4KQ1A 4FE3A 4OK6A 1QNLA 1JFSA 4GWKA 2WMYA 1TD9A 4O59O 2FZ5A 1FUIA 3EPLA 1XZNA 1M2NA 2ZWAA 3MMSA 5A9SB 3UG7A 4Z7JA 2YJTD 2ZR9A 3CBGA 4MQLA 2XNDD 5G0VA 4F4FA 3JVEA 4W8GA 2GXSA 5DTIA 3OKCA 1DAIA 5HKKA 1UKAA 5IVIA 4P34A 1ECFA 3FIUA 4FFRA 2WM3A 1DTEA 3A9VA 4YXFA 4DR6B 5KU1A 1E3DA 2PEZA 3OM9A 5T6MA 3T9FA 1QIFA 4TTIA 3UUEA 3F3SA 4AURA 1C30A 3VVBA 5JI3E 1WG8A 2X8AA 4JMLA 5IDWA 4K9PA 3IMKA 3P2YA 1CB7A 5EN4A 2A33A 3A6PC 3LA8A 3D0KA 3O84A 4M9CA 3BGIA 4O4LF 4XPZA 3U0BA 1AQLA 4FZJA 1WXHA 4DJDC 2ZUUA 4GBGA 1M2VB 3TFWA 3OI7A 3Q7SA 3U3ZA 4DCPA 2ZRDA 5KWSA 3B8EA 1EVEA 4GG1A 3VV2A 5JHGB 1O8CA 1Q17A 2WOJA 4DEXA 1RU3A 2CMKA 4DWJA 2QLJA 5G41A 2AG1A 1BEEA 3WYGA 4RHTA 3IUYA 1T3ZA 3ILHA 4MDHA 2E89A 1RPZA 2UDPA 1W36B 2Q5LA 2VBCA 3B53X 4A26A 2EZ4A 1Z2CA 3H4TA 2RK3A 4R0VA 3GV0A 3ANXA 5DI9A 2IQ5A 3Q8XB 2GM3A 3KHUA 1L7VC 3NBAA 4NK4A 3VSBA 1PEYA 2BEUA 1RW4A 4XGIA 2HRDA 4FR2A 4YH1A 3QVLA 1HWYA 2OYSA 3DZ8A 4GIBA 3C7CB 4ZD6A 1ZICA 1XQ1A 2X5JO 3HR7A 3O8NA 2ZQYA 4I36A 1G41A 4RZXA 5HZGA 1O95A 3K5PA 4H18A 4TS3A 4MW1A 1NOKA 4GMDA 5F4ZA 3Q7IA 5FPTA 4DLKA 3AF2A 4ND4A 4X7RA 3K4QA 4XR9A 1R6XA 3FA2A 3R0IA 4JLDA 2GFIA 4MHTA 1O9HA 1C81A 3JR7A 3MF4A 4Y6GB 3UYKA 4TVSA 3H42B 2PZGA 3RVOA 1P2GA 2B20A 4KPYA 5EWMB 4M9UA 3SZRA 1NTRA 3D6AA 4OJYA 4UTOA 3ZHOA 4K0KB 1IZ0A 2AOTB 1V43A 1YZLA 2OV2A 1G21B 4MUEA 2GZ1A 4MRVA 2QVLA 3AY3A 3TMAA 1FQKA 2NNLD 4DDMA 2VUHB 1SVMA 2CF6A 5TC4A 4D0SA 1J9GA 3GT0A 4IM7A 4YAEA 5ELXA 3PV0A 3EEBA 3BTSA 3O94A 4U7DA 2B2NA 4OLAA 2AJLI 4OAPA 3K16A 2O6LA 4MICA 2RG1A 3LHSA 4OJKA 3R3XA 4TM8A 1NE2A 3IQFA 2B94A 3BJIC 4QPZA 2ZJZA 3TNLA 1Z34A 4ARZB 3PPYA 4EB3A 4EL5A 3IIMA 4F2GA 3VKHA 1MO5A 1GG9A 1BXGB 4DLWA 4KGZA 1EBFA 1US8A 5A05A 1OC4A 1A9XB 1XG5A 1F4LA 4B48A 1TZJA 3OJ0A 5IJWA 3V4OA 3EEOA 5LMUB 2EBHX 3SQOA 5A62A 2C7GA 4NPAA 1ZX1A 5TVGA 1JB1A 4A6PA 2CL0X 3U5ZB 3Q11A 5CVUA 4IQGA 3ID6C 4CLHA 2EGHA 4NS4A 3SU8A 2A67A 3KBBA 3QKRB 4CI0B 5JI2E 3DV0A 4FFBB 4FKMA 5EC8A 3WLFA 2FPSA 3FVWA 2PGOA 3EVDA 4UOZA 2ZWPA 2V0CA 3GEMA 2XHEA 4KAXA 5MN5A 2IYZA 4IHJA 3M6VA 1THMA 4KIGA 4LDPA 3MAGA 4QICA 1IJEA 4WECA 3VR4D 4C05A 5BWCA 5C9ZA 3TSAA 2I7CA 2JFYA 3NETA 2QLFA 1JE0A 5I7AA 2D74A 4ACAA 3U44B 4K1LA 4KMMA 1GG8A 3EQZA 4MP6A 1G21A 3SCZA 3NWOA 4Q6WA 5KVSA 4FE7A 4G1BA 1I2AA 2WAMA 1C9NA 1NZDA 1AGXA 4AP5A 2NT3A 3BWDD 5AM3A 5DLYA 3MCUA 2HT6A 1O5TA 3DKRA 1EJ0A 1P4SA 3ETGA 5IZCA 2O7VA 3VC2A 4UATA 4UEWA 4KR6A 1DMSA 1B6GA 1KO4A 2XYRA 2Z2IA 4DXAA 4K9SA 3G8BA 3IC5A 2NXJA 5KOHA 1SHTX 2J3QA 4KQMA 5EUQB 1JDJA 2ZVPX 4E1BA 4KX3A 3SC2B 1H8HD 2GASA 2MDTA 2O5EA 3LPNA 4W8HA 5JS8A 4P36A 4P4TA 4ND2A 3D7RA 4FR5A 5DW3A 4ZV9A 5YASA 3PUYA 3SZUA 4EGFA 4EJSC 4F04A 4F3RA 2O8BB 3EXAA 2GCOB 4JC4A 5ILOA 1KXZA 3JAKA 3DV0B 4X61A 5EXDA 4JJZA 2DWQA 1NU6A 1EFPB 2XX3A 1U4NA 1QG2A 4HAOA 1CU1A 2Q6TA 5CB4A 2P4EA 1U1FA 4Q7MB 2QZ4A 2FRDC 2K6GA 1RMQA 5F64A 3NI2A 4ZQGA 4JU9A 1G9XA 5IC4A 5GIPE 1SO8A 1T5IA 1W75A 3N2IA 4ZT3A 4B6SA 5AXDA 5K7SA 4FT4A 1E9SA 3KYCB 3AM4A 3L7KA 3HNOA 5K8IA 3KFXA 3VU3A 1RRMA 4IF6A 5T64A 1KDPA 4JC5A 3UXEA 3WDLA 1PLJA 3WK8A 1JH9A 1YFJA 4H9GA 1D1TA 1F60A 2G5PA 4EKGA 4GSLA 2JLUA 2CDAA 3ZN2A 4TS9A 4MDFA 3MTAA 4TLMB 1HK7A 2C92A 4K03A 3QWFA 4IS3A 5JCOC 1K8YB 3PL1A 3SHTA 1DIOB 2JIZD 1RWVA 1GCOA 1ZGHA 2L42A 3CH6A 3KZKA 4HRYA 3WXBA 2HN9A 4OX9B 1MQSA 3RK4A 3L4SO 1VMAA 4NYJR 2YNMD 4GKBA 4UVIA 3TSZA 1IOWA 1YJ5A 3GI1A 3LL4A 1S3GA 1DQPA 2UZIR 1WXEA 3BMOA 3QH4A 5DXJA 1DDIA 4M87A 1E3WB 1W93A 2CLSA 2YRWA 4OL0A 4O2BA 4F8YA 4D41A 4I2VA 2ROQA 2J5RA 2WIFA 4NS1A 1AUOA 1BD4A 5KSWB 2XLBA 3ZHVA 3QI2A 4IDNA 4LIPD 2AUMA 1OXSC 1RACA 1T2NA 2N1BA 2VP3A 3WWZA 1G5PA 1VCIA 4MDEA 4RUKA 3VYTB 1HOXA 1TJ4A 3D7SA 4AL4A 2WAXA 2Y4OA 2P65A 1EX7A 2Y9PB 3NPMA 4HGZA 3PB3A 3PUJA 5C8YB 1EFKA 5ADVA 1IRXA 1XL1A 1XLUA 2A1UB 2QNRA 3BJEA 1OHHD 3IXLA 5KYYA 3QEAZ 3I2JA 3E8XA 3OPQA 3L7IA 4A10A 3RG2A 4ZHQB 1NVUQ 1IPFA 3D3WA 1Z4MA 7ADHA 2Q46A 3D8RA 2JA1A 4MKXA 3VKWA 5B5SA 3D59A 3AUJB 1O08A 2OUKA 3ENNA 3IPYA 4JJFA 1TM3E 3FPHA 1EFVA 2FPKA 3U19A 4FM9A 2C8KA 2IOFK 2L2QA 2HJHA 2XXJA 3L06A 1N3LA 2ZUSA 1CPYA 2ZXFA 1ZLYA 3EISA 3KFVA 3NC0C 2GBLC 4GE3A 5CVJA 3DFFA 1QQ6A 3RKSA 1BGVA 2FEWB 1FX1A 1CYDA 4ZAYA 1NSFA 1UBGA 1Y7LA 4GAEA 3RJ9A 1H2YA 2HF8A 4CKBA 3KLNA 1NNEA 1MPXA 5BNIA 2WIAA 2JEZA 1Y4UA 2W37A 3F5FA 3KKQA 3TPZA 3T1TA 3ZIAA 5KSOA 4REQB 3T99A 3BTUA 4BUJA 4EG0A 3GEGA 5JLAA 2FHPA 3N2GB 2OYRA 3OCUA 2P90A 4NYMR 5DISB 4ZKEA 3W1WA 1XQ6A 4ZICA 2J09A 5JJIA 1XFDA 1FNMA 3PHIA 3G9UA 2ORYA 3KIPA 4G0XA 3GFQA 4D46A 1KO8A 2D59A 4ZO8A 2H2FA 3EGDA 1XD2A 1M0WA 1AXRA 2XF8A 4QD3A 1S4MA 3HXLA 4NICA 1BW9A 4YRGA 3E7DA 5CDYA 3MHTA 3W5CA 3BGSA 4WFQA 2JIPA 3MJCA 2XVMA 4LI0A 4QYSA 1DX4A 4N7BA 1B4DA 4C9BA 1DCFA 4CRWB 4HDRA 3KKMA 4TMKA 1BIFA 2R11A 5CXQA 3BA6A 4M0UA 1SKMA 3IHWA 2OCBA 4J0QA 4X8HA 3ROKA 3K9GA 3O2QB 4N5LA 1EVQA 2PMDA 1VZ3A 3TLBA 4AJIA 3NYIA 1ZNZA 1D6SA 1E3LA 2JI8A 1EDOA 1UZMA 3DE6X 3PXGA 2ACEA 4BXOA 1KQ3A 5F2KA 5AW7A 1U0EA 1GGHA 5EA2A 4YRJA 4BECA 4DV0B 4FHEA 4W5HA 3SC3A 4JGBA 2FK8A 4JLBA 5EHNA 4C21A 1CUEA 1TQ8A 4OHWA 4EA8A 5AVQA 3HBMA 4XWTA 2QJWA 4B76A 4F5WA 2BFBB 3ZHZA 2JVJA 3ADOA 1T4BA 3LCUA 4BWVA 4D98A 4TYMA 1V5EA 2ZFUA 2LGJA 1GCIA 1LBSA 1Y6QA 4MRSA 4A8PA 1AH2A 1W5FA 5HS4A 3A1NA 3CZ5A 4FOOA 1XLTA 3NTXA 4CTOA 1RZVA 1QK3A 3L92A 4AULA 1AN9A 1HQCA 2ZDGA 1G18A 3IGFA 3DQPA 3KELA 5DNAA 1ISSA 1L4BA 2A5GA 4JIMA 1MIOB 4UHBA 1FL9A 1DUSA 4HTFB 3W2TA 2ORED 2XCRB 2YIDA 5FA8A 2FQQA 5HJ2A 3ASYA 3BORA 4B3GA 3LO8A 3FD8A 1LRKA 5ALWA 2GNAA 2G82A 3SZMA 4C2TA 1WXQA 2QWXA 1CV2A 3C3XA 2OXEA 4H3VA 4HUQA 3EA0A 3PU6A 1N0HA 1Z7EA 3BMQB 2ZRIA 3BFPA 3TNFA 2VTKA 1NKVA 4C88A 2CNWA 1A7UA 1M5RA 4PR3A 4MWZA 1LSSA 2H1IA 3JR3A 3GJZA 2PBLA 5F21A 4H7PA 4NFLA 1QYVA 3VISA 4BQRA 5LPNA 4BVLA 1R10A 3F5MA 2NO1A 3Q0IA 1D03A 4YALA 4BVAA 5DCYA 2I2FA 4TYYA 1CJKC 1Y4AE 4JB8A 4QHYA 5CRIA 3MWYW 3RIHA 1YC2A 3WFJA 3LPDA 3U4AA 2QTVB 3A4MA 2AMJA 3JQ7A 3OQ1A 2DHQA 2F8MA 4R9UC 1A5AB 1XEFA 1YHNA 1E2KA 2I2AA 3T8YA 2HMUA 2Y99A 5AK0A 3YASA 5FPSA 5CEJA 5KU7A 1SR8A 2WI8A 4ZT7A 4EEZA 4XDYA 5ALTA 1EHIA 1J0EA 4M36A 5FJJA 3W2FA 1N25A 1O87A 3EJ6A 3O3NB 5EKSA 5FT9A 4WLNA 1VBKA 3RSLA 4LTNA 4PTZA 7REQA 4M98A 5IT5A 4FLMA 1A9OA 3PICA 2FZLA 2SCUA 4JP3A 3PD1A 1MVOA 6REQA 2QKYA 2PZAA 3H6GA 2OKGA 4YDRA 1MX5A 1NSYA 3R0ZA 1KBQA 3W5UA 2W71A 4JJ6A 2LNDA 4P32A 1SKQA 3V48A 4KGXA 4WXRA 4EGSA 5FWDA 4QFDA 4CI9A 1UBEA 2PH3A 3ITEA 3CZPA 4IKPA 2J7PD 4D9IA 3F9CA 3RT7A 1GUFA 5THXA 2FDRA 1I2ZA 4WBSA 4XARA 1VHQA 4K9MA 1HNWB 2OUIA 2DULA 3WBKA 1I24A 4ZVSA 3VVMA 1TM2A 1C9DB 1ESZA 4B44A 1Z08A 1H2ZA 3PEUA 3QI7A 4TGLA 4CIVA 1E9BA 3AGQA 3RS4A 4PSCA 4DDHA 3L6BA 1M54A 2OWEA 2I3BA 1P5HA 3A28A 1TMGE 1XRNA 2G7MC 5BQXA 3ETCA 1CY4A 3EW9A 1XSEA 4L5AA 1XF9A 3GPIA 4NK5A 1GR1A 4J3JA 5JUWA 1HY3A 1II8A 2GF9A 4YJHB 3RUPA 2XCSB 3ZGVA 2O8FB 1LEHA 5K05A 2NUPB 1O3YA 3HYRA 3WR5A 4BPRA 1SQ5A 5B3LA 5JCXA 2IFTA 1VLQA 3EMVA 1U6JA 3GGCA 4Q34A 4AKEA 2PKWA 3QUQA 5IM5A 2O7SA 2O1SA 1XU9A 1ZVQA 3DDZX 1YC5A 2WVGA 4B6FA 5C31A 1U0NA 4MJ3A 2ZRNA 4QSMA 3KDAA 5FAKA 4UE6A 1P9WA 1WSDA 3DPIA 3JALB 1A8IA 1W1WA 1B8OA 3MTIA 3QV1A 3V8QA 3OX2A 2OHJA 4NRDA 3O3CA 2YZMA 3K0KA 1O0BA 3G8YA 3A9UA 5IHPA 3LBAA 3DV9A 1SG0A 5I5GA 2ADFA 4MV7A 2BT4A 1CRWG 5KYVA 3ZGLA 3Q88A 3B38A 3JRNA 4P98A 1TNDA 2DKFA 4LC0A 3TZQA 2WUVA 3DEZA 1K3TA 4INJA 2QUAA 3IPXA 5IVKA 5JFOA 3QU5A 4NECA 4NHOA 1TUEA 3FKJA 3PP8A 1L3BA 2BFCA 1E9CA 2NU6B 3OLQA 1YVPA 3RVQA 1OX5A 3FAZA 2WWHA 2YVLA 3N2KB 4LVCA 4R9NA 2RB5A 3MJRA 2IIBA 2XA2A 1SKUA 2BGJA 3BRWA 3BWXA 3DCYA 1F2DA 2LR0A 1PJ2A 3ZI0A 3FKSA 3KV3O 4MINA 5COAA 4O6VA 2B7BA 2FPGB 4YMLA 5GJBA 3EIHA 1RYBA 2F8LA 1M66A 3MWKA 4W5OA 1CY1A 4IHQA 8ATCA 5BSEA 1TU0A 1QV9A 4BBAA 4M46A 2WU3A 4I5IA 1XRSB 5JAIA 3G1WA 2BGUA 5JXWA 4YCLA 2NU9A 1WU7A 5T6BA 4YAIA 1YQXA 4OAQA 4BNMA 4X1KB 1WMDA 4S35A 5ICEA 3DBHA 5J2TB 3INYA 2EFYA 3ANMA 2VVTA 5JC8A 2WMNB 4X84A 2W7TA 4ZYLA 3B3AA 5I9TA 1MJ5A 1O6FA 3INGA 3IQDB 3W8DA 4YMSA 2PXCA 2DR2A 3QENA 3K4PA 1F5SA 4RQTA 5HP4A 4BNYA 1L8LA 3ED5A 3QZUA 4YP0A 5ARCA 3GRUA 2P4HX 2R00A 3EA5A 2PGLA 3D2CA 3L6OO 3OOEA 1Q0PA 4HAIA 5TARA 2BWJA 4UCQA 4LOKA 5B30A 1XCLA 2HJGA 1VE6A 4JLAA 3NT5A 3MN1A 3WGZA 1IAVA 2XYQA 3LVFO 5T67A 4RK1A 5C5IA 4U6SA 1A5ZA 2I6UA 2WT8A 3FX2A 2RHRA 5HDQA 3P2IA 4FFMA 4KXYA 3R7WA 3RR2A 3RVRA 4ZO9A 4EY5A 5BMVA 5KPJA 4IJ5A 2QG6A 3QEOA 4HMOA 1TE2A 2B37A 2HQ1A 3OZIA 3WDKA 5IX8A 2IEAA 1H4VB 2BUCA 5FNVB 4HVAA 1ZJ6A 3E81A 1RYFA 1U6KA 1VXRA 2HWUA 2VDKB 5JVDA 3T4UA 5DHUA 1V7ZA 3MGCA 4OQMA 4EPYA 2ZYIA 1P9NA 2FG6C 5BYAA 3ZVMA 3F7TA 1USKA 1GPBA 5CMLA 2E5WA 4IP0A 3L93A 1KI2A 3LOQA 1WXGA 1R27A 1JJ7A 3FUUA 4MOWA 4DBLE 4RVUA 2GLUA 2A1TR 1DTSA 4N3CA 4N0MA 3ZU3A 5FOWA 4MS3B 4OI1A 1G59A 4L0DA 3UQZA 4Z4GA 4S2EA 4DCSA 4YJDA 3HB4X 4LJKA 3UMGA 1SCIA 3RHZA 1DADA 3FWNA 3NWEA 2AE1A 2EATA 2GUWA 2ZLBA 2PX4A 2P79A 3N0WA 3PDIB 2P2GA 4MIOA 4NYIQ 1SC1A 3NHLA 4LDRA 2P6MA 3DHYA 1OBHA 1SXJB 4KQWA 3W7VA 5K20A 4EO9A 4J6EA 1DX9A 1XR3A 1OFIA 2J9GA 4FLFA 4G0NA 3N8HA 2P1RA 4G97A 5C2JB 1LNSA 2PA3A 2VTBA 1Y1LA 1K08A 1MB2A 5HRUA 4G5YA 1OLOA 2MINB 4YQYA 1ZH0A 1AHHA 1DRKA 1UKEA 2GPTA 2NO5A 3NIBA 1OH7A 5LXTB 3H5WA 1DI0A 1NV8A 1QKKA 2D1TA 1NN0A 2AS0A 2Z9CA 2VYNA 3ZE0B 2H5JA 3PQ6A 2FW9A 4E21A 4KP7A 5BORA 3DDCA 2UZ3A 3KL4A 3F49S 2F4VB 3KPYA 1GRRA 3AUFA 4BTLA 1L2TA 4RF4A 1P3DA 3PCXA 4EITA 5IMBA 4NLLA 1NATA 1C3XA 2Y71A 3NHRA 1KIFA 2CZGA 3HWWA 2JGIA 4HGYA 5L45A 1ZA1A 5EZSA 2ACKA 4LOIA 2BLNA 1YRAA 3A4LA 4U7HA 4AMYA 4F6CA 1SG6A 3KQPA 1OGJA 1VPTA 2J4FA 4XQEA 4IDBA 2ZM5A 2IXGA 3U4MA 1LLQA 4ESOA 2O2JA 2V9ZA 1J33A 4RA6A 3FGOA 2XZOA 1ACMA 3H5NA 5K8UA 3OEHA 3FLBA 1RZRD 3IL2A 4RFLA 1Y98A 2FR0A 4QOFA 2R4TA 1MHTA 1POWA 1EVYA 3L0YA 4S0ZA 3DMRA 2BSAA 3RASA 4BX8A 1MEEA 4KXQA 3FTNA 1DG3A 1N8KA 2FUCA 1RS0A 3QIAA 4PPGA 3JQQA 4ROSA 2C82A 1MQ9A 5L7YA 1EAYA 3T7CA 2E49A 3CONA 2OAP1 1TTHA 2A88A 4PSAA 1NT4A 3C7AA 4N8DA 4BBJA 1UBFA 3BXXA 4UPDA 1ONBA 1Y34E 2YN2A 3VSCA 5LU8A 2O06A 2PT7A 3AHGA 4D8YA 3ANNA 2G06A 2GZMA 5JZ9A 1Q0LA 2WWWA 3H75A 4X1YA 1GTJ1 1UJ5A 1W4LA 2PWYA 3AFIA 3QJGA 3K8OE 4Y2YA 4KBYA 2EFJA 4HY3A 4BN5A 3BHNA 5BR4A 1EJBA 4PINA 5IJXA 1JXOA 3G7SA 3I9JA 2FCRA 3DC7A 1TOAA 5IULC 2HA0A 3FAKA 1L5RA 2D7CA 3UIEA 5MHTA 1VQ1A 3IS3A 3TSOA 1WQ1R 1XRPA 4XGKA 3ZWDA 2QTGA 2X4LA 1JLKA 1OZ0A 1TF7A 3OLZA 1SCUA 3TLJA 2JZNA 4MIYA 4F8JA 3K70D 5B3AA 2Z1MA 3LTNC 2W11A 3KQWA 3KLBA 3WYEA 4LDNA 2AWOA 4AMGA 2NUTA 1SUWA 2JFHA 4ZI2A 4IQFA 5AVTA 1DAHA 1T0BA 3BFKA 3GJSA 3QNWA 2DMRA 4JYMA 4MR7A 2DUWA 1FSGA 2I3DA 2ZETA 4Y2SA 3TEMA 1Q2UA 4TWRA 1S2GA 1N77A 4G5OA 1HTBA 4S1WA 3OF5A 1YR7A 1KC1A 2W2KA 5TMDA 4HEQA 2H57A 4RJJA 2ZBQA 2IGTA 3OEYA 4Y0AA 1LSUA 1QMGA 4BRSA 4JYBA 2EP8A 1Y7TA 4G0ZA 4LBYA 4DRXB 1NJ2A 3IXQA 3NHZA 4AS2A 1JAZA 3DFKA 2D2EA 4Q16A 1JKJB 1OIXA 1TU3A 3LLMA 4JUBA 3I1IA 4I66A 2XTAA 5JZBA 5LUAA 1N5RA 1Z7BA 3P8ZA 5ALVA 2WVHA 4BFZA 2F1KA 1KDTA 3M8KA 1I3LA 3OICA 4I1IA 1NRWA 3UWOA 2ZZKA 3K15A 4NENB 4W6QA 4LAFA 2J9FB 1J8QA 4QO7A 4YECA 5IF3A 1Z4NA 3T7AA 1FUKA 1SURA 3Q2IA 4IJQA 4LDJA 1DJOA 1SD1A 2P9EA 1T35A 3H5VA 2GNPA 4UUMA 2XD9A 5DJ5A 3KQHA 2VDOB 1QGZA 3ZWAA 3EXEA 1HDCA 5L9AA 1RQ2A 1HYBA 2OSVA 3TIFA 1QPGA 4TM7A 4Q1EA 2B98A 4NCIA 3JZIA 2R8PA 4CVNA 1QPBA 1YI8A 1ZPDA 5JQGA 1E89A 1Z0SA 2OPBA 1ODSA 3DAPA 3FWHA 1NDUA 2WZBA 4FWIB 1WRBA 1A2OA 2ZPAA 3OQJA 3OTQA 3QLVA 1HL7A 3C16C 1L5SA 2E5FA 1OROA 2FHSA 2IC5A 2N46A 3C70A 1T2UA 3K2QA 4L22A 3VSDA 4KIUA 2DKNA 2XOXA 2Z0MA 3E0QA 4LPSA 4D42A 1YRLA 1AOXA 2IW3A 3FGPA 2A5LA 4MRNA 2FLKA 1N78A 3KLOA 4GGMX 3IHTA 4CV1A 5HIKA 5JFGA 3R20A 2PWZA 5GAJA 2GN2A 4X7PA 2ZE5A 3D6HA 4DEYA 4BGIA 5K8VA 2PT6A 2OV1A 5ALUA 3E23A 2HO5A 3QG5A 2BCGY 1SOAA 2VH5R 3DGEC 1ISFA 3HJTA 4R1QA 4ZK2A 5KVQA 3WLMA 5JBQA 1Y5MA 4RTKA 3DZGA 2GN9A 2CHGA 3G2OA 4PRYA 3OJXA 4CLOA 5BQOA 3OZXA 1JQJC 5G1OA 4OY3A 4L78A 1M7HA 2HMTA 3KTAB 3MMZA 3ZKWB 5JWRA 2PY6A 3JWJA 1LWOA 2AD1A 2P9GA 3VKGA 3AXSA 3IDFA 3JQGB 4EGAA 2WVAA 4ESVA 5AICA 2NVUA 3T52A 1A2QA 4BGEA 4ND8B 3ND9A 3C3DA 4HB0A 4EA7A 3GA5A 1KJ9A 1RZUA 3JVDA 1FFYA 3RFXA 4RPIA 2AJTA 4EP1A 2QT1A 3L18A 4MVJM 3P19A 5EUCA 3RREA 2QQEA 1Y5RA 3Q7TA 4B7CA 1DIHA 1I3OA 4X65B 1PNOA 1LKZA 5DNWA 4LGCA 4O1HA 2WYIA 3SJUA 4HNAA 1OLXA 3GJ0A 3PNMA 3PI6A 4BKOA 2H2GA 2GF2A 3WNBA 1K8ZB 3BMNA 1QDEA 3ZHCA 1SCJA 1SXHA 1J0BA 4JB2A 1T5LA 3LDHA 2WJPA 1I5EA 2QT9A 3OMWA 3PFIA 3K05A 3P4YA 4KXWA 3ZJYA 1RRGA 2VJKA 1K63A 1QONA 4L3VA 2D54A 4UBMA 4DL9A 1IOZA 3ZCVA 2BHSA 1JSZA 2Q1WA 2FZ4A 1IATA 4XIJA 2PBFA 2QTAA 2NTNA 3LVQE 3PJDA 3DO6A 1XA0A 3QX9A 2R1TB 4MH0R 3EEYA 4L1KA 2IWRA 4DCOA 1B2RA 2WQ7A 1TT7A 4E3WA 5C4IA 4TZ6A 4D57A 2O8NA 5BN1A 5EZYF 2H4FA 1VPVA 1ZK2A 2OBYA 4J90A 4RA6B 3ZIAD 4D80A 3V3KA 1KI1A 2AGVA 3U4GA 3VGPA 2R7NA 4FUTA 1FJGB 4Q3OA 4ZO7A 4FS8A 4Y9SA 2VWHA 3T1QA 3SWWA 1W4ZA 4GZLA 3DCNA 5KYUA 2X9NA 4J16C 5EMHA 3L1JA 5ALEA 5ESXA 2VRBA 2OM6A 2GEUA 3HCNA 3T1NA 3TW4A 2NVBA 4CMEC 1Z28A 4U8HA 1RTKA 4PONA 1QH9A 3OHMA 1DEHA 1VJDA 2JJ1D 4R1LA 3CEHA 4Q05A 1JE1A 1OU4A 1XVLA 2CDRA 2H07A 3ITDA 3LPLA 5EPUA 3T7TA 2LKCA 5BYJA 4EHJA 5LIRA 2P6OA 5EXSA 2AOUB 4QTTB 5B4TA 3W05A 5BMVF 1EINA 3AVOA 2PSEA 4J91A 5A3JA 1BX3A 5A2GA 2XB6A 1E4EA 3KSRA 4MWTA 3U4HA 2CBXA 1U3WA 3LD9A 1JHUA 3JQAB 3CSDA 4EH1A 3FSJX 3EAFA 2ORIA 3OLWA 4NQRA 2RHGB 2F3PA 2XKBA 1WB6A 2HDOA 2DERA 4A0SA 3G02A 1RBMA 4R1SA 3COYA 1NR1A 1WXWA 2B92A 3GJXC 3MBKA 1JIJA 1U5BA 3SBDA 5I9IA 5K3OA 2AFIE 1ECJA 2E1RA 4MGEA 1ATZA 1JIVA 2RONA 2VTBB 2H5IA 2OZVA 2NWQA 4EFMA 1YD7A 2CL6X 2HUNA 3CTPA 3JTMA 3KJQA 2GAJA 3I39X 4M49A 3SHVA 2YOFA 5EERA 5IAEA 1ZHFA 2JIQA 3PDIA 3PVZA 3W2EA 2I0FA 4DGQA 3SYNA 3KEOA 4AY4A 4M1ZA 3M9WA 2VK4A 1C9YA 4S1VA 5FJIA 1GPKA 2GS9A 5FWXA 4K6FA 3ZBPA 3LC0A 1LTHR 1G3QA 2OO5A 3MNFA 3I4FA 1KVUA 1BEUB 2P1ZA 2AQHA 3MFQA 3PQFA 1O96A 2OCAA 4V0KA 3K8ZA 1JFFA 2H0RA 2EG5A 2XE8A 2H2AA 1RXUA 5AI5A 3I9LA 2Z8XA 2KLBA 4CN8A 1U2TA 3CVVA 5K4AA 1TDJA 5HFNA 1TKAA 4AI6A 1JDSA 3C6YA 4NVRA 2MYNA 1G8HA 3K5HA 1YWGO 3ZD6A 4UU8A 3NJ4A 2WU1A 4L9AA 1GDTA 1NASA 3AM3A 1KBOA 2NZXA 3U4QA 1LD3A 3OESA 3L0CA 5KHOC 5JWHA 1JV2B 3THXA 2X15A 4II3A 1QF9A 3D8UA 3AVYA 4G1UC 4J9UE 3H4VA 1XKQA 3LY9A 4ZCIA 2CE2X 3O1LA 2EX1A 4GKVA 4KU4A 2FPIA 1LI7A 5ITWA 3IAXA 3KDPA 3F2IA 3B7PA 3A11A 4OI4A 1FRNA 3QVJA 1J0XO 1Z0UA 4PLYA 1KDVA 1XPUA 4A2CA 2C7BA 3THOA 3QPDA 3A6DA 2J31A 4CEIA 1UKYA 4B33A 3QPBA 2NUBA 1TW3A 3KR2A 4I8DA 1OBOA 3ET4A 2C78A 2G6BA 3N2YA 4QPJC 3WRWA 3LX5A 3U3OA 3I9V6 3NKLA 5TB5A 1EH5A 2BY4A 2P7HA 1F51E 3NHMA 2IIPA 3WGVA 4CMGA 2G36A 1TVKB 1ZDMA 2DBQA 2RHTA 5A9TA 3DAHA 2ISQA 3WMFA 5CFNA 2X4DA 5SY6A 3ZGZA 1UPTA 3TLAA 2H92A 1QIIA 4JQYA 4W1RA 1J7JA 1KEUA 4MLDA 1YB2A 2C1EA 2J8ZA 1ORRA 2VPPA 3S68A 2V5VA 4J43A 5JNTA 1CXZA 1U2DC 3UG6A 3U1VA 3CRQA 3GLHE 4EG6A 2D8MA 3EDOA 4II7A 2R3SA 4C7OB 1AKUA 3OZDA 4DF3A 2C0PA 3A9CA 4P38A 1YQTA 5EGSA 4GXTA 2D5BA 2ZI9A 3BXOA 4XXHA 5EYPB 2J9YB 5LXTF 3UOAB 4E07A 2O20A 4IXDA 7MDHA 3JQGA 4F6RB 2IS4A 4N76A 1FFEA 2XNCA 5MFPA 5F9FA 2C4NA 3TH5A 3ZDAA 1OH5A 2BKUA 3KAQA 2R25B 4OGLA 1ZWLA 2OCYC 4JUAA 4MW2A 2BSQA 1HG0A 2YUTA 4JLNA 1GM5A 1KF0A 4YONB 2J0VA 2NU6A 2VHJA 4S1NA 4DY4A 1IIRA 4I4NA 4KV7A 2PS9A 1BCRA 3L0OA 1IUKA 4YMIA 4LFAB 2VP5A 3PNYA 3U80A 4TSFD 1K5DA 2CVHA 2B3TA 2V55B 4RX1A 4BVEA 3Q9NA 4AKSA 4G07A 1VYTA 4PWYA 5TPZA 3A3KA 4AJOA 5A7FA 5JSYA 5BUSA 4U9HS 1WDTA 1D0IA 3OIFA 2HRCA 2D06A 2JI6A 1LC3A 3NLLA 4LHZA 3F5QA 4U02A 1JMVA 3T7IA 4E11A 3EIQA 1NLMA 5E0KB 3FOFC 3EOZA 1CR4A 1Z0KA 4IIJF 2VCYA 1ZOSA 3PQ4A 1TEXA 4DIFA 1DT5A 2CFCA 1FTYA 4BQFA 3CH7A 3TN7A 4F3NA 5JQGB 5DM4A 5ED4A 4D5GA 4UHHA 5JSZB 3TDMA 5DM1A 5DMXA 4C06A 5CFQA 2ZP1A 1XCPA 2XMCA 4FT2A 3U3RA 1NQWA 3C3CA 4ZPJA 4Y2TA 1C7QA 2X0KA 2AL7A 3AXTA 2O8FA 3EGEA 2QVXX 3N7AA 1I5OA 4K87A 5LP6F 1Z07A 2ICAA 3VPBA 5K3SA 4KRXA 3GLGE 2RC6A 4Q7LA 2GUGA 1ZU4A 2R86A 4KG7A 4LY0A 4XOIA 2V7TA 3AEZA 3MPUA 3U7QA 4PIVA 3I2YX 1YIOA 2FN3A 1CE8A 1TJNA 4PC1A 3ZK9A 3DTVD 1H1DA 1ZD1A 5KUTA 4YRAA 4V39A 2WWRA 4JBWA 3IR6A 3KT6A 4IVNA 4GL4A 3F5SA 5ALXA 4OOEA 4LPKA 3WFZA 2O8VA 4A92A 1EKXA 3DJYA 4ARIA 2OO7A 4PGAA 3W8RA 4CMEA 2J08A 3ABRB 5DI3B 4IILA 4P4UA 3R7BA 3RNLA 1PFUA 1HLDA 3R0JA 1YKFA 3AYXB 4V0LA 1B14A 3I9FA 3M33A 4G5QA 3OIWA 1JDUA 1QAMA 3O4VA 3PXDA 1ZM7A 2FF7A 1R6DA 1IFXA 1LJUA 1MOPA 5BSTA 3IB3A 5EIWA 1GSHA 1QP0A 1ZHHA 3A06A 4OATA 1AUXA 1VKJA 1KKUA 1YI0A 1P1FA 3E15A 3ZLBA 1M9NA 4EPRA 3V3TA 1PT5A 1RM5A 1ZM3A 4C0SA 3A6HA 3EZXA 2H11A 3AIOA 2FSIA 1R0ZA 5EQTA 3KX2A 4CM1A 3X1KA 1I4DD 1KZ7B 2EV9A 2BMAA 4RZQA 1DBIA 2XVXA 7REQB 3B3QA