1DZCA

High resolution structure of acidic fibroblast growth factor. mutant fgf-4-ala-(24-154), 24 nmr structures
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
131
structure length
131
Chain Sequence
AAALLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBROBLAST GROWTH FACTOR 1
publication title 1H-NMR Structural Characterization of a Non Mitogenic, Vasodilatory, Ischemia-Protector and Neuromodulatory Acidic Fibroblast Growth Factor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 36
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2000-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1dzcA00
1JTCA 1HWMB 3VWCA 4LO3A 1S0GA 3HMYA 3NBEA 3I2AA 3O4OA 1IRPA 4OWKA 3P6IA 3HN1A 3K1XA 5G00A 2X2TA 1MD6A 1S0BA 1IRAX 4I4VA 3CA3A 1WD3A 2R9KB 2J3PA 4ZKTB 3N7KA 4IQPA 3UD7A 3BAGA 4TLPA 4J2YA 4I4OA 4LO2C 2VXTI 2KKIA 1FWVA 2NM1A 1RG8A 1G82A 2VXRA 4EEEB 1P63A 1Q03A 2ET2A 4JQ0A 1XG6A 4AN7B 5JLVA 31BIA 2BFHA 4IHZA 2AAIB 3Q7WA 3NBDA 3O3QA 3O4DA 3CRIA 3ZC8A 4I4UA 1EPWA 1PUMB 4GOYA 3V0BA 1K5UA 2D7IA 3BAHA 2X2SA 2I1BA 2KI6B 1JY0A 3TC2A 3O5WB 3PUBA 3AH2A 1DFQA 3BA7A 3CRGA 4ENDA 4IY8A 4KEIA 2DREA 3POKA 4FGFA 2XOAA 4I37A 3AKFA 1N4KA 5HPZA 3WINA 1HWNB 4QKSA 41BIA 4USPA 4X3AA 1I1EA 1JT7A 4R6UB 1J0SA 3ZXDA 1AVXB 3BAQA 3A23A 4I8MA 3CA6A 2Q9XA 4USOA 4Z9WB 3BAVA 3F62B 3AJ5A 1XHBA 3RTIB 3OGGA 3FJFA 3PHZA 1YF8B 2AQZA 4DCKC 1W3GA 3CA5A 3FJ9A 1TOOA 1XYFA 2GZBA 1DZCA 4GOVA 3CA4A 4I4RA 3WMUA 4LO1C 3AZVA 3BRDA 3VT0A 1DQOA 1SZ6B 5D62A 4X37A 1DJSB 4EFPA 5F8SA 4HR6C 4F83A 1SR4C 2Z48A 2ZQOA 2P39A 3V0AB 1A8DA 3AKIA 1BASA 1D0HA 3AKGA 1VCLA 4JPZA 3S8KA 3RSJA 4D0ZA 3I2XA 1K5VA 2VSEA 1II4A 2KLLA 2Y9GA 3C9ZA 3ILAA 2HWMA 5FNXA 4I1EA 4KEKA 2Q3NB 2VUAA 3H6RA 5DSSB 4ZLBB 3NBNA 2M49A 4ZOTA 4D0TA 1S0DA 5D63A 3FJEA 1IT0A 3BAUA 2D24A 2FDBM 1I1BA 2YUGA 1IHKA 5F8WA 4XKIA 2ESUA 5BOWA 2E4MA 1T9FA 3PMEA 1WBCA 4OW4A 1FQ9A 1RZOB 3Q7XA 1BFGA 3F1RA 3O4BA 3VEQA 1F31A 2D23A 2UUSA 1DLLA 3FFZA 4Q91A 4X38A 4IONA 5EC5A 1TFMB 4LO0C 4HA2A 2DS0A 2K4AB 2FGFA 2ERMA 4AN6A 2F8XC 4GP3A 1G9CA 2D20A 4G9MA 1L2HA 4H9WA 3VSFA 4KBBA 3R4UA 1E0OA 2K8RA 3LTQA 1WBAA 1NZKA 1PWAA 3JUTA 2D7RA 4FVVA 4I4XA 1ONKB 2VU9A 1ILR1 4LO2A 1M16A 3BRGC 1JLXA 4QD2B 3UJ4A 1DFCA 2NP0A 3AKHA 4ZA3B 2KH2A 4EFQA 1ABRB 1AFCA 4G6MA 4LO7B 3AZWA 1BFFA 3VT2A 3N7JA 4OUJA 1V6WA 2P23A 5BXPA 4I3NA 4P6AA 3RMYA 4L4HA 4ZFYB 3CRHA 5BP5C 4WBCA 2HWAA 1S0LA 2AFGA 2BEAA 2WRYA 4F34A 3ZC9A 4I4YA 4G6JA 4I1BA 4I4SA 2F2FC 4JP0A 3N7MA 1QQLA 1BFCA 2ZR1B 4Z8SB 1DZDA 1WD4A 4EFRA 4JKXB 3AJ6A 3CAHA 3CA0A 3BAOA 4J2SA 3H6RB 4I4PA 3WINC 1RMLA 1R8OA 2HZ9A 4OWLA 2Y9FA 3AH4A 1V6VA 3UDAA 1HWPB 1Z4SA 5F90A 3CU1B 4IZEA 2MC2A 4P0KA 4QD2C 4XFSA 3WO3A 3HSMA 3S8JA 3IIRA 4ZFUB 2MIBA 3FJAA 1BLDA 5DUYA 7I1BA 3PG0A 5BQUA 2K43A 1MC9A 1YBIA 9ILBA 1S0EA 1TTUA 3AH1A 3HBWA 4OWJA 1SR4A 3VUOA 2VSAA 3FJ8A 1BFBA 3FUOA 4YOLA 2IHOA 1Z0HA 1TWMA 3MPPG 1BARA 1PUUB 2Y9WC 1JLYA 2AXMA 5FZYA 1AXMA 1ISZA 1JT5A 3BRFA 3RMXA 3CA1A 4G1RA 3HALA 1HWOB 1TIEA 3A22A 3B9UA 2Y9XE 4I7IA 1Q1UA 3VT1A 4Q9PA 1HKNA 3BB2A 1FWUA 3V0BB 2LIQA 1HIBA 3KMVA 3OJ2A 4QALA 1ISYA 4ZFWB 1IJTA 1S0CA 2ZQNA 3FGMA 3NJ5A 3FJBA 4GAIA 4I4QA 4QC4A 4QBVA 3QYDA 4ZBVB 1CE7B 1BLAA 4CJMA 1IILA 3IM7A 2NTDA 1XZZA 3OGFA 8I1BA 3SNVA 1FGAA 4GP0A 2D43A 4Q9GA 2GO2A 4LO0A 4I96A 4I2SA 3O4AA 4A7KA 1EYLA 1PZZA 2D1ZA 4LO3C 2NYYA 4KC3A 1G9DA 1JT3A 3WMVA 3BA5A 5BXSA 1HCDA 3CQAA 3MALA 2DRZA 2BEBA 2DRYA 3QR5A 4EKXB 1ISVA 4IZXA 1DIWA 1FV2A 1AVWB 1V6XA 1PC8B 3O49A 2QN4A 4HJJA 4LO8B 4DENA 5FZUA 3BA4A 3A21A 5I1BA 3FJKA 1IOBA 2MLLB 2KI4A 4H04A 4PC4A 5B2HA 1G9BA 4DEPA 1R8NA 2FO1A 3BX1C 3LLPA 4JRAA 4IYBA 4A7ZA 1FMMS 3WA1A 5FNWA 3H6SE 4XFUA 1YTOA 1BA7A 4L4IA 1AVUA 5DVHA 1NUNA 6I1BA 4XFTA 3BADA 1AVAC 2QYIB 4OEFA 2NVHA 1AF9A 3OBTA 5F8YA 1JQZA 4A7YA 5BP5A 3FJCA 4I6IA 4ISQA 1FV3A 2D44A 3OBRA 1QQKA 2F2FA 3O4CA 5EHAA 2NZ9A 2L5XA 1FMZA 4IY9A 1M2TB 1QXMA 3FJJA 3E8LC 4P0LA 4QO3A 4D8HA 1TWEA 3ZX7A 3N0KA 4QBCA 1RY7A 3FUQA 21BIA 1EV2A 1TP0A 3IM6A 1ISXA 1FN0A 3IAGC 3FJIA 4OEEA 5GAQA 4LO1A 4LO7C 3Q7YA 4ISRA 1T4QA 1W3AA 3HOMA 4ZGRB 5BVPI 1Q04A 4J23B 3WO4A 1HCEA 3A07A 3UJ0A 3UD9A 3P53A 5BXRA 5EG6C 2RG9B 4QKRA 4KEJA 4JKQA 1YXWA 3I29B 5DZUA 1G9AA 5JMCA 5BQUC 2LIEA 2WBCA 1CVSA 1Z2VA 1EVTA 3NBCA 1UPSA 1DQGA 1KNMA 1S0FA 1YYNA 2FFVA 2RQ9A 3T8SA 4EB2B 1GGPB 2D22A 1W3FA 2IWTB 3BTAA 2FFUA 3WO2A 2RSTA 3R4SA 5D61A 3OJVA 4JAWA 3FJDA 5FZZA 3V79C 3FJHA 3ZXGA 4II0A 4OEGA 4P0JA 1ISWA 1ITBA 1V6UA 2E4MC 3H6QA 5BXTA 3UD8A 4G9NA 4I0YA 3O44A 4GAFA 3N7LA 3D7WB 3IM5A 3OJMA 5E24E 2HW9A 3RTJB 1OQLB 2VLCA 2Z49A 4J2XA 4X39A 3W9TA 3V0AA 3JRRA 1JT4A 3P6JA 3VSZA 4J2KA 3EF2A
chains in the Genus database with same CATH superfamily
1JTCA 1HWMB 3VWCA 4LO3A 1S0GA 3HMYA 3NBEA 3I2AA 3O4OA 1IRPA 4OWKA 3P6IA 3HN1A 3K1XA 5G00A 2X2TA 1MD6A 1S0BA 1IRAX 4I4VA 3CA3A 1WD3A 2R9KB 2J3PA 4ZKTB 3N7KA 4IQPA 3UD7A 3BAGA 4TLPA 4J2YA 4I4OA 4LO2C 2VXTI 2KKIA 1FWVA 2NM1A 1RG8A 1G82A 2VXRA 4EEEB 1P63A 1Q03A 2ET2A 4JQ0A 1XG6A 4AN7B 5JLVA 31BIA 2BFHA 4IHZA 2AAIB 3Q7WA 3NBDA 3O3QA 3O4DA 3CRIA 3ZC8A 4I4UA 1EPWA 1PUMB 4GOYA 3V0BA 1K5UA 2D7IA 3BAHA 2X2SA 2I1BA 2KI6B 1JY0A 3TC2A 3O5WB 3PUBA 3AH2A 4H75A 1DFQA 3BA7A 3CRGA 4ENDA 4IY8A 4KEIA 2DREA 3POKA 4FGFA 2XOAA 4I37A 3AKFA 1N4KA 5HPZA 3WINA 1HWNB 4QKSA 41BIA 4USPA 4X3AA 1I1EA 1JT7A 4R6UB 1J0SA 3ZXDA 1AVXB 3BAQA 3A23A 4I8MA 3CA6A 2Q9XA 4USOA 4Z9WB 3BAVA 3F62B 3AJ5A 1XHBA 3RTIB 3OGGA 3FJFA 3PHZA 1YF8B 2AQZA 4DCKC 1W3GA 3CA5A 3FJ9A 1TOOA 1XYFA 2GZBA 1DZCA 4GOVA 3CA4A 4I4RA 3WMUA 4LO1C 3AZVA 3BRDA 3VT0A 1DQOA 1SZ6B 5D62A 4X37A 1DJSB 4EFPA 5F8SA 4HR6C 4F83A 1SR4C 2Z48A 2ZQOA 2P39A 3V0AB 1A8DA 3AKIA 1BASA 1D0HA 3AKGA 1VCLA 4JPZA 3S8KA 3RSJA 4D0ZA 3I2XA 1K5VA 2VSEA 1II4A 2KLLA 2Y9GA 3C9ZA 3ILAA 2HWMA 5FNXA 4I1EA 4KEKA 2Q3NB 2VUAA 3H6RA 5DSSB 4ZLBB 3NBNA 2M49A 4ZOTA 4D0TA 1S0DA 5D63A 3FJEA 1IT0A 3BAUA 2D24A 2FDBM 1I1BA 2YUGA 1IHKA 5F8WA 4XKIA 2ESUA 5BOWA 2E4MA 1T9FA 3PMEA 1WBCA 4OW4A 1FQ9A 1RZOB 3Q7XA 1BFGA 3F1RA 3O4BA 3VEQA 1F31A 2D23A 2UUSA 1DLLA 3FFZA 4Q91A 4X38A 4IONA 5EC5A 1TFMB 4LO0C 4HA2A 2DS0A 2K4AB 2FGFA 2ERMA 4AN6A 2F8XC 4GP3A 1G9CA 2D20A 4G9MA 1L2HA 4H9WA 3VSFA 4KBBA 3R4UA 1E0OA 2K8RA 3LTQA 1WBAA 1NZKA 1PWAA 3JUTA 2D7RA 4FVVA 4I4XA 1ONKB 2VU9A 1ILR1 4LO2A 1M16A 3BRGC 1JLXA 4QD2B 3UJ4A 1DFCA 2NP0A 3AKHA 4ZA3B 2KH2A 4EFQA 1ABRB 1AFCA 4G6MA 4LO7B 3AZWA 1BFFA 3VT2A 3N7JA 4OUJA 1V6WA 2P23A 5BXPA 4I3NA 4P6AA 3RMYA 4L4HA 4ZFYB 3CRHA 5BP5C 4WBCA 2HWAA 1S0LA 4MZGB 2AFGA 2BEAA 2WRYA 4F34A 3ZC9A 4I4YA 4G6JA 4I1BA 4I4SA 2F2FC 4JP0A 3N7MA 1QQLA 1BFCA 2ZR1B 4Z8SB 1DZDA 1WD4A 4EFRA 4JKXB 3AJ6A 3CAHA 3CA0A 3BAOA 4J2SA 3H6RB 4I4PA 3WINC 1RMLA 1R8OA 2HZ9A 4OWLA 2Y9FA 3AH4A 1V6VA 3UDAA 1HWPB 1Z4SA 5F90A 3CU1B 4IZEA 2MC2A 4P0KA 4QD2C 4XFSA 3WO3A 3HSMA 3S8JA 3IIRA 4ZFUB 2MIBA 3FJAA 1BLDA 5DUYA 7I1BA 3PG0A 5BQUA 2K43A 1MC9A 1YBIA 9ILBA 1S0EA 1TTUA 3AH1A 3HBWA 4OWJA 1SR4A 3VUOA 2VSAA 3FJ8A 1BFBA 3FUOA 4YOLA 2IHOA 1Z0HA 1TWMA 3MPPG 1BARA 1PUUB 2Y9WC 1JLYA 2AXMA 5FZYA 1AXMA 1ISZA 1JT5A 3BRFA 3RMXA 3CA1A 4G1RA 4MZFB 3HALA 1HWOB 1TIEA 3A22A 3B9UA 4MZHA 2Y9XE 4I7IA 1Q1UA 3VT1A 4Q9PA 1HKNA 3BB2A 1FWUA 3V0BB 2LIQA 1HIBA 3KMVA 3OJ2A 4QALA 1ISYA 4ZFWB 1IJTA 1S0CA 2ZQNA 3FGMA 3NJ5A 3FJBA 4GAIA 4I4QA 4QC4A 4QBVA 3QYDA 4ZBVB 1CE7B 1BLAA 4CJMA 1IILA 3IM7A 2NTDA 1XZZA 3OGFA 8I1BA 3SNVA 1FGAA 4GP0A 2D43A 2NS2A 4Q9GA 2GO2A 4LO0A 4I96A 4I2SA 3O4AA 4A7KA 1EYLA 1PZZA 2D1ZA 4LO3C 2NYYA 4KC3A 1G9DA 1JT3A 3WMVA 3BA5A 5BXSA 1HCDA 3CQAA 3MALA 2DRZA 2BEBA 2DRYA 3QR5A 4EKXB 1ISVA 4IZXA 1DIWA 1FV2A 1AVWB 1V6XA 1PC8B 3O49A 2QN4A 4HJJA 4LO8B 4DENA 5FZUA 3BA4A 3A21A 5I1BA 3FJKA 1IOBA 2MLLB 2KI4A 4H04A 4PC4A 5B2HA 1G9BA 4DEPA 1R8NA 2FO1A 3BX1C 3LLPA 4JRAA 4IYBA 4A7ZA 1FMMS 3WA1A 5FNWA 3H6SE 4XFUA 1YTOA 1BA7A 4L4IA 1AVUA 5DVHA 1NUNA 6I1BA 4XFTA 3BADA 1AVAC 2QYIB 4OEFA 2NVHA 1AF9A 3OBTA 5F8YA 1JQZA 4A7YA 5BP5A 3FJCA 4I6IA 4ISQA 1FV3A 2D44A 3OBRA 1QQKA 2F2FA 3O4CA 5EHAA 2NZ9A 2L5XA 1FMZA 4IY9A 1M2TB 1QXMA 3FJJA 3E8LC 4P0LA 4QO3A 4D8HA 1TWEA 3ZX7A 3N0KA 4QBCA 1RY7A 3FUQA 21BIA 1EV2A 1TP0A 3IM6A 1ISXA 1FN0A 3IAGC 3FJIA 4OEEA 5GAQA 4LO1A 4LO7C 3Q7YA 4ISRA 1T4QA 1W3AA 3HOMA 4ZGRB 5BVPI 1Q04A 4J23B 3WO4A 1HCEA 3A07A 3UJ0A 3UD9A 3P53A 5BXRA 5EG6C 2RG9B 4QKRA 4KEJA 4JKQA 1YXWA 3I29B 5DZUA 1G9AA 5JMCA 5BQUC 2LIEA 2WBCA 1CVSA 1Z2VA 1EVTA 3NBCA 1UPSA 1DQGA 1KNMA 1S0FA 1YYNA 2FFVA 2RQ9A 3T8SA 4EB2B 1GGPB 2D22A 1W3FA 2IWTB 3BTAA 2FFUA 3WO2A 2RSTA 3R4SA 5D61A 3OJVA 4JAWA 3FJDA 5FZZA 3V79C 3FJHA 3ZXGA 4II0A 4OEGA 4P0JA 1ISWA 1ITBA 1V6UA 4UY4A 2E4MC 3H6QA 5BXTA 3UD8A 4G9NA 4I0YA 3O44A 4GAFA 3N7LA 3D7WB 3IM5A 3OJMA 5E24E 2HW9A 3RTJB 1OQLB 2VLCA 2Z49A 4J2XA 4X39A 3W9TA 3V0AA 3JRRA 1JT4A 3P6JA 3VSZA 4J2KA 3EF2A
chains in the Genus database with same CATH topology
1JTCA 1HWMB 3VWCA 4LO3A 1S0GA 3HMYA 3NBEA 3I2AA 3O4OA 1IRPA 4OWKA 3P6IA 3HN1A 3K1XA 5G00A 2X2TA 1MD6A 1S0BA 1IRAX 4I4VA 3CA3A 1WD3A 2R9KB 2J3PA 4ZKTB 3N7KA 4IQPA 3UD7A 3BAGA 4TLPA 4J2YA 4I4OA 4LO2C 2VXTI 2KKIA 1FWVA 2NM1A 1RG8A 1G82A 2VXRA 4EEEB 1P63A 1Q03A 2ET2A 4JQ0A 1XG6A 4AN7B 5JLVA 31BIA 2BFHA 4IHZA 2AAIB 3Q7WA 3NBDA 3O3QA 3O4DA 3CRIA 3ZC8A 4I4UA 1EPWA 1PUMB 4GOYA 3V0BA 1K5UA 2D7IA 3BAHA 2X2SA 2I1BA 2KI6B 1JY0A 3TC2A 3O5WB 3PUBA 3AH2A 4H75A 1DFQA 3BA7A 3CRGA 4ENDA 4IY8A 4KEIA 2DREA 3POKA 4FGFA 2XOAA 4I37A 3AKFA 1N4KA 5HPZA 3WINA 1HWNB 4QKSA 41BIA 4USPA 4X3AA 1I1EA 1JT7A 4R6UB 1J0SA 3ZXDA 1AVXB 3BAQA 3A23A 4I8MA 3CA6A 2Q9XA 4USOA 4Z9WB 3BAVA 3F62B 3AJ5A 1XHBA 3RTIB 3OGGA 3FJFA 3PHZA 1YF8B 2AQZA 4DCKC 1W3GA 3CA5A 3FJ9A 1TOOA 1XYFA 2GZBA 1DZCA 4GOVA 3CA4A 4I4RA 3WMUA 4LO1C 3AZVA 3BRDA 3VT0A 1DQOA 1SZ6B 5D62A 4X37A 1DJSB 4EFPA 5F8SA 4HR6C 4F83A 1SR4C 2Z48A 2ZQOA 2P39A 3V0AB 1A8DA 3AKIA 1BASA 1D0HA 3AKGA 1VCLA 4JPZA 3S8KA 3RSJA 4D0ZA 3I2XA 1K5VA 2VSEA 1II4A 2KLLA 2Y9GA 3C9ZA 3ILAA 2HWMA 5FNXA 4I1EA 4KEKA 2Q3NB 2VUAA 3H6RA 5DSSB 4ZLBB 3NBNA 2M49A 4ZOTA 4D0TA 1S0DA 5D63A 3FJEA 1IT0A 3BAUA 2D24A 2FDBM 1I1BA 2YUGA 1IHKA 5F8WA 4XKIA 2ESUA 5BOWA 2E4MA 1T9FA 3PMEA 1WBCA 4OW4A 1FQ9A 1RZOB 3Q7XA 1BFGA 3F1RA 3O4BA 3VEQA 1F31A 2D23A 2UUSA 1DLLA 3FFZA 4Q91A 4X38A 4IONA 5EC5A 1TFMB 4LO0C 4HA2A 2DS0A 2K4AB 2FGFA 2ERMA 4AN6A 2F8XC 4GP3A 1G9CA 2D20A 4G9MA 1L2HA 4H9WA 3VSFA 4KBBA 3R4UA 1E0OA 2K8RA 3LTQA 1WBAA 1NZKA 1PWAA 3JUTA 2D7RA 4FVVA 4I4XA 1ONKB 2VU9A 1ILR1 4LO2A 1M16A 3BRGC 1JLXA 4QD2B 3UJ4A 1DFCA 2NP0A 3AKHA 4ZA3B 2KH2A 4EFQA 1ABRB 1AFCA 4G6MA 4LO7B 3AZWA 1BFFA 3VT2A 3N7JA 4OUJA 1V6WA 2P23A 5BXPA 4I3NA 4P6AA 3RMYA 4L4HA 4ZFYB 3CRHA 5BP5C 4WBCA 2HWAA 1S0LA 4MZGB 2AFGA 2BEAA 2WRYA 4F34A 3ZC9A 4I4YA 4G6JA 4I1BA 4I4SA 2F2FC 4JP0A 3N7MA 1QQLA 1BFCA 2ZR1B 4Z8SB 1DZDA 1WD4A 4EFRA 4JKXB 3AJ6A 3CAHA 3CA0A 3BAOA 4J2SA 3H6RB 4I4PA 3WINC 1RMLA 1R8OA 2HZ9A 4OWLA 2Y9FA 3AH4A 1V6VA 3UDAA 1HWPB 1Z4SA 5F90A 3CU1B 4IZEA 2MC2A 4P0KA 4QD2C 4XFSA 3WO3A 3HSMA 3S8JA 3IIRA 4ZFUB 2MIBA 3FJAA 1BLDA 5DUYA 7I1BA 3PG0A 5BQUA 2K43A 1MC9A 1YBIA 9ILBA 1S0EA 1TTUA 3AH1A 3HBWA 4OWJA 1SR4A 3VUOA 2VSAA 3FJ8A 1BFBA 3FUOA 4YOLA 2IHOA 1Z0HA 1TWMA 3MPPG 1BARA 1PUUB 2Y9WC 1JLYA 2AXMA 5FZYA 1AXMA 1ISZA 1JT5A 3BRFA 3RMXA 3CA1A 4G1RA 4MZFB 3HALA 1HWOB 1TIEA 3A22A 3B9UA 4MZHA 2Y9XE 4I7IA 1Q1UA 3VT1A 4Q9PA 1HKNA 3BB2A 1FWUA 3V0BB 2LIQA 1HIBA 3KMVA 3OJ2A 4QALA 1ISYA 4ZFWB 1IJTA 1S0CA 2ZQNA 3FGMA 3NJ5A 3FJBA 4GAIA 4I4QA 4QC4A 4QBVA 3QYDA 4ZBVB 1CE7B 1BLAA 4CJMA 1IILA 3IM7A 2NTDA 1XZZA 3OGFA 8I1BA 3SNVA 1FGAA 4GP0A 2D43A 2NS2A 4Q9GA 2GO2A 4LO0A 4I96A 4I2SA 3O4AA 4A7KA 1EYLA 1PZZA 2D1ZA 4LO3C 2NYYA 4KC3A 1G9DA 1JT3A 3WMVA 3BA5A 5BXSA 1HCDA 3CQAA 3MALA 2DRZA 2BEBA 2DRYA 3QR5A 4EKXB 1ISVA 4IZXA 1DIWA 1FV2A 1AVWB 1V6XA 1PC8B 3O49A 2QN4A 4HJJA 4LO8B 4DENA 5FZUA 3BA4A 3A21A 5I1BA 3FJKA 1IOBA 2MLLB 2KI4A 4H04A 4PC4A 5B2HA 1G9BA 4DEPA 1R8NA 2FO1A 3BX1C 3LLPA 4JRAA 4IYBA 4A7ZA 1FMMS 3WA1A 5FNWA 3H6SE 4XFUA 1YTOA 1BA7A 4L4IA 1AVUA 5DVHA 1NUNA 6I1BA 4XFTA 3BADA 1AVAC 2QYIB 4OEFA 2NVHA 1AF9A 3OBTA 5F8YA 1JQZA 4A7YA 5BP5A 3FJCA 4I6IA 4ISQA 1FV3A 2D44A 3OBRA 1QQKA 2F2FA 3O4CA 5EHAA 2NZ9A 2L5XA 1FMZA 4IY9A 1M2TB 1QXMA 3FJJA 3E8LC 4P0LA 4QO3A 4D8HA 1TWEA 3ZX7A 3N0KA 4QBCA 1RY7A 3FUQA 21BIA 1EV2A 1TP0A 3IM6A 1ISXA 1FN0A 3IAGC 3FJIA 4OEEA 5GAQA 4LO1A 4LO7C 3Q7YA 4ISRA 1T4QA 1W3AA 3HOMA 4ZGRB 5BVPI 1Q04A 4J23B 3WO4A 1HCEA 3A07A 3UJ0A 3UD9A 3P53A 5BXRA 5EG6C 2RG9B 4QKRA 4KEJA 4JKQA 1YXWA 3I29B 5DZUA 1G9AA 5JMCA 5BQUC 2LIEA 2WBCA 1CVSA 1Z2VA 1EVTA 3NBCA 1UPSA 1DQGA 1KNMA 1S0FA 1YYNA 2FFVA 2RQ9A 3T8SA 4EB2B 1GGPB 2D22A 1W3FA 2IWTB 3BTAA 2FFUA 3WO2A 2RSTA 3R4SA 5D61A 3OJVA 4JAWA 3FJDA 5FZZA 3V79C 3FJHA 3ZXGA 4II0A 4OEGA 4P0JA 1ISWA 1ITBA 1V6UA 4UY4A 2E4MC 3H6QA 5BXTA 3UD8A 4G9NA 4I0YA 3O44A 4GAFA 3N7LA 3D7WB 3IM5A 3OJMA 5E24E 2HW9A 3RTJB 1OQLB 2VLCA 2Z49A 4J2XA 4X39A 3W9TA 3V0AA 3JRRA 1JT4A 3P6JA 3VSZA 4J2KA 3EF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JTC A;  1HWM B;  3VWC A;  4LO3 A;  1S0G A;  3HMY A;  3NBE A;  3I2A A;  3O4O A;  1IRP A;  4OWK A;  3P6I A;  3HN1 A;  3K1X A;  5G00 A;  2X2T A;  1MD6 A;  1S0B A;  1IRA X;  4I4V A;  3CA3 A;  1WD3 A;  2R9K B;  2J3P A;  4ZKT B;  3N7K A;  4IQP A;  3UD7 A;  3BAG A;  4TLP A;  4J2Y A;  4I4O A;  4LO2 C;  2VXT I;  2KKI A;  1FWV A;  2NM1 A;  1RG8 A;  1G82 A;  2VXR A;  4EEE B;  1P63 A;  1Q03 A;  2ET2 A;  4JQ0 A;  1XG6 A;  4AN7 B;  5JLV A;  31BI A;  2BFH A;  4IHZ A;  2AAI B;  3Q7W A;  3NBD A;  3O3Q A;  3O4D A;  3CRI A;  3ZC8 A;  4I4U A;  1EPW A;  1PUM B;  4GOY A;  3V0B A;  1K5U A;  2D7I A;  3BAH A;  2X2S A;  2I1B A;  2KI6 B;  1JY0 A;  3TC2 A;  3O5W B;  3PUB A;  3AH2 A;  1DFQ A;  3BA7 A;  3CRG A;  4END A;  4IY8 A;  4KEI A;  2DRE A;  3POK A;  4FGF A;  2XOA A;  4I37 A;  3AKF A;  1N4K A;  5HPZ A;  3WIN A;  1HWN B;  4QKS A;  41BI A;  4USP A;  4X3A A;  1I1E A;  1JT7 A;  4R6U B;  1J0S A;  3ZXD A;  1AVX B;  3BAQ A;  3A23 A;  4I8M A;  3CA6 A;  2Q9X A;  4USO A;  4Z9W B;  3BAV A;  3F62 B;  3AJ5 A;  1XHB A;  3RTI B;  3OGG A;  3FJF A;  3PHZ A;  1YF8 B;  2AQZ A;  4DCK C;  1W3G A;  3CA5 A;  3FJ9 A;  1TOO A;  1XYF A;  2GZB A;  1DZC A;  4GOV A;  3CA4 A;  4I4R A;  3WMU A;  4LO1 C;  3AZV A;  3BRD A;  3VT0 A;  1DQO A;  1SZ6 B;  5D62 A;  4X37 A;  1DJS B;  4EFP A;  5F8S A;  4HR6 C;  4F83 A;  1SR4 C;  2Z48 A;  2ZQO A;  2P39 A;  3V0A B;  1A8D A;  3AKI A;  1BAS A;  1D0H A;  3AKG A;  1VCL A;  4JPZ A;  3S8K A;  3RSJ A;  4D0Z A;  3I2X A;  1K5V A;  2VSE A;  1II4 A;  2KLL A;  2Y9G A;  3C9Z A;  3ILA A;  2HWM A;  5FNX A;  4I1E A;  4KEK A;  2Q3N B;  2VUA A;  3H6R A;  5DSS B;  4ZLB B;  3NBN A;  2M49 A;  4ZOT A;  4D0T A;  1S0D A;  5D63 A;  3FJE A;  1IT0 A;  3BAU A;  2D24 A;  2FDB M;  1I1B A;  2YUG A;  1IHK A;  5F8W A;  4XKI A;  2ESU A;  5BOW A;  2E4M A;  1T9F A;  3PME A;  1WBC A;  4OW4 A;  1FQ9 A;  1RZO B;  3Q7X A;  1BFG A;  3F1R A;  3O4B A;  3VEQ A;  1F31 A;  2D23 A;  2UUS A;  1DLL A;  3FFZ A;  4Q91 A;  4X38 A;  4ION A;  5EC5 A;  1TFM B;  4LO0 C;  4HA2 A;  2DS0 A;  2K4A B;  2FGF A;  2ERM A;  4AN6 A;  2F8X C;  4GP3 A;  1G9C A;  2D20 A;  4G9M A;  1L2H A;  4H9W A;  3VSF A;  4KBB A;  3R4U A;  1E0O A;  2K8R A;  3LTQ A;  1WBA A;  1NZK A;  1PWA A;  3JUT A;  2D7R A;  4FVV A;  4I4X A;  1ONK B;  2VU9 A;  1ILR 1;  4LO2 A;  1M16 A;  3BRG C;  1JLX A;  4QD2 B;  3UJ4 A;  1DFC A;  2NP0 A;  3AKH A;  4ZA3 B;  2KH2 A;  4EFQ A;  1ABR B;  1AFC A;  4G6M A;  4LO7 B;  3AZW A;  1BFF A;  3VT2 A;  3N7J A;  4OUJ A;  1V6W A;  2P23 A;  5BXP A;  4I3N A;  4P6A A;  3RMY A;  4L4H A;  4ZFY B;  3CRH A;  5BP5 C;  4WBC A;  2HWA A;  1S0L A;  2AFG A;  2BEA A;  2WRY A;  4F34 A;  3ZC9 A;  4I4Y A;  4G6J A;  4I1B A;  4I4S A;  2F2F C;  4JP0 A;  3N7M A;  1QQL A;  1BFC A;  2ZR1 B;  4Z8S B;  1DZD A;  1WD4 A;  4EFR A;  4JKX B;  3AJ6 A;  3CAH A;  3CA0 A;  3BAO A;  4J2S A;  3H6R B;  4I4P A;  3WIN C;  1RML A;  1R8O A;  2HZ9 A;  4OWL A;  2Y9F A;  3AH4 A;  1V6V A;  3UDA A;  1HWP B;  1Z4S A;  5F90 A;  3CU1 B;  4IZE A;  2MC2 A;  4P0K A;  4QD2 C;  4XFS A;  3WO3 A;  3HSM A;  3S8J A;  3IIR A;  4ZFU B;  2MIB A;  3FJA A;  1BLD A;  5DUY A;  7I1B A;  3PG0 A;  5BQU A;  2K43 A;  1MC9 A;  1YBI A;  9ILB A;  1S0E A;  1TTU A;  3AH1 A;  3HBW A;  4OWJ A;  1SR4 A;  3VUO A;  2VSA A;  3FJ8 A;  1BFB A;  3FUO A;  4YOL A;  2IHO A;  1Z0H A;  1TWM A;  3MPP G;  1BAR A;  1PUU B;  2Y9W C;  1JLY A;  2AXM A;  5FZY A;  1AXM A;  1ISZ A;  1JT5 A;  3BRF A;  3RMX A;  3CA1 A;  4G1R A;  3HAL A;  1HWO B;  1TIE A;  3A22 A;  3B9U A;  2Y9X E;  4I7I A;  1Q1U A;  3VT1 A;  4Q9P A;  1HKN A;  3BB2 A;  1FWU A;  3V0B B;  2LIQ A;  1HIB A;  3KMV A;  3OJ2 A;  4QAL A;  1ISY A;  4ZFW B;  1IJT A;  1S0C A;  2ZQN A;  3FGM A;  3NJ5 A;  3FJB A;  4GAI A;  4I4Q A;  4QC4 A;  4QBV A;  3QYD A;  4ZBV B;  1CE7 B;  1BLA A;  4CJM A;  1IIL A;  3IM7 A;  2NTD A;  1XZZ A;  3OGF A;  8I1B A;  3SNV A;  1FGA A;  4GP0 A;  2D43 A;  4Q9G A;  2GO2 A;  4LO0 A;  4I96 A;  4I2S A;  3O4A A;  4A7K A;  1EYL A;  1PZZ A;  2D1Z A;  4LO3 C;  2NYY A;  4KC3 A;  1G9D A;  1JT3 A;  3WMV A;  3BA5 A;  5BXS A;  1HCD A;  3CQA A;  3MAL A;  2DRZ A;  2BEB A;  2DRY A;  3QR5 A;  4EKX B;  1ISV A;  4IZX A;  1DIW A;  1FV2 A;  1AVW B;  1V6X A;  1PC8 B;  3O49 A;  2QN4 A;  4HJJ A;  4LO8 B;  4DEN A;  5FZU A;  3BA4 A;  3A21 A;  5I1B A;  3FJK A;  1IOB A;  2MLL B;  2KI4 A;  4H04 A;  4PC4 A;  5B2H A;  1G9B A;  4DEP A;  1R8N A;  2FO1 A;  3BX1 C;  3LLP A;  4JRA A;  4IYB A;  4A7Z A;  1FMM S;  3WA1 A;  5FNW A;  3H6S E;  4XFU A;  1YTO A;  1BA7 A;  4L4I A;  1AVU A;  5DVH A;  1NUN A;  6I1B A;  4XFT A;  3BAD A;  1AVA C;  2QYI B;  4OEF A;  2NVH A;  1AF9 A;  3OBT A;  5F8Y A;  1JQZ A;  4A7Y A;  5BP5 A;  3FJC A;  4I6I A;  4ISQ A;  1FV3 A;  2D44 A;  3OBR A;  1QQK A;  2F2F A;  3O4C A;  5EHA A;  2NZ9 A;  2L5X A;  1FMZ A;  4IY9 A;  1M2T B;  1QXM A;  3FJJ A;  3E8L C;  4P0L A;  4QO3 A;  4D8H A;  1TWE A;  3ZX7 A;  3N0K A;  4QBC A;  1RY7 A;  3FUQ A;  21BI A;  1EV2 A;  1TP0 A;  3IM6 A;  1ISX A;  1FN0 A;  3IAG C;  3FJI A;  4OEE A;  5GAQ A;  4LO1 A;  4LO7 C;  3Q7Y A;  4ISR A;  1T4Q A;  1W3A A;  3HOM A;  4ZGR B;  5BVP I;  1Q04 A;  4J23 B;  3WO4 A;  1HCE A;  3A07 A;  3UJ0 A;  3UD9 A;  3P53 A;  5BXR A;  5EG6 C;  2RG9 B;  4QKR A;  4KEJ A;  4JKQ A;  1YXW A;  3I29 B;  5DZU A;  1G9A A;  5JMC A;  5BQU C;  2LIE A;  2WBC A;  1CVS A;  1Z2V A;  1EVT A;  3NBC A;  1UPS A;  1DQG A;  1KNM A;  1S0F A;  1YYN A;  2FFV A;  2RQ9 A;  3T8S A;  4EB2 B;  1GGP B;  2D22 A;  1W3F A;  2IWT B;  3BTA A;  2FFU A;  3WO2 A;  2RST A;  3R4S A;  5D61 A;  3OJV A;  4JAW A;  3FJD A;  5FZZ A;  3V79 C;  3FJH A;  3ZXG A;  4II0 A;  4OEG A;  4P0J A;  1ISW A;  1ITB A;  1V6U A;  2E4M C;  3H6Q A;  5BXT A;  3UD8 A;  4G9N A;  4I0Y A;  3O44 A;  4GAF A;  3N7L A;  3D7W B;  3IM5 A;  3OJM A;  5E24 E;  2HW9 A;  3RTJ B;  1OQL B;  2VLC A;  2Z49 A;  4J2X A;  4X39 A;  3W9T A;  3V0A A;  3JRR A;  1JT4 A;  3P6J A;  3VSZ A;  4J2K A;  3EF2 A; 
#chains in the Genus database with same CATH topology
 1JTC A;  1HWM B;  3VWC A;  4LO3 A;  1S0G A;  3HMY A;  3NBE A;  3I2A A;  3O4O A;  1IRP A;  4OWK A;  3P6I A;  3HN1 A;  3K1X A;  5G00 A;  2X2T A;  1MD6 A;  1S0B A;  1IRA X;  4I4V A;  3CA3 A;  1WD3 A;  2R9K B;  2J3P A;  4ZKT B;  3N7K A;  4IQP A;  3UD7 A;  3BAG A;  4TLP A;  4J2Y A;  4I4O A;  4LO2 C;  2VXT I;  2KKI A;  1FWV A;  2NM1 A;  1RG8 A;  1G82 A;  2VXR A;  4EEE B;  1P63 A;  1Q03 A;  2ET2 A;  4JQ0 A;  1XG6 A;  4AN7 B;  5JLV A;  31BI A;  2BFH A;  4IHZ A;  2AAI B;  3Q7W A;  3NBD A;  3O3Q A;  3O4D A;  3CRI A;  3ZC8 A;  4I4U A;  1EPW A;  1PUM B;  4GOY A;  3V0B A;  1K5U A;  2D7I A;  3BAH A;  2X2S A;  2I1B A;  2KI6 B;  1JY0 A;  3TC2 A;  3O5W B;  3PUB A;  3AH2 A;  4H75 A;  1DFQ A;  3BA7 A;  3CRG A;  4END A;  4IY8 A;  4KEI A;  2DRE A;  3POK A;  4FGF A;  2XOA A;  4I37 A;  3AKF A;  1N4K A;  5HPZ A;  3WIN A;  1HWN B;  4QKS A;  41BI A;  4USP A;  4X3A A;  1I1E A;  1JT7 A;  4R6U B;  1J0S A;  3ZXD A;  1AVX B;  3BAQ A;  3A23 A;  4I8M A;  3CA6 A;  2Q9X A;  4USO A;  4Z9W B;  3BAV A;  3F62 B;  3AJ5 A;  1XHB A;  3RTI B;  3OGG A;  3FJF A;  3PHZ A;  1YF8 B;  2AQZ A;  4DCK C;  1W3G A;  3CA5 A;  3FJ9 A;  1TOO A;  1XYF A;  2GZB A;  1DZC A;  4GOV A;  3CA4 A;  4I4R A;  3WMU A;  4LO1 C;  3AZV A;  3BRD A;  3VT0 A;  1DQO A;  1SZ6 B;  5D62 A;  4X37 A;  1DJS B;  4EFP A;  5F8S A;  4HR6 C;  4F83 A;  1SR4 C;  2Z48 A;  2ZQO A;  2P39 A;  3V0A B;  1A8D A;  3AKI A;  1BAS A;  1D0H A;  3AKG A;  1VCL A;  4JPZ A;  3S8K A;  3RSJ A;  4D0Z A;  3I2X A;  1K5V A;  2VSE A;  1II4 A;  2KLL A;  2Y9G A;  3C9Z A;  3ILA A;  2HWM A;  5FNX A;  4I1E A;  4KEK A;  2Q3N B;  2VUA A;  3H6R A;  5DSS B;  4ZLB B;  3NBN A;  2M49 A;  4ZOT A;  4D0T A;  1S0D A;  5D63 A;  3FJE A;  1IT0 A;  3BAU A;  2D24 A;  2FDB M;  1I1B A;  2YUG A;  1IHK A;  5F8W A;  4XKI A;  2ESU A;  5BOW A;  2E4M A;  1T9F A;  3PME A;  1WBC A;  4OW4 A;  1FQ9 A;  1RZO B;  3Q7X A;  1BFG A;  3F1R A;  3O4B A;  3VEQ A;  1F31 A;  2D23 A;  2UUS A;  1DLL A;  3FFZ A;  4Q91 A;  4X38 A;  4ION A;  5EC5 A;  1TFM B;  4LO0 C;  4HA2 A;  2DS0 A;  2K4A B;  2FGF A;  2ERM A;  4AN6 A;  2F8X C;  4GP3 A;  1G9C A;  2D20 A;  4G9M A;  1L2H A;  4H9W A;  3VSF A;  4KBB A;  3R4U A;  1E0O A;  2K8R A;  3LTQ A;  1WBA A;  1NZK A;  1PWA A;  3JUT A;  2D7R A;  4FVV A;  4I4X A;  1ONK B;  2VU9 A;  1ILR 1;  4LO2 A;  1M16 A;  3BRG C;  1JLX A;  4QD2 B;  3UJ4 A;  1DFC A;  2NP0 A;  3AKH A;  4ZA3 B;  2KH2 A;  4EFQ A;  1ABR B;  1AFC A;  4G6M A;  4LO7 B;  3AZW A;  1BFF A;  3VT2 A;  3N7J A;  4OUJ A;  1V6W A;  2P23 A;  5BXP A;  4I3N A;  4P6A A;  3RMY A;  4L4H A;  4ZFY B;  3CRH A;  5BP5 C;  4WBC A;  2HWA A;  1S0L A;  4MZG B;  2AFG A;  2BEA A;  2WRY A;  4F34 A;  3ZC9 A;  4I4Y A;  4G6J A;  4I1B A;  4I4S A;  2F2F C;  4JP0 A;  3N7M A;  1QQL A;  1BFC A;  2ZR1 B;  4Z8S B;  1DZD A;  1WD4 A;  4EFR A;  4JKX B;  3AJ6 A;  3CAH A;  3CA0 A;  3BAO A;  4J2S A;  3H6R B;  4I4P A;  3WIN C;  1RML A;  1R8O A;  2HZ9 A;  4OWL A;  2Y9F A;  3AH4 A;  1V6V A;  3UDA A;  1HWP B;  1Z4S A;  5F90 A;  3CU1 B;  4IZE A;  2MC2 A;  4P0K A;  4QD2 C;  4XFS A;  3WO3 A;  3HSM A;  3S8J A;  3IIR A;  4ZFU B;  2MIB A;  3FJA A;  1BLD A;  5DUY A;  7I1B A;  3PG0 A;  5BQU A;  2K43 A;  1MC9 A;  1YBI A;  9ILB A;  1S0E A;  1TTU A;  3AH1 A;  3HBW A;  4OWJ A;  1SR4 A;  3VUO A;  2VSA A;  3FJ8 A;  1BFB A;  3FUO A;  4YOL A;  2IHO A;  1Z0H A;  1TWM A;  3MPP G;  1BAR A;  1PUU B;  2Y9W C;  1JLY A;  2AXM A;  5FZY A;  1AXM A;  1ISZ A;  1JT5 A;  3BRF A;  3RMX A;  3CA1 A;  4G1R A;  4MZF B;  3HAL A;  1HWO B;  1TIE A;  3A22 A;  3B9U A;  4MZH A;  2Y9X E;  4I7I A;  1Q1U A;  3VT1 A;  4Q9P A;  1HKN A;  3BB2 A;  1FWU A;  3V0B B;  2LIQ A;  1HIB A;  3KMV A;  3OJ2 A;  4QAL A;  1ISY A;  4ZFW B;  1IJT A;  1S0C A;  2ZQN A;  3FGM A;  3NJ5 A;  3FJB A;  4GAI A;  4I4Q A;  4QC4 A;  4QBV A;  3QYD A;  4ZBV B;  1CE7 B;  1BLA A;  4CJM A;  1IIL A;  3IM7 A;  2NTD A;  1XZZ A;  3OGF A;  8I1B A;  3SNV A;  1FGA A;  4GP0 A;  2D43 A;  2NS2 A;  4Q9G A;  2GO2 A;  4LO0 A;  4I96 A;  4I2S A;  3O4A A;  4A7K A;  1EYL A;  1PZZ A;  2D1Z A;  4LO3 C;  2NYY A;  4KC3 A;  1G9D A;  1JT3 A;  3WMV A;  3BA5 A;  5BXS A;  1HCD A;  3CQA A;  3MAL A;  2DRZ A;  2BEB A;  2DRY A;  3QR5 A;  4EKX B;  1ISV A;  4IZX A;  1DIW A;  1FV2 A;  1AVW B;  1V6X A;  1PC8 B;  3O49 A;  2QN4 A;  4HJJ A;  4LO8 B;  4DEN A;  5FZU A;  3BA4 A;  3A21 A;  5I1B A;  3FJK A;  1IOB A;  2MLL B;  2KI4 A;  4H04 A;  4PC4 A;  5B2H A;  1G9B A;  4DEP A;  1R8N A;  2FO1 A;  3BX1 C;  3LLP A;  4JRA A;  4IYB A;  4A7Z A;  1FMM S;  3WA1 A;  5FNW A;  3H6S E;  4XFU A;  1YTO A;  1BA7 A;  4L4I A;  1AVU A;  5DVH A;  1NUN A;  6I1B A;  4XFT A;  3BAD A;  1AVA C;  2QYI B;  4OEF A;  2NVH A;  1AF9 A;  3OBT A;  5F8Y A;  1JQZ A;  4A7Y A;  5BP5 A;  3FJC A;  4I6I A;  4ISQ A;  1FV3 A;  2D44 A;  3OBR A;  1QQK A;  2F2F A;  3O4C A;  5EHA A;  2NZ9 A;  2L5X A;  1FMZ A;  4IY9 A;  1M2T B;  1QXM A;  3FJJ A;  3E8L C;  4P0L A;  4QO3 A;  4D8H A;  1TWE A;  3ZX7 A;  3N0K A;  4QBC A;  1RY7 A;  3FUQ A;  21BI A;  1EV2 A;  1TP0 A;  3IM6 A;  1ISX A;  1FN0 A;  3IAG C;  3FJI A;  4OEE A;  5GAQ A;  4LO1 A;  4LO7 C;  3Q7Y A;  4ISR A;  1T4Q A;  1W3A A;  3HOM A;  4ZGR B;  5BVP I;  1Q04 A;  4J23 B;  3WO4 A;  1HCE A;  3A07 A;  3UJ0 A;  3UD9 A;  3P53 A;  5BXR A;  5EG6 C;  2RG9 B;  4QKR A;  4KEJ A;  4JKQ A;  1YXW A;  3I29 B;  5DZU A;  1G9A A;  5JMC A;  5BQU C;  2LIE A;  2WBC A;  1CVS A;  1Z2V A;  1EVT A;  3NBC A;  1UPS A;  1DQG A;  1KNM A;  1S0F A;  1YYN A;  2FFV A;  2RQ9 A;  3T8S A;  4EB2 B;  1GGP B;  2D22 A;  1W3F A;  2IWT B;  3BTA A;  2FFU A;  3WO2 A;  2RST A;  3R4S A;  5D61 A;  3OJV A;  4JAW A;  3FJD A;  5FZZ A;  3V79 C;  3FJH A;  3ZXG A;  4II0 A;  4OEG A;  4P0J A;  1ISW A;  1ITB A;  1V6U A;  4UY4 A;  2E4M C;  3H6Q A;  5BXT A;  3UD8 A;  4G9N A;  4I0Y A;  3O44 A;  4GAF A;  3N7L A;  3D7W B;  3IM5 A;  3OJM A;  5E24 E;  2HW9 A;  3RTJ B;  1OQL B;  2VLC A;  2Z49 A;  4J2X A;  4X39 A;  3W9T A;  3V0A A;  3JRR A;  1JT4 A;  3P6J A;  3VSZ A;  4J2K A;  3EF2 A; 
#chains in the Genus database with same CATH homology
 1JTC A;  1HWM B;  3VWC A;  4LO3 A;  1S0G A;  3HMY A;  3NBE A;  3I2A A;  3O4O A;  1IRP A;  4OWK A;  3P6I A;  3HN1 A;  3K1X A;  5G00 A;  2X2T A;  1MD6 A;  1S0B A;  1IRA X;  4I4V A;  3CA3 A;  1WD3 A;  2R9K B;  2J3P A;  4ZKT B;  3N7K A;  4IQP A;  3UD7 A;  3BAG A;  4TLP A;  4J2Y A;  4I4O A;  4LO2 C;  2VXT I;  2KKI A;  1FWV A;  2NM1 A;  1RG8 A;  1G82 A;  2VXR A;  4EEE B;  1P63 A;  1Q03 A;  2ET2 A;  4JQ0 A;  1XG6 A;  4AN7 B;  5JLV A;  31BI A;  2BFH A;  4IHZ A;  2AAI B;  3Q7W A;  3NBD A;  3O3Q A;  3O4D A;  3CRI A;  3ZC8 A;  4I4U A;  1EPW A;  1PUM B;  4GOY A;  3V0B A;  1K5U A;  2D7I A;  3BAH A;  2X2S A;  2I1B A;  2KI6 B;  1JY0 A;  3TC2 A;  3O5W B;  3PUB A;  3AH2 A;  4H75 A;  1DFQ A;  3BA7 A;  3CRG A;  4END A;  4IY8 A;  4KEI A;  2DRE A;  3POK A;  4FGF A;  2XOA A;  4I37 A;  3AKF A;  1N4K A;  5HPZ A;  3WIN A;  1HWN B;  4QKS A;  41BI A;  4USP A;  4X3A A;  1I1E A;  1JT7 A;  4R6U B;  1J0S A;  3ZXD A;  1AVX B;  3BAQ A;  3A23 A;  4I8M A;  3CA6 A;  2Q9X A;  4USO A;  4Z9W B;  3BAV A;  3F62 B;  3AJ5 A;  1XHB A;  3RTI B;  3OGG A;  3FJF A;  3PHZ A;  1YF8 B;  2AQZ A;  4DCK C;  1W3G A;  3CA5 A;  3FJ9 A;  1TOO A;  1XYF A;  2GZB A;  1DZC A;  4GOV A;  3CA4 A;  4I4R A;  3WMU A;  4LO1 C;  3AZV A;  3BRD A;  3VT0 A;  1DQO A;  1SZ6 B;  5D62 A;  4X37 A;  1DJS B;  4EFP A;  5F8S A;  4HR6 C;  4F83 A;  1SR4 C;  2Z48 A;  2ZQO A;  2P39 A;  3V0A B;  1A8D A;  3AKI A;  1BAS A;  1D0H A;  3AKG A;  1VCL A;  4JPZ A;  3S8K A;  3RSJ A;  4D0Z A;  3I2X A;  1K5V A;  2VSE A;  1II4 A;  2KLL A;  2Y9G A;  3C9Z A;  3ILA A;  2HWM A;  5FNX A;  4I1E A;  4KEK A;  2Q3N B;  2VUA A;  3H6R A;  5DSS B;  4ZLB B;  3NBN A;  2M49 A;  4ZOT A;  4D0T A;  1S0D A;  5D63 A;  3FJE A;  1IT0 A;  3BAU A;  2D24 A;  2FDB M;  1I1B A;  2YUG A;  1IHK A;  5F8W A;  4XKI A;  2ESU A;  5BOW A;  2E4M A;  1T9F A;  3PME A;  1WBC A;  4OW4 A;  1FQ9 A;  1RZO B;  3Q7X A;  1BFG A;  3F1R A;  3O4B A;  3VEQ A;  1F31 A;  2D23 A;  2UUS A;  1DLL A;  3FFZ A;  4Q91 A;  4X38 A;  4ION A;  5EC5 A;  1TFM B;  4LO0 C;  4HA2 A;  2DS0 A;  2K4A B;  2FGF A;  2ERM A;  4AN6 A;  2F8X C;  4GP3 A;  1G9C A;  2D20 A;  4G9M A;  1L2H A;  4H9W A;  3VSF A;  4KBB A;  3R4U A;  1E0O A;  2K8R A;  3LTQ A;  1WBA A;  1NZK A;  1PWA A;  3JUT A;  2D7R A;  4FVV A;  4I4X A;  1ONK B;  2VU9 A;  1ILR 1;  4LO2 A;  1M16 A;  3BRG C;  1JLX A;  4QD2 B;  3UJ4 A;  1DFC A;  2NP0 A;  3AKH A;  4ZA3 B;  2KH2 A;  4EFQ A;  1ABR B;  1AFC A;  4G6M A;  4LO7 B;  3AZW A;  1BFF A;  3VT2 A;  3N7J A;  4OUJ A;  1V6W A;  2P23 A;  5BXP A;  4I3N A;  4P6A A;  3RMY A;  4L4H A;  4ZFY B;  3CRH A;  5BP5 C;  4WBC A;  2HWA A;  1S0L A;  4MZG B;  2AFG A;  2BEA A;  2WRY A;  4F34 A;  3ZC9 A;  4I4Y A;  4G6J A;  4I1B A;  4I4S A;  2F2F C;  4JP0 A;  3N7M A;  1QQL A;  1BFC A;  2ZR1 B;  4Z8S B;  1DZD A;  1WD4 A;  4EFR A;  4JKX B;  3AJ6 A;  3CAH A;  3CA0 A;  3BAO A;  4J2S A;  3H6R B;  4I4P A;  3WIN C;  1RML A;  1R8O A;  2HZ9 A;  4OWL A;  2Y9F A;  3AH4 A;  1V6V A;  3UDA A;  1HWP B;  1Z4S A;  5F90 A;  3CU1 B;  4IZE A;  2MC2 A;  4P0K A;  4QD2 C;  4XFS A;  3WO3 A;  3HSM A;  3S8J A;  3IIR A;  4ZFU B;  2MIB A;  3FJA A;  1BLD A;  5DUY A;  7I1B A;  3PG0 A;  5BQU A;  2K43 A;  1MC9 A;  1YBI A;  9ILB A;  1S0E A;  1TTU A;  3AH1 A;  3HBW A;  4OWJ A;  1SR4 A;  3VUO A;  2VSA A;  3FJ8 A;  1BFB A;  3FUO A;  4YOL A;  2IHO A;  1Z0H A;  1TWM A;  3MPP G;  1BAR A;  1PUU B;  2Y9W C;  1JLY A;  2AXM A;  5FZY A;  1AXM A;  1ISZ A;  1JT5 A;  3BRF A;  3RMX A;  3CA1 A;  4G1R A;  4MZF B;  3HAL A;  1HWO B;  1TIE A;  3A22 A;  3B9U A;  4MZH A;  2Y9X E;  4I7I A;  1Q1U A;  3VT1 A;  4Q9P A;  1HKN A;  3BB2 A;  1FWU A;  3V0B B;  2LIQ A;  1HIB A;  3KMV A;  3OJ2 A;  4QAL A;  1ISY A;  4ZFW B;  1IJT A;  1S0C A;  2ZQN A;  3FGM A;  3NJ5 A;  3FJB A;  4GAI A;  4I4Q A;  4QC4 A;  4QBV A;  3QYD A;  4ZBV B;  1CE7 B;  1BLA A;  4CJM A;  1IIL A;  3IM7 A;  2NTD A;  1XZZ A;  3OGF A;  8I1B A;  3SNV A;  1FGA A;  4GP0 A;  2D43 A;  2NS2 A;  4Q9G A;  2GO2 A;  4LO0 A;  4I96 A;  4I2S A;  3O4A A;  4A7K A;  1EYL A;  1PZZ A;  2D1Z A;  4LO3 C;  2NYY A;  4KC3 A;  1G9D A;  1JT3 A;  3WMV A;  3BA5 A;  5BXS A;  1HCD A;  3CQA A;  3MAL A;  2DRZ A;  2BEB A;  2DRY A;  3QR5 A;  4EKX B;  1ISV A;  4IZX A;  1DIW A;  1FV2 A;  1AVW B;  1V6X A;  1PC8 B;  3O49 A;  2QN4 A;  4HJJ A;  4LO8 B;  4DEN A;  5FZU A;  3BA4 A;  3A21 A;  5I1B A;  3FJK A;  1IOB A;  2MLL B;  2KI4 A;  4H04 A;  4PC4 A;  5B2H A;  1G9B A;  4DEP A;  1R8N A;  2FO1 A;  3BX1 C;  3LLP A;  4JRA A;  4IYB A;  4A7Z A;  1FMM S;  3WA1 A;  5FNW A;  3H6S E;  4XFU A;  1YTO A;  1BA7 A;  4L4I A;  1AVU A;  5DVH A;  1NUN A;  6I1B A;  4XFT A;  3BAD A;  1AVA C;  2QYI B;  4OEF A;  2NVH A;  1AF9 A;  3OBT A;  5F8Y A;  1JQZ A;  4A7Y A;  5BP5 A;  3FJC A;  4I6I A;  4ISQ A;  1FV3 A;  2D44 A;  3OBR A;  1QQK A;  2F2F A;  3O4C A;  5EHA A;  2NZ9 A;  2L5X A;  1FMZ A;  4IY9 A;  1M2T B;  1QXM A;  3FJJ A;  3E8L C;  4P0L A;  4QO3 A;  4D8H A;  1TWE A;  3ZX7 A;  3N0K A;  4QBC A;  1RY7 A;  3FUQ A;  21BI A;  1EV2 A;  1TP0 A;  3IM6 A;  1ISX A;  1FN0 A;  3IAG C;  3FJI A;  4OEE A;  5GAQ A;  4LO1 A;  4LO7 C;  3Q7Y A;  4ISR A;  1T4Q A;  1W3A A;  3HOM A;  4ZGR B;  5BVP I;  1Q04 A;  4J23 B;  3WO4 A;  1HCE A;  3A07 A;  3UJ0 A;  3UD9 A;  3P53 A;  5BXR A;  5EG6 C;  2RG9 B;  4QKR A;  4KEJ A;  4JKQ A;  1YXW A;  3I29 B;  5DZU A;  1G9A A;  5JMC A;  5BQU C;  2LIE A;  2WBC A;  1CVS A;  1Z2V A;  1EVT A;  3NBC A;  1UPS A;  1DQG A;  1KNM A;  1S0F A;  1YYN A;  2FFV A;  2RQ9 A;  3T8S A;  4EB2 B;  1GGP B;  2D22 A;  1W3F A;  2IWT B;  3BTA A;  2FFU A;  3WO2 A;  2RST A;  3R4S A;  5D61 A;  3OJV A;  4JAW A;  3FJD A;  5FZZ A;  3V79 C;  3FJH A;  3ZXG A;  4II0 A;  4OEG A;  4P0J A;  1ISW A;  1ITB A;  1V6U A;  4UY4 A;  2E4M C;  3H6Q A;  5BXT A;  3UD8 A;  4G9N A;  4I0Y A;  3O44 A;  4GAF A;  3N7L A;  3D7W B;  3IM5 A;  3OJM A;  5E24 E;  2HW9 A;  3RTJ B;  1OQL B;  2VLC A;  2Z49 A;  4J2X A;  4X39 A;  3W9T A;  3V0A A;  3JRR A;  1JT4 A;  3P6J A;  3VSZ A;  4J2K A;  3EF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...