1DZQA

Lectin uea-ii complexed with galactose
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
236
structure length
234
Chain Sequence
SDDLSFNFDKFVPNQKNIIFQGDASVSTTGVLQVTKVSTTTSIGRALYAAPIQIWDSITGKVASFATSFSFVVKADKSDGVDGLAFFLAPANSQIPSGSSAGMFGLFSSSDSKSSNQIIAVEFDTYFGKAYNPWDPDFKHIGIDVNSIKSIKTVKWDWRNGEVADVVITYRAPTKSLTVCLSYPSDGTSNIITASVDLKAILPEWVSVGFSGGVGNAAEFETHDVLSWYFTSNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Carbohydrate Recognition by Lectin II from Ulex Europaeus, a Protein with a Promiscuous Carbohydrate Binding Site
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords LECTIN II
total genus 52
structure length 234
sequence length 236
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1dzqA00
4PF5A 3MW3A 2UU8A 2CYFA 1UKGA 2W52A 3OY8B 3WOGA 1LU1A 2V5YA 1KRIA 5JVVA 1CONA 4TZDA 1Y7BA 3WDYA 2NMNA 2YMZA 4ISRA 4Y1ZA 3WUCA 3FLPA 1DQ2A 4Q1RA 1FYUA 2DTYA 2DU0A 4HL0A 3VKMA 3WCSA 1V6OA 3ZVXA 1GYKA 2NMOA 4MYEA 4FOQA 4ISQA 3Q9OA 4FP3A 1S0EA 4BOWA 1DYPA 2GALA 2CWMA 3ZSJA 2YV8A 1DQ1A 2P3KA 1DQ4A 1CIWA 2WKKA 3AZYA 1UAIA 2ZMNA 3PMEA 4CTEA 2C9AA 1RITA 1W6OB 1W6MA 2R0FA 2JD4A 4LBQA 1LEDA 3WDTA 4YFZA 2VU9A 1YYNA 3I8TA 5CBLA 1G9FA 1W6MB 1W6OA 2UWBA 4SLIA 2EIGA 2WT1A 2CY6A 3AP4A 3WG3A 1JW6A 4XXPA 3B9CA 4WVVA 1W6PB 1R1ZA 2SBAA 3N35A 1QMJA 3D4KA 3A0KA 3N7LA 2PELA 5E88A 2ZGSA 1UZZA 4XHXA 4BQ1A 2VW1A 1PZ9A 5CA6A 3AP6A 2VXRA 1LULA 4DRVA 1DFQA 3ASIA 1JYIA 2AENA 3AX4A 5H9QA 3N36A 2PHFA 4FPGA 5DUWA 1GZWB 1W6QA 3N7MA 3O0VA 3WLUA 1GZCA 1Q8SA 3FFZA 4P9YA 3AYDA 3BODA 4R9CA 4YGDA 2DUPA 1GICA 3SH4A 3AP9A 1OFSA 1X50A 3W59A 1UN1A 3L2YA 1GKBA 5GZEA 1WW7A 2H0BA 4Q26A 4GWNA 4D69A 2A6XA 4LBKA 4YM3A 2HYKA 5H9RA 4FOWA 1MZ5A 4UW6A 2TEPA 4FPOB 3RSJA 1AJOA 3U4XA 4DQAA 1I1EA 3WDWA 4BM8A 2ES3A 3R4SA 3WNXA 1RINA 3VKOA 1LU2A 2DVFA 2AH2A 3NV1A 2V73A 5IT6A 1S0IA 1QOTA 3ZYRA 1V00A 5L73A 5H9PA 1BYHA 3OYWB 3WCRA 5EXOA 1CN1A 4BLIA 1W6QB 4H55A 3ZSKA 1FX5A 3ZPYA 3VUOA 2D3RA 4LBOA 2Q5TA 3H0OA 1LCLA 1S0BA 3ATGA 5GZDA 5T55A 1MVQA 1HKDA 2KM2A 5AVAA 2A6WA 4FPLA 2FHRA 1H9PA 1N1TA 1WBFA 2JKBA 3A4UA 1IS4A 2RHPA 1VALA 2EXHA 2DURA 1GNZA 1KITA 1WD4A 5IUQA 4GALA 4YG3A 1QOSA 1KQRA 1SLBA 2ZHLA 3FLRA 4BMBA 2AR6A 1AX1A 1JBCA 3AYAA 3HR9A 5DG1A 4LBJA 1W0PA 4YW1A 4XBQA 1G9CA 1BQPA 2GMPA 1QKQA 2NYYA 3DGTA 4FOYA 1MS9A 2PHUA 2D44A 3FUQA 3QLQA 3WUDA 2PHRA 1LOGA 4Q1PA 5T5OA 3NWKA 4PQ9A 3ZXLA 3TB0A 1LOAA 2ERFA 2P34A 1MS4A 5GLVA 3UL2A 3ZXEA 4UW5A 2EXJA 4UW4A 3FLTA 4FP2A 5DUXA 4WZFA 3WG1A 4ZXKA 3RMYA 2D6KA 1V6LA 5JLVA 3WZ1A 2LALA 5DG2A 3HMYA 5IK4A 1W6NB 1ULCA 2E51A 4LBNA 3SITA 1F31A 1S0GA 4W65A 3WVJA 3OYWA 4M01A 4XZPA 3AYCA 4WV8A 1IS5A 2CWSA 5T5LA 3ZSLA 5GLTA 1WLCA 1VIWB 3FUOA 2ZKNA 2A5ZA 1APNA 1N1SA 1DGLA 2W08A 2ZGTA 3R4UA 4Y1XA 2R49A 2ENRA 1J1TA 1GBGA 4AVVA 1DZQA 4LBQB 1UX6A 1MACA 4M3CA 4AVTA 2ZMLA 3BOPA 1BKZA 2EF6A 3I4IA 4XBNA 3T1LA 1CQ9A 3OJBA 3HN1A 5KXEA 2A6YA 1LGCA 1VLNA 4XOGA 3ZYPA 1BXHA 3O0XA 2PHWA 3SLIA 3M3EA 2UURA 1PZ7A 1W6NA 2VW0A 1CESA 1LGNA 3VKLA 2ZHKA 1JOJA 1WLDA 3WDXA 2D6LX 2VY0A 1JHNA 4Q2FA 3APBA 1Q56A 1ULDA 2YZ4A 4Y22B 2DV9A 3DUIA 1HLCA 4NOTA 1G86A 3USUB 5GZCA 2CNAA 2XG3A 3AJYA 1Z0HA 3AZZA 1OQ1A 1DQ6A 2P3JA 4XJAA 3IPVB 1S0FA 2P2KA 2DVGA 4PBOA 5E8AA 2GN3A 4FOVA 3O12A 4PBPA 2ZGLA 4JC1A 4DFSA 1YI7A 1LOEA 1UL9A 2R16A 3RQ0A 5KXCA 3BIWE 2JE7A 1WW6A 3SH5A 3AK0A 5CAZA 3N7JA 1FAYA 1UZYA 3OBRA 4BPZA 4YFWA 1LOCA 1YIFA 2DUQA 1QNYA 2WJSA 3O0WA 4GXLA 2VUAA 1SLLA 3PVNA 5CB7A 1JN2P 1SBDA 1H30A 1ENSA 2CTVA 2ZGOA 5F5QA 5T5JA 2EAKA 3IKWA 4DRRA 1SLIA 2YXSA 1S0CA 4WVWA 2LTNA 2XB6C 2W68A 3D5OA 2AYHA 4R9BA 3AZWA 1ENQA 4LBQD 4ATFA 1WCSA 4XHBA 2A3XA 5EYXA 4YW5A 2EALA 3JUUA 1URXA 1FV3A 4YZ3A 5JOZA 3IPVA 1LODA 1AVBA 1QGLA 1Q8QA 2OW4A 1SLAA 3POYA 2ZBJA 3R05A 4K1YA 3MEPA 4XJZA 5GJ6A 1HQLA 3WG2A 1C1LA 1LECA 3M1HA 4FPHA 5GZGA 1N3OA 1WBLA 1ONAA 2BQPA 4Q8LA 1G9BA 1HQWA 2ZGNA 1CJPA 1JXNA 1VAMA 4AVSA 4IQPA 5IK7A 5HCAA 1WUVA 4C1WA 5CNAA 3JU9A 1SLTA 4GKXA 1OKQA 1AJKA 3B00A 3NV2A 3AP7A 1VAVA 3IMNA 4YM0A 5JOXA 3INAA 2ZZJA 1N3QA 2ZGPA 4Y24A 1N47A 1ULGA 1LHWA 2OVUA 2NZ9A 2SLIA 1DQ5A 1ULEA 2NP0A 3AFKA 3POSA 3KM5A 3AZVA 2GNBA 3OGGA 1SACA 4YGCA 5E89A 1WLWA 4TYSA 1GZ9A 1AXZA 4LBLA 4LBMA 1XQNA 4RA0A 2WT2A 5T50A 5BYNA 3V64A 1C4RA 4R9DA 5DUUA 1V6NA 3MPPG 4XJ9A 1DBNA 5DZFA 4YZ2A 1YRZA 4XBLA 3M2MA 1N1VA 2ZMKA 3VV1A 4AGGA 2GNMA 4RL7A 1UMZA 3ZXKA 2AUYA 5KXBA 3PVOA 4Y1UA 1LGBA 4XTPA 4F83A 1DHKB 4XXAA 5KXDA 1LHOA 4M00A 5GM0A 2EXIA 3AXDA 4OZXA 1LENA 2ZGRA 1TEIA 1Q8OA 2GNDA 3POWA 1MZ6A 4YW2A 2DVAA 3ILNA 4Q27A 1CVNA 3B69A 1MS0A 4GA9A 1MVEA 2CL2A 1BZWA 2DVDA 4YW4A 1V6MA 5DZEA 3ZXFA 5FRAA 1S1AA 4FPEA 4YM1A 3B3QE 4ZKTB 1D2SA 4HANA 5LK5A 4BMEA 3V0BA 1IKQA 2VW2A 1HDKA 4K21A 2A3YA 1LOFA 4FPYA 3LSEA 5JDBA 2ZA9A 4Y26A 3SNMA 3VKNA 5F9TA 1LJ7A 2D3PA 1C1FA 2PHXA 1ULFA 4XYXA 1UPSA 2A70A 2GNTA 1AX2A 1WD3A 1A3KA 4M3CB 1DYKA 4XJUA 1LOBA 1PZ8A 4YZ5A 1DQ0A 3WDUA 1Q8VA 2JECA 5IK8A 4UW3A 4JCKA 1BJQA 4XE9A 5DUVA 3O5SA 3MW4A 1KJRA 4XMAA 2ZGQA 2YROA 3PJQA 3WV6A 2D43A 1KDMA 2ZGKA 3IM0A 3M3CA 2JJ6A 4DPNA 5JMCA 4M3CE 1KJLA 2D6NA 2VH9A 3IN9A 3N7KA 4FQZA 4KBBA 3B01A 4M3CF 3ZXJA 4U36A 2D3SA 1MR5A 1MS3A 3OPZA 1KDKA 4XILA 4YG6A 3SISA 4PCRA 1GLHA 1GNHA 1V6JA 1G9DA 3LSDA 1IOAA 5GLZA 3VKFC 1GV9A 1F9KA 3M3QA 4Q8KA 1G7YA 3A0NA 3OY8A 1G8WA 1FNYA 2GMMA 4P9WA 5DXDA 3USUA 4Y1VA 2ZABA 2E7QA 2W39A 3AZXA 2R1DA 3T1MA 3C2UA 2OUJA 3RMXA 1CR7A 2WQZC 1FATA 2GDFA 2R1BA 1WW4A 2WT0A 2ZGMA 1ENRA 2P37A 2WSUA 3ILFA 5H9SA 4XJWA 2I2SA 1N3PA 5GZFA 4AGRA 1RIRA 1LHUA 4FVVA 1LHVA 1V6IA 4XDQA 1LTEA 1U0AA 5T52A 3ENRA 1AXYA 3SH3A 4CZSA 2B7YA 3WHUA 1QNWA 5GALA 4FPJA 4Y20B 1GZWA 4AWDA 4YG0A 1H9WA 2C5DA 4ITCA 1LEMA 2A6VA 2DYCA 5T54A 2NN8A 2FMDA 5EWSA 3AJZA 3QCWA 4Y20A 4AYUA 3NV4A 1JUIA 4U2AA 4FPFA 4I30A 3V0BB 2ZGUA 5GLUA 3T2TA 2GN7A 1DLLA 4YLZA 4ATEA 2G4IA 5SV8A 1W6PA 4L8QA 1FNZA 2WSVA 1NXD1 1B09A 1W0OA 2DWRA 3AXEA 1YXWA 2AGSA 4Y22A 2E6VA 5HCFA 2P3IA 3NV3A 4NO4A 2D7FA 2DUOA 1IS6A 1IKPA 2E53A 4GWMA 1F5FA 3WG4A 2OUHA 2UWCA 4YM2A 1QDOA 1CPMA 1A8DA 3UJQA 2JDZA 1CPNA 1ZM1A 2A7AA 2DU1A 2R0HA 2YY1A 1SBFA 4XIKA 1SCSA 4P9XA 1ZA4A 1NLSA 1S0DA 1AZDA 4XTMA 5JOWA 4JRAA 5T5PA 2ZACA 3BTAA 3FBYA 4XJ8A 3GALA 1N1YA 1QOOA 3RS6A 1SBEA 4GKYA 4BLJA 1AXKA 1SFYA 5DZGA 1O4YA 4R9AA 3PVEA 3UJOA 1LESA 2NM1A 3RRDA 3WDVA 3UK9A 4Z8BA 2E7TA 3V0AB 5FREA 5JOYA 1GSLA 2D6MA 4XIOA 4YZ4A 3W58A 2Z42A 1LOFC 1D0HA 1Z78A 4FPKA 4K1ZA 5GLWA 3N3HA 1MS1A 1QF3A 2D6PA 2A75A 5HCBA 3ZSMA 1G9AA 4XMIA 3D6EA 1IS3A 2ARXA 4FPCA 1MS8A 2D6OX 5IK5A 1WW5A 3AP5A 3V65A 3WHTA 3M3OA 5EYYA 2WNEA 4YGBA 3RG0A 4YW3A 3KQRA 3MW2A 4YZ1A 1V6KA 1AX0A 1YO8A 1SLCA 3LCPA 1LHNA 1EPWA 1S0JA 2GMEA 2ARBA 1FV2A 1SCRA 2AREA 2ZAAA 4DS0A 1C57A 1JYCA 1GANA 2PHTA 3CNAA 3ILRA 1QU0A 2DVBA 2A71A 3OBTA 4K20A 2EXKA 1O4ZA 3GNEA 1A78A 1Q8PA 1I3HA 3V0AA 1DIWA 2JE9A 3TAYA 4ASMB 1AF9A 2ZHNA 1QDCA 4CRQA 2A3WA 2A6ZA 2DTWA 2UWAA 1MS5A 2WLQA 3AYEA 4FQ4A 4C1XA 4YGEA 4AGVA 4P14A 4Y1YA 2ZHMA
chains in the Genus database with same CATH superfamily
4QX3A 4GQ7A 3MW3A 2B39A 3OY8B 3WNPA 1O3RA 3E5QA 2Y6FA 1TQ5A 4LO6B 2UY8A 4CDWA 1UNBA 2O14A 3I7DA 4BQ5A 2YMZA 3WUCA 2W3JA 4Y1ZA 3H8OA 5BV6A 4QM8A 1DQ2A 4Q1RA 4UF0A 2DTYA 2RVAA 3FWEA 3TEYA 4OMDA 3RZHA 4QPYA 4FOQA 5EP9A 4ISQA 3ZN6A 1O3QA 5K7PA 1JZ7A 2XOMA 4GWJA 1S0EA 3GZAA 1G6NA 4BOWA 2XKOA 1RUG2 1RUI3 2VQAA 1W9TA 1DQ4A 2WKKA 2C0ZA 4CU8A 1QQP1 2D5HA 3PMEA 1KS4A 4CTEA 2RMU1 2JD4A 4QPIA 1LEDA 4HG6B 4MGQA 3ZLIA 4YFZA 3QH7A 1PO12 1RUJ3 1W6MB 2UWBA 2VQTA 1UZVA 5A7SA 2WT1A 1QJY2 2VE1A 2CY6A 5BNNB 3VDDC 1BVVA 3BKZA 2HWE2 4EZHA 4WVVA 1W6PB 2VBPA 1GP6A 5FZ6A 1YEWA 3N35A 2ZTNA 4XFCA 3LZZA 1YQ5A 2IVIB 1NQDA 2PELA 2B4KA 3E6CC 4XHXA 5AC92 4NUBA 2WA3A 3VZKA 1PZ9A 1LULA 1XE7A 5IVFA 1REEA 3N9QA 3KSCA 1POV3 2CHHA 4AEDC 5DUWA 4NPMA 3WLUA 3N7MA 4LUMA 1GZCA 3FFZA 4P9YA 3VHPA 4YGDA 3BODA 2BNOA 3CL1A 3IDEA 5FPLA 4BJ0A 5KC6A 1NY71 3KV6A 2XVLA 1H0BA 1X50A 3TEZA 4AXOA 1E5SA 1UN1A 3OOXA 2G1MA 3L2YA 3NAPC 1GKBA 3ACIA 3HBZA 4FBFA 2H0BA 2FDKA 3MPBA 4YVWB 3TN92 4YM3A 1QXRA 1D2QA 5BNPC 4FOWA 1MZ5A 2DCZA 2EICA 2TEPA 2YB7A 3D0JA 4UW6A 2BOIA 4C91A 1AJOA 2XPJA 1MZEA 1PX4A 2VECA 5E1RA 3TNQA 3BI3A 4YNIA 4YSFA 1IZ3A 3POGA 4Q4Y3 1WCQA 2BPA2 2V73A 2QQVA 1S0IA 1QOTA 1J59A 1XYNA 4OLLA 4RHV1 1BYHA 1POV0 2GP5A 4HT1T 2WS91 3EBRA 3WF1A 1A34A 2P6CA 4Z07A 4LA2A 1UYPA 4LHKA 3VUOA 1JS9A 3O1MA 2W1SA 2Y6KA 4PLOA 3CMGA 3ELNA 1S0BA 3SHRA 4D7SA 1XNKA 1UY2A 5C5TA 4HETA 2JDMA 2JDNA 2JKBA 4IE4A 5ANNA 5L7OC 4M4PA 1DDLA 3AC0A 1KITA 1WD4A 4KWLA 5IJRA 2PAMA 2DBNA 1NX9A 4NPRA 5IUQA 4FAGA 1PO11 2ZHLA 4LLOA 1Y9MA 4HSJA 4BMBA 2E63A 1ASJ1 3ZFFA 3H1MA 5IATA 1PVC1 4LBJA 4HVOA 1W0PA 4YW1A 1UXXX 1PVC3 2NYYA 3U14A 3DGTA 4FOYA 4I0WB 1VJ2A 2LROA 3C7HA 2J1EA 2WBKA 4UFMA 2PHRA 1H2MA 1LOGA 1NE6A 1R081 1RUI1 1W2NA 3PDQA 3B7MA 4LE4A 3NWKA 5T5OA 3ZXLA 3TB0A 2FMYA 1KFUL 4LIVA 4GB31 4UW5A 4RS5A 2EXJA 1I9RA 3FLTA 4FP2A 1YJKA 5DUXA 1BMV2 5DN2A 3WG1A 4UFIA 1WCDJ 4NHXA 5DG2A 3KHCA 5IK4A 2E7AA 4F8AA 2WZR2 4NWWA 2E51A 1UZ0A 2HWF3 1S0GA 2IFRA 3WVJA 3OYWA 3PUQA 4CDUB 3BALA 2XHKA 5T5LA 2OYZA 1JTZX 3VGIA 5T3NA 2WA4A 5GLTA 2Q1MA 2YBKA 1NZIA 2ZGTA 2XDVA 3WY6A 4P9JA 4Q0PA 4Y1XA 4IEPA 1J1TA 4Y5SA 5C8WA 2VMCA 1ZRDA 5L9VA 1Y3TA 3UNPA 3T2QA 2KD7A 4WVMB 4CCOA 5K0UA 1IG3A 3JD73 3N4MA 3W21A 1YHFA 4Z82A 5FYYA 4XOGA 3PVBB 1REDA 2B45X 2W91A 3ZYPA 3O0XA 1W2OA 2HWE1 2YBSA 4QHZA 3M3EA 1JH5A 1LGNA 3VKLA 5I0TA 1WLDA 1J58A 2R063 2VQUA 4HZFA 3WDXA 1BHGA 1DYOA 5A7QA 3VBRA 4Q2FA 1EPZA 5A32B 2FD8A 2K2SA 3ZN5A 4Q4X3 3AJYA 1Z0HA 5EQUA 3I2DA 1DQ6A 4PDWC 3OEBA 3PUSA 4XJAA 1H4GA 2DCJA 3K4AA 1CZVA 1S0FA 4Q4X2 4MGYE 5FKCA 5A3WA 5JSRA 2R7EB 4LO7A 3O1SA 2XJRA 5CFCB 2X05A 4WVMA 2F4LA 1LOEA 2WNUA 3TN91 2YG0A 3MIHA 3RQ0A 4JX0A 3BIWE 3T3YA 3VB9A 3ZIXA 4E8DA 2XBO2 5C3RA 2RS11 3VDCA 1AR62 5B4XA 2BNMA 3ZDSA 1NYWA 1ZZ9A 3OBRA 5EPAA 5J36A 4YFWA 2E32A 1YIFA 3E97A 4XC9A 4NWVA 3KQ4B 5FPBA 2RS33 5FJHA 4QPWA 5FZ3A 3T1LA 2CTVA 1H30A 3ZOIA 3ZYGA 4BWOA 2E9QA 1HXS3 2WZR1 2YU2A 4DRRA 2LTNA 3D5OA 2VPVA 1AR93 1QY4A 1VMHA 1OF3A 5EYXA 3E6DA 2EALA 3JUUA 2X09A 5A6XA 4I0AA 5JMOA 1AVBA 5FZ9A 2OW4A 3R05A 2JDAA 4K1YA 3MEPA 1HRI2 1FPN3 1OVSA 1LECA 1Q3EA 4FPHA 1Z7S1 1LNSA 1G9BA 4X8NA 4Q8LA 1HQWA 4XCAA 2GC0A 1SDWA 3VBRB 5FLJA 3VBFC 2D5FA 3WSOA 4C1WA 1NLQA 4GKXA 2IUWA 3HD8B 4CEWC 1GP5A 3NV2A 3ZYHA 1HN1A 4YM0A 4QX7A 1OKOA 2RDQA 4DIQA 4IEQA 1LKNA 1N3QA 3I2KA 2LW8A 1J3PA 2WFF3 4Y24A 5I91A 1LHWA 3U10A 2XL9A 3VZMA 5A7WB 2SLIA 1DP0A 3G6JB 3RZZA 1DQ5A 5A3MA 2NP0A 1BEV2 3POSA 3KM5A 1GQPA 2VTXJ 2VUDA 1ZBA3 1K5JA 3BOWA 2O0OA 5E89A 3HEIA 1AR91 4LBMA 4N9HA 4WM8A 4CUCA 1O91A 5FKBA 1C4RA 1EP0A 1XYOA 2H6CA 2HWB3 3LEMA 4PLNA 1E5RA 1V6NA 2QZ2A 1I5PA 1ZA7A 4LPLA 4YVWA 1NCQB 1N1VA 1GOFA 4FFGA 4QGLA 3U75A 4JGYC 1O3SA 5SV5A 1UY0A 4Y1UA 1KGYA 3M8LA 1LGBA 4K8FA 3NMBA 2OPWA 3LF7A 3RZMA 2ORXA 1VRH3 3MGUA 4M00A 5F32A 1UIKA 1W9WA 1Q8OA 3AFGA 3POWA 1BBT1 5FP9A 4RR3B 3GBFA 5H9QA 4MH0E 3B69A 5FZIA 5KXEA 1MVEA 2CL2A 3O7OA 3BPZA 4NVPA 2X8KA 5DZEA 4YW4A 3UKNA 4MVTA 5FRAA 1S1AA 1XYPA 3NNLA 4G3YC 1D2SA 4MXWA 5A6QA 2FZ1A 3POJA 1HDKA 2A3YA 3OUHA 5JZGB 4LTAA 2ZA9A 1F2NA 4Y26A 1DZTA 2D3PA 5I8YA 1C1FA 4BA6A 2ARCA 1ULFA 4B7EA 2O1QA 2CGPA 1UPSA 3I49A 4A41A 5FZOB 2GNTA 3SCGA 3J7NA 4XUTA 5FPXA 1C8NA 1JU3A 2N7GA 1TG7A 2X5IA 1DQ0A 1QJU2 3LEIA 4YZ5A 1EAH2 4XUPA 5IK8A 4L0PA 2AC1A 1C8M3 3S7EA 5FYTA 4F7ZA 2IFWA 1UMHA 1WKYA 1BK1A 4DB5A 1STMA 3PJQA 3J8F1 3WEZA 4R4XA 4XETA 5IVYA 4URAA 2OT7A 4S2FA 1QJEA 3A7QA 3ZFEC 5CIRA 4KBBA 4UF0B 2V72A 4M3CF 3S30A 2FDFA 1C28A 1MR5A 4U36A 3HBKA 5DAXA 5I0DA 4DUXA 3SISA 4FTBA 1UQXA 3P3NA 5KBFA 1G9DA 1R1A3 5GLZA 2XJQA 1GV9A 2WN3A 3IB3A 3J7LA 1T6GC 2P4EA 3A0NA 1IGOA 3H9AA 3OY8A 4H14A 5ABJC 1G8WA 1AR92 1FNYA 1DU3D 5DXDA 3USUA 1VBA2 2W39A 3VL9A 3C2UA 5JR2A 4N53B 3NJVA 3IDBB 1B35B 3RMXA 2GDFA 3THCA 3WQ7A 1OQDA 4P9IA 2WT0A 4AI9A 3RZKA 1YI9A 2EIBA 2RR12 4PIYA 4S2DA 1BCXA 4XF3A 4EWAA 4D94A 1ND2B 4XJWA 3WP3A 2E33A 3T2OA 3TEXA 1LHUA 1W06A 2WFF1 4FVVA 1RUE3 1BBT2 2Y26A 3Q8EA 5F3GA 2FCVA 3ENRA 2Q8DA 2GSYA 3T0AA 1L7LA 3SH3A 5FY5A 1NA1B 2VVFA 3ZM8A 1JZ2A 4ARXA 1PMJX 1GZWA 2RS53 3JBG2 4IEVA 2BOJA 4CP9B 2VZVA 3AJZA 2VJXA 4JRLA 4Y20A 1SZBA 5CISA 2YC2A 3NV4A 1JUIA 2R071 3HVDA 4RHV3 5I8SA 2WO2A 2ZGUA 1ODMA 4HPKB 3NNFA 1NXMA 3DPRC 4O61A 4RQPC 1ZVFA 3T2TA 4CA9A 2JD9A 1JYNA 1YC61 2P1BA 4HPKA 1W6PA 1MEC3 3LOIA 4AEMA 1O3TA 3WQ0A 2DWRA 2NPIA 2ADEA 3VHOA 2HWD3 2VOKA 4Y22A 2X53S 4LNVA 3LA3A 5FY7A 3UYJA 4DUWA 5A1AA 2OIIA 3BVCA 4KH9A 2H0VA 3NV3A 4CDXC 4GWMA 1IS6A 1O8SA 1WMDA 4BH9A 2CGOA 4JQRA 5A3NA 3AKQA 2QQNA 4EN8B 1S2BA 3FN9A 4QKBA 4YM2A 4OHYA 3W5MA 1CZSA 1A8DA 3GHNA 1VP6A 1ZM1A 4B1LA 2A7AA 3SKVA 1GNYA 1SBFA 4AEDB 1NQJA 1SCSA 1NLSA 3J7HA 3NAPA 4WM7A 3RNSA 3PNAA 2QQMA 3CDZB 1M4WA 1H1MA 4LHSA 3FBYA 4XJ8A 3GALA 1N1YA 4HN1A 5IVEA 5ACA1 1CAUB 2ZOEB 1DLCA 5A3TA 3DL3A 5DZGA 4CXXA 2JG9B 4QXHA 4J6GA 1RHI2 4AFDA 3ZR6A 1BBT3 2WYFA 5CZKA 5FZMA 2X10A 4D0QA 1GU3A 3IIIA 1FI2A 4XIOA 4C0BA 2Z42A 2YU1A 1LOFC 1RJ7A 1EUUA 1D0HA 3MICA 1Z78A 4FPKA 4K1ZA 5GLWA 1PIV2 4UOJA 4AFMA 4AOCA 2RS52 2D6PA 3JBG3 3ZYIB 3ZSMA 5JXJA 5C33A 2V09A 2W5FA 1WGPA 2KA3A 1PGL1 1GWKA 2QQUA 3CJIC 2J1SA 4FPCA 1MS8A 5IK5A 1KD7A 3AP5A 1JZ4A 3WHTA 3KT1A 4K7JA 1OPOA 2WFF2 3ZO0B 2XXZA 3RG0A 3RI8A 4QPIB 5J37A 3MW2A 1XNTA 3KT7A 1O7FA 4AEDA 3CZJA 2Y33A 2XL7A 5A7NA 3BU7A 4A6OA 5DAVA 1ZZCA 1D4M2 2ARBA 3RJRA 1C8M1 2BNNA 3GDBA 1COV2 2ZAAA 3LPFA 2WZPP 2PHTA 1GANA 3ILRA 3PU8A 2VCMA 2DVBA 4EN0A 5FBJA 2X5IB 3JB4C 4HFSA 4P9LA 1I3HA 5LBCA 3I3QA 3EJKA 5BNPA 1T2XA 2JE9A 2VMFA 4RGGA 1AF9A 4Z1VA 1KXGA 3BU0A 1U5ZA 4CRQA 4XFIA 4C1XA 2Q0AA 4AGVA 1PVC2 2JKXA 3KCYA 2W95A 2WYSA 2ZHMA 4IV3B 4Y1YA 3ZIWA 5J09A 3O1RA 2BFUL 2W52A 5FWEA 4B8EA 2BERA 1KRIA 5JVVA 5L9BA 1CONA 4BIOA 4TZDA 2Q8EA 4CEYB 3C8XA 1Y7BA 1AL21 5DQ0A 5DDJ1 4N43B 2NMNA 4RD7A 5BNOC 5IVVA 2DFBA 2Z5WA 4BXFA 5DDJ3 5FP7A 1IG0A 1OMIA 4YPJA 3WCSA 2DU0A 5KR7A 1V6OA 2WIIB 2WZ8A 1PGW1 2Y6LA 1S55A 2NMOA 3MF9A 1C5IA 1WCKA 3FBMA 3QBQA 4GZ9A 2DCKA 2GC2A 2RDNA 4IV1C 1UMIA 4XAAA 3IMMA 1DYPA 1ZZ6A 3IDCB 4ORFA 4OMCA 4MZUA 3U1XA 4EE2A 2HBTA 2FZ2A 1DQ1A 2P3KA 3KT4A 1CIWA 3OBAA 1X36A 4MGZE 4AR2A 2ZMNA 2QUOA 2C9AA 2VCAA 3MIBA 3OCPA 3WDTA 3OUIA 3SMHA 3LEGA 2RE9A 3I8TA 1F35A 1W6OA 1PO13 3O14A 2XR4A 4A3ZA 1XJAA 1XNBA 1IQAA 1JW6A 1QJX1 3WG3A 1E5HA 4XXPA 2JIGA 4L92A 1NCRB 2SBAA 5C4WA 1QMJA 1V9U3 1PNGA 4B3NA 1QWRA 1JYVA 2ZGSA 4LHNA 4HSLA 4QDSA 4NHKA 1ZRRA 1JOBA 5A7OA 3CZUA 1V0AA 2I45A 5CA6A 2IXCA 5A3OA 4DRVA 2AEZA 4QXCA 1BVP1 1JYIA 1ASJ3 3ZXDA 2F17A 3N36A 3K3NA 4P9GA 4FPGA 3L2HA 4IEOA 4JDMA 1GZWB 3EYPA 2BUKA 4WVZA 4IXLA 3SH4A 1Z7S3 4R9CA 4RGKA 3VD3A 2DUPA 1GICA 3AP9A 4QX0A 1W8OA 3H8RA 1H8TB 3O1TA 3W59A 1UYXA 4YW7A 3VBUB 2D97A 2WINB 2VNRA 5A6ZA 1WW7A 3DXUA 2RR13 4EROA 5IVJA 3VBUA 1QJFA 2IXHA 4A44A 5C7GA 2HYKA 5H9RA 3C7EA 5FYUA 5C3PA 3I59A 2QQLA 3RSJA 3GBGA 4XZUG 4LULA 1I1EA 4LT5A 5ACA3 4OUEA 3DPRB 3S57A 1AHSA 5JSOA 1OSGA 3V56A 4FT8A 1LU2A 4Y4RA 3NV1A 2VR4A 4HONA 1TNFA 1F5JA 1TZOA 5LY2A 1R64A 4C8DA 1IPSA 1ZBA2 4LHLA 4B29A 1JOPA 3CJIA 1FX5A 3ZPYA 3PUIA 1AR72 3DXTA 3MDPA 3H0OA 1HXS2 1OOPB 4IEUA 5EV7A 5FUNA 3ATGA 4AI0A 5GZDA 4EZ4A 4OI0A 1EV11 1GUIA 1HKDA 4IE7A 1PGL2 3VBSA 4P5YA 3WNOA 3GXUA 4RGAA 1RUH2 5EFUA 4FPLA 2FHRA 1WBFA 2VNVA 3QD6A 4COWA 1IS4A 2IVJA 2RHPA 1YQ6A 2EXHA 1OBNA 5CVRA 3QACA 4IW3A 1PK6A 5LY1A 2PAEA 5L7OB 1UOJA 4OFGA 4MGIE 3DKWA 4JGYB 1RHI1 2AR6A 2QVSB 1JBCA 1V70A 3AYAA 5IYYA 3KVAA 1JODA 1GR3A 1OA4A 4CDQC 3O1VA 4XBQA 3N9MA 5HV0A 2RM22 5FZCA 1QKQA 5J96B 2P6HA 1OPMA 3LE0A 3URFA 1QJY3 4K8RB 4OYUA 4W6YA 4KG8A 3C7OA 1Y9GA 3QLQA 4NROA 3WUDA 4BXSV 2IC1A 2Y6GA 4QXKA 3FFQA 4UAPA 5L19A 4UFHA 1R083 1OD3A 1LOAA 4QU2A 4COZA 4H7MA 2OKXA 3UGFA 1K5MB 4ARYA 4CCMA 4EN6B 3OF1A 4FTEA 3N9NA 2ZPXA 4LKSA 5DAQA 1V6LA 5FWJA 1MPXA 3AMMA 1SPPB 3HMYA 4OCTA 3Q8AA 1O8PA 2XMLA 1HXS1 2WZR3 4LBNA 1AYM2 2ZZQA 4XZPA 3VBFB 3GM8A 5J1XA 2CWSA 2VCBA 5FO7B 3FHIB 4IV1B 3SCFA 5BNQA 3RZJA 1WLCA 1QHDA 1PX3A 3ZDVA 3K4DA 4QB1A 2LS6A 1DGLA 3ETPA 4D8MA 2EVXA 2HEWF 2ENRA 2VNOA 5FZ7A 5F6LB 1D4M3 4AVVA 1R092 3I97A 4AVTA 4C0HA 2RJKA 4Q4W1 3MUZ1 3BOPA 1I6XA 1RVF1 4QPGA 4KU8A 2ILMA 2RM21 3UETA 3WF4A 2RS31 3OJBA 1ACCA 3HN1A 4AFCA 1VLNA 1LGCA 2A6YA 5L7OA 1DG6A 2XJVA 2PHWA 1UO9A 1J3RA 3ZYFA 1W6NA 2BV4A 5A1FA 4X8PA 1QJZA 4OQ8A 1KEXA 3GHMA 4YARA 4V2WA 3ABZA 4V2VA 3VBSB 3THDA 3KHBA 1SDDB 3APBA 3FC0A 2MEV2 4Y22B 1PO23 5FYHA 4BQ3A 2DV9A 1UY4A 3D3AA 4Q4V1 3LIGA 3MLJA 4IDZA 4O65A 3NSTA 5GZCA 2CNAA 3ZMNA 3AZZA 1HRV1 1OQ1A 4Q4V3 3GCWA 2P3JA 5C9AC 1MQTA 1US3A 4RYDA 3RVHA 1QH7A 1VBC3 2PLV3 2QDRA 4Y33A 3UKTA 1Y9QA 2P2KA 3U78A 4PDWB 1OA3A 4OI2A 5KHJA 1K5MA 2VMEA 4PQQA 4DFSA 1QJX2 1YI7A 3RYPA 1PVXA 4CU6A 1UL9A 1GZTA 1O4TA 5FZBA 2JE7A 5JPMB 3SH5A 1JI6A 1MEC1 3PMSA 1XE0A 2ID4A 1W05A 3LDKA 1DF0A 1CIYA 5F6KA 1GOHA 4EN9B 2W87A 4DY5A 3HN3A 3B94A 3WW4A 1UF2C 5FJKA 1QNYA 2BBVA 3ACHA 2JDKA 1RUD3 3O0WA 5FMCA 1GWMA 1SLLA 2ARAA 3PVNA 1JN2P 1SMVA 1O6UA 2ZGOA 2TUNA 2EAKA 4TXWA 2YXSA 1NG0A 1RUG3 4CP0A 2JB8A 2WWJA 1R1A1 2HWB1 3USSA 4Q0VA 1YCIA 2ADDA 2BFUS 3NKGA 5FZGA 4XHBA 3RZGA 2A3XA 1XOYA 2W46A 4YZ3A 1YLLA 4DMIA 2VZSA 3IPVA 1LODA 2WQ8A 4MHUA 1Q8QA 1UW8A 5GJ6A 1FPN1 1SLAA 4AZZA 4XJZA 2HLEA 1W2UA 1NA1A 1VBB2 1UZWA 2PHLA 2ZEZA 1C1LA 4JQTA 2XKPA 3KV9A 3WG2A 4BYYA 4BQ2A 3H3LA 2PQSA 1AYN2 5GZGA 1ND3B 1ONAA 3MUY1 2W0XA 1WCUA 2QQWA 2W1QA 4DXZA 3QOPA 1CGPA 2G9ZA 1VE0A 3HQRA 4GIQA 1NLRA 4OULA 4UWDA 5IK7A 1WUVA 4BISA 3JU9A 1JYTA 5FYVA 4E4ZA 1LB2A 4PJYA 1XU2A 2CDPA 1AJKA 1RUF1 2FDIA 3AP7A 1VBA1 5BNOA 5JOXA 5C8CC 3HPNA 1WA6X 3K46A 4BCUA 5JR7B 3DPRA 2UY9A 2G19A 1RUD1 3VHRA 4MXWB 4AK3A 2QFEA 3BPSA 3OGGA 3R0RA 1S2EA 4LLFA 1GZ9A 1AXZA 1OQEA 4LBLA 1XQNA 5T50A 2WT2A 5C4WC 3V64A 3ZFFB 2VOWA 1XBFA 2WNUB 3DF0A 4H7LA 1DBNA 1RUH3 2FDGA 3GF6A 2VMDA 1ZREA 4AGGA 2VMGA 1W90A 1UMZA 2GC1A 2VC9A 3RYKA 4CPBD 2Q1ZB 2C24A 5FIXA 2VBDA 1DHKB 5GM0A 5LA2A 2LUWA 3H8XA 1SQ4A 1LENA 3WP6A 2JDYA 4YW2A 2WNVB 1ZBE1 3ES1A 1XNDA 2DVAA 2GU9A 4FO9A 4LKDA 4Q27A 4GA9A 1TMF3 2DVDA 2VBBA 4GMP1 3BB6A 5A7PA 1V6MA 3CQOA 3ZXFA 5KHGA 1RL3A 3U11A 2XJSA 4GH4B 2FDJA 4FPEA 1VBE1 4YM1A 5FZAA 3CIHA 2Q8OA 5LK5A 3WF2A 3IAQA 4ZKTB 3C7FA 5BNNC 1IKQA 4LORA 4K21A 1FOD2 3R6SA 3LEKA 5JDBA 2RM23 3SNMA 3OGVA 3VKNA 3WQ1A 1OLME 2W2IA 5F9TA 4QM9A 4NJ4A 1PO21 2WNOA 1QJU1 2A70A 2PFWA 4JVAA 1WD3A 5C70A 1A3KA 4KMQA 4QD2A 1DYKA 2WQ4A 3NJXA 4F3JA 3TEWA 3WDUA 2ETEA 2OZ6A 4YW6A 5A6YA 1EAH3 3ALQA 4JCKA 4QX5A 3LA2A 4CDQA 5I0RA 3HQUA 2ZGQA 1X82A 3ORJA 2YROA 4A42A 2MPFA 3WV6A 5F8PA 2D43A 1KDMA 2WUHA 2BBAA 3IM0A 4Z92B 1US2A 4QX1A 2D6NA 2VH9A 1XC6A 2YGLA 4CEYA 5JUVA 3B01A 3ZXJA 3H42B 1VRH1 1UU4A 4COVA 3JQWA 1T6BX 2JB4A 1RUD2 3KLSA 4PCRA 5CKQA 5FY8A 1J3QA 2YFZA 1D0GA 3LSDA 3WP5A 1IOAA 2MHFA 2Q30A 1F9KA 1XNCA 3M3QA 4NIAA 4RS5B 1G7YA 4EWDA 3KGLA 3VZOA 4Y1VA 2ZABA 1DZRA 3T1MA 4AQ6A 4I0BA 2YYOA 1HV0A 1FATA 2R6QA 2WNVC 3MIGA 2VTFA 2QDNA 3F95A 4TWTA 1L7RA 4AEJA 4FXGB 1FOD3 2HWF2 2I2SA 1N3PA 4AGRA 3DV8A 4PT6A 1W2TA 2B8MA 4DXSA 3ZFGB 2WDBA 4YVSC 5FAXA 3CEWA 1VMJA 5T52A 1LTEA 1POQA 3KD4A 5C3QA 4CZSA 4QKFA 1QNWA 1QJY1 1CX4A 5GALA 4S2GA 4KGQA 1S4CA 4NAMA 4H2AA 4YG0A 4ITCA 1LEMA 2DYCA 3HAGA 5J3UA 2VMHA 5EWSA 3PU3A 4AYUA 1O5UA 3Q8BA 1OH4A 3S6PA 3WINE 4I30A 3V0BB 2ZAHA 4GD4A 4P02B 4AL9A 5JXGA 2GN7A 1OVPA 5HBAA 4YLZA 4ATEA 5SV8A 2BVVA 1FNZA 2WSVA 2XQRA 5A33B 1V9U2 2AGSA 3S5QA 3T4VA 3C7GA 4CCDA 2P3IA 3LKJA 5CYYA 2WC2A 3ZVXA 1GP4A 5D8AC 2XUEA 4IEWA 4UFJA 1QXJA 1F5FA 3WG4A 2OUHA 4LOSA 1AYN1 3E5XA 4RS5C 1CPNA 3H1YA 2WWSA 2DU1A 3OTFA 5LW9A 4LO4B 4XIKA 4QX8A 4P9XA 1RUC3 4D6SA 3MHZA 2GP3A 4HOOA 2WFPA 4JRAA 2W1WA 4KWKA 3BTAA 5D21A 3RS6A 4E8CA 1QOOA 3OPTA 1XU1A 3RFRA 4QB6A 1AXKA 2XBO1 3ZFEB 2JDUA 1O4YA 2Z4FA 3K77A 3PVEA 1LESA 3ST7A 3UJOA 3IT8A 4CDWB 1GOGA 5EIYB 2ZS6B 3RRDA 5A3PA 4QWNA 3V0AB 2E7TA 1H1AA 4DINB 2QNKA 1UKRA 4DXRA 1UOGA 3W58A 4ZONA 1EUTA 2V5DA 5KC5A 1UPIA 3N3HA 5FK7A 1QF3A 4Q0SA 3VD7A 1G9AA 1VBE2 2J7MA 3CF6E 2R061 1IS3A 2ARXA 4HK8A 4JKMA 4FTSA 4XQWA 2D6OX 1UCXA 1J1LA 1WW5A 4HBNA 3V65A 3IAPA 2JEMA 4JGZA 4KWUA 1HX6A 3HOBA 1YWKA 4YGBA 4QGNA 3MI8A 3KQRA 4LMFA 5GKAC 5I93A 1EYBA 2A1XA 4N8MA 3P6BA 4YRDA 1FMD2 1ZNPA 1LHNA 2DBIA 5FYCA 1H8VA 1EPWA 4BK5A 1ALYA 1ZRCA 1H8TA 3WF3A 4BDVB 4NRQA 1RUH1 1C57A 4DS0A 2W47A 5FMOL 3W20A 2R073 2A71A 4K20A 4D6RA 2EXKA 1A78A 4LK6A 5HXVA 3V0AA 4XPVA 4CP2A 4CSWA 2ZHNA 2IXLA 4GH4C 3HNMA 4DOUA 2DTWA 2A6ZA 1MS5A 4FQ4A 3AYEA 4RR3A 5FCCA 4P14A 5C6CA 5KWRA 1RUOA 2XJPA 5FMDA 4ZXEA 2UU8A 1UKGA 2V5YA 1A8MA 2V4VA 3GYDA 3N9LA 5L36A 1AL22 4FSJA 4R52A 3BTYA 1VB4A 3ETQA 1W03A 3WW1A 4OHWA 3WDYA 1ZRFA 2MEV3 1JHJA 3B9IA 5DDJ2 1FYUA 4HL0A 5D2AA 3B02A 4WM8B 2QQIA 1VB2A 3Q9OA 4YVSA 3SQOA 3UV9A 4D7TA 2B5HA 3JCIA 1WMEA 4IESA 4LA3A 5FYSA 5C8CB 2CWMA 3ZSJA 4AF9A 3AZYA 4WZCA 2YPJA 1VBB1 2K0GA 1UAIA 2WL1A 4QKDA 5BNPB 1W6OB 4LBQA 3OG2A 4Y3OA 3CU7A 2VU9A 1YYNA 2JENA 1W99A 5LWBA 1RMU3 5CBLA 5LA0A 1NA1C 2BP6A 4SLIA 5FZDA 5FR3A 5JZGA 1TVGA 3AP4A 3FE5A 1RC6A 3B9CA 4RQPA 1HJFA 2VNGA 2ORZA 1R1ZA 1RYYA 1OD5A 3N7LA 3HT1A 1MQTB 2RDRA 5FFOC 3JD71 5CKNA 3AP6A 2VXRA 2HEYF 1JZ6A 1DFQA 2Y8KA 4CXYA 1EV13 4XDOA 2AENA 4DO0A 1YJLA 1FT9A 4BQ4A 4LQRA 1W6QA 1BLZA 3O0VA 1Q8SA 5C71A 5FO8B 3DYMA 2OX0A 3VDDB 5BY5A 2DF7A 1K12A 4XEZA 4NIGA 1UD1A 4MV2A 3I2IA 2VULA 5GZEA 3NNGA 4Q26A 1X8EA 4Q4V2 2CU5A 4CDUC 3ZN6B 4D69A 2A6XA 3OEAA 5FPAA 1ZRIA 3MFAA 5BNNA 5F2WA 3RZLA 4E2QA 2IXKA 3K51A 3M4FA 4XURA 2XLFA 4AAPA 4CU9A 3ZPOA 3U4XA 4DQAA 5AC93 1A6CA 1XNAA 3OUJA 3VD9A 4JGYA 4B4RA 2CDOA 5DAPA 3R4SA 3BYWA 5F5CA 2FCTA 4XUNA 1ZBA1 2DVFA 4QMAA 4D3WA 3AVSA 5IT6A 5JXHA 5FQ0A 1DGRA 3ZYRA 4D6QA 1CAWA 2Z79A 1OLQA 2YC0A 3MIDA 1MZFA 1W6QB 1ND2C 2Q5TA 1PGSA 2RDSA 2L9LA 3M3IA 3B5LB 1LCLA 5T55A 1OUXA 5ABJA 4AE2A 2RMU3 4FFFA 1MVQA 5J98B 4CUAA 1H6YA 3KV4A 4JDNA 5C5UA 1LRHA 4ASLA 4DEQA 3EMRA 2A6WA 1YQCA 5LASA 4ES9A 2VMIA 2BW8A 1H9PA 2XQXA 5FXVA 1VALA 3LIHA 2BTVC 4D7YA 4YG3A 5FXZA 1KQRA 1SLBA 4OUSA 3E1F1 1MQTC 2GC3A 2X5IC 3FLRA 1TMF1 2WO3A 3P5BA 3SCHA 1GFF2 1QJX3 3C3VA 4NE9A 4Q4Y2 1ZZ7A 4XAEA 4GJZA 1AX1A 3HR9A 4RFT0 1JZ3A 4AVAA 4LK7A 1MEC2 4J25A 4HVRA 4GH4A 1G9CA 3RWNA 3WW2A 1BQPA 2GMPA 2HWC1 2Y60A 1AL23 3LQCA 1S2KA 1MS9A 2PHUA 4OHXA 1UU6A 1SEFA 2OS2A 3HQXA 1UIJA 4Q1PA 1YFUA 1W8TA 1R1A2 4PQ9A 2P34A 1O59A 5FYIA 3S5AA 1MS4A 1AR81 5GLVA 3MIEA 4XF4A 5LZ6A 1REFA 4FI9A 3NKTA 2IWGB 5CFCA 4KG0A 2OXBA 4UW4A 4ZU5A 1NY72 1NZCA 5FZ1A 4WZFA 4L97A 4ZXKA 4EQVA 4QB2A 4MADA 2D6KA 2FCUA 3N9PA 1FPN2 2LALA 4WM7C 2XGXA 3RMYA 1W6NB 2Q8CA 2GH8A 1X9TA 2D98A 5FP4A 4FAHA 1VPHA 2DFCA 5HV4A 3SITA 1F31A 4YVWC 3AYCA 2E31A 1IS5A 2HWF1 1HRI3 1VIWB 4CU7A 3FUOA 2ZKNA 5FXWA 2A5ZA 1W3VA 2BVBA 1VBD3 1N1SA 3R4UA 5C3SA 1VR3A 1GBGA 4G4FA 4Q4W2 2EIDA 4LBQB 5EJ1B 1UX6A 1MACA 2QBXA 5IFTA 5G04L 2YGMA 3M7AA 4ET7A 4MSVA 1BKZA 2EF6A 3EHKA 2J1RA 5FZLA 3BTXA 2C4XA 2I07B 4LO5B 2BYVE 4XF1A 1CAVA 3D8CA 3OD0A 3KGZA 3VDBA 5F2SA 4OZOA 4UFKA 1F8VA 4CCJA 3SLIA 2UURA 1PZ7A 5FZOA 2VW0A 1CESA 2VO5A 5LATA 5ABJB 2ZHKA 4I09A 1VRBA 5A33A 4CCCA 2WO7A 2VY0A 3MLKA 3ACFA 1JHNA 2HBUA 2VD7A 1JMUB 2JDPA 1SHWB 3DUIA 4NHYA 3POFA 3WNMA 1G86A 3USUB 1COV1 3MYXA 4BE3A 3KB5A 1RGSA 3VBOC 1NCRA 5IVCA 1OLRA 3LDRA 5D8AA 4YYOA 2XJTA 2FDHA 5JWPA 4UI9L 4JHZA 4PBOA 3IIAA 5E8AA 2BGCA 4PI0A 1RUNA 4FOVA 2ZJCA 3O12A 5JPNB 2ZGLA 3AM2A 4JC1A 1RUF3 4TLFA 3ZMOA 1ND3A 1H2NA 1ST8A 4WM7B 4AHXA 5KXCA 4E4HA 3Q8FA 1U5XA 4W6WA 5FV3A 4BPZA 1LOCA 2FBEA 2DCYA 3AKRA 3WQBA 1YQ2A 4B7KA 1LAJA 1TE1B 2WJSA 2ET1A 2PTMA 2DCTA 1UU5A 4GXLA 4QX2A 5FZFA 1ENSA 2B42B 4MGKE 1SLIA 2KR2A 2QKDA 4WVWA 1H2KA 2VZPA 1XPWA 2W68A 2XB6C 4IL7A 2AYHA 2GAUA 1PGW2 3P3PA 3WNNA 2WR9A 3AZWA 1ENQA 1XSQA 4LBQD 4ATFA 4N43A 5CG8A 5APAA 1PHMA 4YW5A 5BXXA 3HNYM 2JWPA 2PMWB 2PAKA 5D8AB 1QGLA 3IDAA 4EWEA 5I8TA 3OPWA 1GQGA 2C9KA 4S2HA 4XFFA 1WBLA 1UY1A 2QZ3A 3HT2A 3EQEA 2QQJA 1JXNA 1VAMA 1X9PA 4BIFA 4NIIA 4LITA 2PYTA 4IQPA 2NQYA 2XHNA 1W8ZA 3ES4A 4UXAA 4ES8A 5CNAA 1F4HA 2PQQA 3AB0A 5JXIA 4OHZA 4MO3M 5LRRA 2FQPA 1AR83 4CXWA 1VAVA 1ULPA 2A73B 4KWJA 3INAA 3AKSA 1R091 4LJHA 3NRUA 4DUVA 5I0UA 1W28A 2OVUA 3TNPB 1VBC1 1RUE1 2PLV1 2NZ9A 3U37A 1OFNA 5C9AB 2WLPA 1J84A 3K4ZA 3AFKA 4V1PA 2GNBA 1WLTA 2W92A 4AQ2A 3MBWA 4LO8A 3KZ4C 4N53A 3K2OA 4RA0A 3VBRC 5A3LA 5BYNA 4QAWA 2G9GA 2BU9A 1FMD3 4R9DA 3T4HB 3FHQA 5DUUA 3MLLA 5DZFA 5HI0A 1VMFA 4XBLA 3M2MA 2VM9A 2ZMKA 1W8WA 4AEKA 2GNMA 3BGAA 1RTVA 2QJVA 2AUYA 3WNKA 4QU1A 3AMHA 5KXBA 3PVOA 1GQHA 3ZX7A 3I3MA 4XTPA 1UYYA 2GH2A 1LHOA 2XUMA 1HRV2 2EXIA 3KS7A 4XQDA 5F3EA 2HWC2 3BTZA 1W8NA 2ZGRA 1E5IA 4O9EA 2W9XA 3EXUA 5F39A 5F1RA 3VKOA 1MS0A 4IETA 2YC4A 5FBZA 1CAUA 4TN7A 1RB8G 1RUI2 1OLMA 1W8FA 1RUC1 4KL1A 4LKFA 3JBG1 4BMEA 4PHZA 4COYA 3VZJA 1ENXA 2OQ7A 4FPYA 4NRMA 4IGOA 3H7JA 3AMNA 3LSEA 5CKMA 1ZZBA 3SKJE 2D93A 4RQPB 1LJ7A 3K3OA 4CVUA 4XYXA 1OI6A 2PA7A 4B4QA 5FO9B 2Y0OA 4ASKA 4M3CB 4M0HA 3WX5A 1WWYA 3U07A 1B35A 1Q8VA 2JECA 4A45A 2YUEA 4XE9A 5DUVA 1HW5A 3MW4A 1KJRA 1KS5A 3GZEA 5F37A 5KHKA 3RI9A 3I3BA 4UFLA 2ZGKA 2JJ6A 4DPNA 1F15A 3EB7A 4DXTA 2JG9C 3NW4A 4P08A 2P3YA 4OUMA 1K5MC 1ZZ8A 3VBOB 1JYXA 1QXPA 3EO6A 2VXJA 3IN9A 4FQZA 3N7KA 3UESA 1RUJ1 3U4SA 1OF4A 5A1LA 2R072 2D3SA 2R043 1J83A 2W1UA 1KDKA 3OPZA 4LKEA 4XACA 4XILA 4YG6A 3LWCA 1GLHA 1GNHA 3PTRB 5CFDC 4CP9A 5IWFA 5K4LA 3LPGA 1WMXA 4ZU4A 3TRSB 2UYAA 1RHI3 3KMHA 1VBD2 4Q8KA 4OQ9A 1AUYA 4NAOA 1NCQA 1H4HA 3D0SA 4W8JA 2BGPA 4URTA 5JI7A 1VBE3 2GMMA 5K8SA 4Q4W3 4CP1A 5K0UB 4Y5Z0 1QIQA 1W9YA 1W9SA 2E7QA 3AZXA 2YBPA 3PIGA 4KBZA 3WW3A 5B4NA 2WRAA 1L3JA 4UYBA 4J1WA 4RHV2 1CR7A 2WQZC 1RXFA 3I2FA 4Q0UA 4I2OA 4CUBA 1WW4A 2VZ1A 4MGTA 2ZGMA 1ENRA 2VG9A 1AYM1 1U5IA 2J1AA 2J42A 4XFHA 3OGRA 3ILFA 1ULOA 3POBA 4HN0A 2O8QA 2CAVA 3ZFFC 5GZFA 1RIRA 5FK8A 1XRUA 3NVCA 2V4AA 4DZGA 5I0SA 3I2JA 1V6IA 3BN6A 4QQLA 4XDQA 2VOVA 5FOJB 2XJUA 1GMMA 1Y43B 3VZLA 1AXYA 1X33A 2B7YA 3I59B 1M06G 5FP3A 1COV3 2CAUA 4CPBA 4AWDA 4XF9A 4JGZB 2WAOA 4IGPA 5T54A 4FXKB 1QEXA 2FMDA 4NR1A 4TSVA 4DEVA 5AFEA 4MGSA 4AVBA 2UYBA 4FPFA 4U2AA 5FUIA 4E4DX 2EAAA 2WS93 5GLUA 4L9BA 1CAWB 3ZFGC 1KFXL 4I01A 4I02A 1CZTA 2WN2A 2G4IA 3OGJA 5FMOS 4IEZA 4L8QA 1TNRA 1NXD1 1U5YA 1W0OA 2RS13 2B9UA 1YXWA 1TME1 2BWCA 1EAH1 2WZEA 4BZ4A 5HCFA 2YHJA 4BB3A 3BCWA 2ZX0A 1RUE2 4MOAA 2JDHA 3VZNA 1B35C 4Y4YA 5FPUA 4GJYA 2VQ0A 4KNCA 4E9KA 1BMV1 1ODNA 1PO22 2PN5A 2XH6A 3NL1A 1RUG1 4AFBA 1QDOA 1CPMA 2RR11 3CHXA 3UJQA 4NIHA 1X7NA 4IE5A 5A7WA 3F2ZA 2CV6A 1OA2A 3W5NA 3JZVA 2YY1A 3H8UA 3PHMA 2OZJA 5F5IA 3KCXA 4AQTA 3I2HA 4I3GA 4PF1A 4QPGC 2VOXA 2ZACA 3WXPA 5BUVA 1SBEA 2XBO3 4GKYA 4MUVA 4BLJA 5FY0A 4XDPA 4PDWA 4BQWA 4CDXB 5L9RA 4HLTA 3WDVA 3HWJA 2HWE3 4ZPIA 1PMIA 1NCQC 5LBFA 4Z8BA 5FREA 3RJ2X 2D6MA 3KWVA 1DCSA 3ON7A 3JD72 3OB8A 3GCXA 3N9OA 3OD4A 5BPXA 1MS1A 1NUKA 2RJLA 5FY1A 3X29B 1K45A 4XMIA 4OI1A 2XONA 3H3ZA 4AI2A 3D6EA 3FZ3A 2WO1A 4FFHA 1IPKA 3W9AA 2JX9A 2HH9A 2O8OA 2WS92 2WNEA 4YZ1A 1V6KA 1SG3A 3OBZA 5FYZA 5K9YA 2NLRA 3VD5A 1AX0A 3PL0A 1VAKA 3VBSC 4A4AA 1SLCA 3LCPA 1YFYA 3O1UA 3PTYA 5KHHA 3E6BA 1S0JA 5EJ3A 5FZHA 3GGLA 2AREA 4YVSB 3CNAA 4ZY9A 3J7MA 1QU0A 4HKLA 2ZXQA 1PK6C 1RMU1 4MXVA 3ME2A 4PIZA 4ASMB 3TAYA 5CFDA 4LR4A 1QDCA 4XF0A 2A3WA 5E6HA 2I74A 2WLQA 4J1XA 1UOBA 4AW7A 4QQHA 4PI2A 5HXMA 3RYRA 4P5HA 3TWIA 4PF5A 3CJXA 3KCCA 3WT3A 2CYFA 4OVEA 2BEOA 4OI4A 1LU1A 4W4ZA 3WOGA 4B4PA 5LA1A 3TYJA 1CX1A 4AAXA 3ZKUA 5FTTC 1POV1 2VTXA 3HIFA 2F6BA 2RS51 4CDXA 4NN0A 1C5HA 2JE8A 4ISRA 3FLPA 2YFUA 2ZEWA 4CCNA 5TSWA 3VKMA 2Q4SA 4E27A 1GYKA 4BQYA 4MYEA 1H6XA 3CO2A 4JTOA 4FP3A 3LGRA 4IEXA 3NQHA 2GALA 3O1OA 3NJZA 4WM8C 2YV8A 1PNFA 3ROUA 1RITA 1W6MA 2R0FA 4Q0QA 1P8JA 3VL8A 1DGRN 3ACLA 3UGHA 2IZWA 3K75B 2PHDA 1G9FA 1RMU2 2BGOA 2EIGA 2XLAA 4A3XA 2C1FA 4Q5OA 4IV3C 3D4KA 1HV1A 3A0KA 4XABA 5JI9A 3NNMA 1OHFA 5E88A 1UZZA 4BQ1A 4JZRA 2VW1A 1H1IA 2Z69A 3DN7A 4JKLA 3ASIA 1WMFA 5HCHA 3AX4A 2PHFA 1RXGA 2Y38A 3CLPA 4LXLA 4CEWB 2VZTA 3ECQA 5F3CA 3AYDA 3H7YA 3O1PA 1UWWA 2VZUA 3JB8A 4KU7A 1OFSA 2JICA 2WWUA 3DCQA 3RPQA 1CJDA 5LRSA 4AI8A 4YWAA 3AVRA 3RDIA 5IVBA 3OSDA 2VVEA 2VVDA 4Z2WA 4GWNA 4LBKA 3G7DA 4AI1A 1OOPC 5FY4A 4AVCA 3KF3A 2QQOA 4FPOB 4ZZ8A 2Y6HA 3I54A 3MO4A 1HB2A 1OT5A 4EYUA 3WDWA 4BM8A 2ES3A 4E2SA 1OH3A 2E26A 2WNVA 1RINA 3WNXA 3AKTA 4N90A 4ZS2A 4E2GA 1OXCA 3AMQA 2AH2A 3MF6A 1PM4A 2J1VA 4LUKA 1V00A 5L73A 5H9PA 4RFRB 3OYWB 3WCRA 1AR61 2RS12 5EXOA 1CN1A 1XE8A 4BLIA 5FQ0B 4H55A 5FZ4A 3ZSKA 2ZCWA 4E4SA 2D3RA 3J9SA 1NE4A 2C26A 3GJAA 3I2GA 1PIV1 1FMD1 4I3PA 4LBOA 3SEPA 3TBDA 3PIJA 1TME3 4LEJA 1W8UA 2IXIA 2KM2A 4N43C 5AVAA 3WNLA 3ZFEA 4B1MA 2MNGA 1QQP3 2OA2A 3GBWA 3WD5A 1XSRA 3ZSEA 1CWPA 4ZU7A 1N1TA 3IZOA 3A4UA 5F5AA 4XUOA 2DURA 1GNZA 4SBVA 4GALA 2BDRA 4QPGB 1QOSA 3PLQA 5ERLA 5ACA2 1U12A 3HJRA 2BWAA 4M4RA 4XFAA 1RUF2 5CFDB 5DG1A 1C8M2 5LA9A 1WA4A 3UT0A 3T0DA 2LRPA 5IAVA 4COUA 3LDBA 2ZKLA 4CCKA 5J7MA 2WNUC 5D1IA 3K48A 2D44A 2H6BA 3FUQA 4M0NA 2X29A 4LOTA 4UBGA 4GB32 2VCCA 2K9ZA 2ERFA 2BRTA 2OQ6A 2RG4A 4L99A 3UL2A 3ZXEA 1VBA3 5F7UA 5A32A 2J1UA 1SPPA 2JG8C 3VBHC 2HWD1 5JLVA 5AC91 1IPJA 1VBB3 2WAAA 2XLGA 2ZX1A 3WZ1A 4A7ZA 2P5BA 2ET7A 1ULCA 1UX7A 3I3EA 2B9VA 4QXBA 4W65A 4M01A 4N9IA 4O9GA 1W39A 3J8F3 1BK0A 5JIAA 4WV8A 1UOFA 3ZSLA 4L11A 4UT5A 5FMBA 4A7YA 5ANQA 2ZEXA 3LD8A 4BHPA 1APNA 2W08A 1AYN3 2YPDA 1OC1A 3TN93 1LR5A 3ZFGA 5LEKA 2R49A 4WBBA 5FZKA 3NAPB 5JIUA 1DZQA 2VZOA 3GJBA 4M3CA 1YIPA 2ZX3A 5FYMA 1VBC2 2PLV2 5LBEA 2ZMLA 5FY9A 4FFIA 4CEWA 3I4IA 4XBNA 1CQ9A 4UBHA 3LFMA 3PUHA 2W94A 1E57A 1BXHA 2QE3A 4XQ4A 4XW3A 5IFPA 3ZN4A 1DGWX 2QQPA 3MZHA 1JOJA 4HK9A 2D6LX 5F3IA 4W6XA 3VDAA 1PM7A 4GAZA 3ZXGA 1Q56A 1ULDA 1EY2A 1XB9A 2YZ4A 2Y64A 1HLCA 4NOTA 3DKQA 4X6RB 1CAXB 5A70A 3LOBA 2XG3A 1UY3A 1DGWA 4Q4X1 1HB4A 1HRV3 4JGZC 5JAXA 5FLIA 3IPVB 4CE8A 2EIEA 1Y4WA 2DVGA 2KXLA 3D82A 3POEA 2GN3A 2JG9A 2P17A 4PBPA 5IW0A 1RUC2 3JQXA 2R16A 4A7KA 4CCLA 4QDQA 2G9FA 4LE3A 1WW6A 2R042 3ZYBA 1CAVB 1RUJ2 3AK0A 5B2GB 5CAZA 2RV9A 3N7JA 4RSUA 1FAYA 1UZYA 2DUQA 3A21A 3L9JT 4XCBA 1L7QA 2VUAA 4IV1A 5DAWA 5CB7A 5BNOB 2J1TA 1SBDA 4GWIA 4JHTA 5F5QA 5T5JA 3IKWA 3RGBA 4RR3C 1S0CA 4K40A 3Q8CA 2QCSB 1FOD1 1H8TC 2VZRA 4MX3A 4R9BA 2YDEA 2XVGA 1WCSA 4QQ2A 5FYBA 1PIV3 5FXXA 1URXA 1FV3A 4AHZA 5JOZA 1AR71 2XVKA 3E5UA 3POYA 2ZBJA 3FJSA 3FL7A 2DDUA 1HQLA 3AL6A 1W3XA 3AMPA 5CU1A 3M1HA 5CADA 3VDDA 1N3OA 3LFIA 3ZKYA 2BQPA 4N7IA 3THPA 4HKWA 2ZGNA 4Q29A 4DNYA 1CJPA 1AYM3 3MIFA 3PUAA 4AVSA 1JZ8A 4NMIA 1RVF2 1ZYBA 3H50A 5HCAA 3OGSA 4GB33 1SLTA 5LCWL 2VZQA 4PIXA 1OKQA 3B00A 2RJ2A 2HJIA 3IMNA 1AR82 4HMZA 4XUQA 2TBVA 2ZZJA 5JSPA 3NJYA 3JXSA 4AHYA 2ZGPA 4ZS3A 1N47A 1ULGA 4QHOA 4HVQA 1ULEA 3AZVA 3KV5A 2MEV1 4L2NA 4XFGA 1SACA 3S7IA 4YGCA 1EV12 1HB3A 5CEHA 1YFWA 1WLWA 4TYSA 2WABA 4IE0A 5FZ0A 4AI3A 1K42A 3TOJA 4XVHA 3MPPG 3GZUC 1OOPA 4XJ9A 4YZ2A 1YRZA 5FZ8A 4ZZ5A 3VN4A 1YNAA 3VBOA 3VV1A 3T08A 4RL7A 3ZXKA 4G9SB 5JZGC 3J4UH 2Z2SB 4F83A 1HJGA 1VRH2 2VOTA 4XXAA 5G05L 2R041 4RN5A 3PJYA 3AXDA 4OZXA 5A3UA 5KXDA 1ZX5A 4X6QB 3VD4A 1TEIA 2GNDA 1MZ6A 1PMHX 3QH6A 4R8HA 1CD3G 2Y34A 3ILNA 5FP8A 1CVNA 3PURA 1BZWA 5AVPA 3LAGA 1HIXA 1JU4A 5EZWA 1NOVA 3B3QE 1W0NA 4CDUA 4HANA 5AFBA 3V0BA 2VW2A 4NRPA 3B93A 1LOFA 4PLMA 5HPOA 3VHNA 2HWD2 2PHXA 2RS32 3WF0A 1RJ8A 2AEYA 4Z2AA 1AX2A 3UGGA 4ZHNA 1QJU3 1LOBA 1PZ8A 3CKHA 4FCAA 4XJUA 3T2PA 3ZXAC 4QKNA 5DABA 4UW3A 3AL5A 4GULA 1NT0A 1BJQA 2XWJB 2ZEYA 3O5SA 4K6BA 4NHMA 2J22A 3J8F2 4ONUA 4QDRA 5EHDA 5C9AA 4MLOA 1QH6A 4XMAA 3U0ZA 1TMF2 3LA7A 4IERA 4QHBA 1W8HA 2ZX4A 4CCEA 1ASJ2 4KGGA 5LK7B 2Y0IA 3M3CA 2BJSA 5JMCA 2BZDA 4M3CE 1JZ5A 5DPNA 4QQPA 3DEMA 1KJLA 3ITQA 1Z7S2 3S0MA 1MS3A 3P1IA 4EV0A 4R4ZA 5FOBB 4K3UA 4C90A 1Q43A 1HQNA 1VBD1 3SEEA 1V6JA 4IUGA 2JG8A 1R082 3VBHA 4CUGA 1Q5OA 4NIDA 4KQ7A 1IHMA 3VKFC 3DECA 2HKXA 3WR0A 5LB6A 1NKGA 1CAXA 4P9WA 2R1DA 1C3HA 4CYDA 4OHVA 3J26N 2OUJA 2VZ3A 1BEV3 3FX3A 3NNJA 4AG4A 4A2UA 4QT6A 2R1BA 3T0BA 4JDOA 1BEV1 2B46X 3KVBA 2HYXA 4NHLA 2P37A 2AACA 4QGMA 2R062 1YFXA 2WSUA 3DYPA 5FUPA 5H9SA 5DMYA 2AZ5A 2HWB2 1PK6B 3FMGA 2IXJA 4JAAA 3NO8A 4DY3A 2QTWB 2RMU2 4IEYA 4GMP0 4K9SA 1LHVA 1ND2A 1ZBE2 3IWZA 1U0AA 1AR73 4N7UA 4BQXA 5FDBA 3DYOA 3A22A 3I3DA 3WHUA 1H2LA 2EA7A 4FPJA 4Y20B 3VBFA 2HWC3 1AL0G 1H9WA 2C5DA 2JG8B 4QPIC 2A6VA 3VBHB 5KHIA 2NN8A 4A6SA 3QCWA 1NAEA 3GZTB 3HNBM 5CFCC 1OUSA 2VAUA 2D40A 3ZR5A 1JYWA 5LEJA 1XXNA 3T09A 1FXZA 2JIJA 3MV01 1DLLA 5M0TA 2OPKA 4QQOA 2JXAA 3H1WA 1AR63 3ZYJB 5EJZB 1D7PM 1JUHA 1YUDA 4JTNA 1B09A 1I5ZA 2VGDA 3AXEA 5J48A 2VUJA 5FLHA 2VUCA 3IBMA 2E6VA 3FHAA 1UYZA 2PXJA 4NO4A 1TME2 3T30A 2D7FA 4CDWC 2DUOA 2E53A 1IKPA 4GMP3 3KF5A 4IGQA 2UWCA 3SXWA 2Y6JA 3AKPA 4XFBA 5A80A 5FZEA 4NPLA 3I2OA 3UKVA 2JDZA 5JCTA 3RWKX 1YQ8A 2R0HA 5IHRA 1W9FA 2XWBB 1OURA 4W50A 1ZA4A 4AQSA 2F4PA 1S0DA 1AZDA 4XTMA 4BK4A 5JOWA 5T5PA 5K0UC 3BIEA 1RVF3 4META 1HN0A 1UXZA 1SFYA 2TNFA 4R9AA 3WP4A 2ATFA 2NM1A 4H3WA 4JV4A 4BU2A 1NCRC 1O5LA 1WZXA 1ZBE3 2QQKA 2ZX2A 3UK9A 3VLBB 5JOYA 1GSLA 4YZ4A 3BUCA 2GZWA 4AFAA 1IQDC 4P00B 4O7XA 3CJIB 2R30A 3MV11 4MHRA 3CBNA 1W2AX 3LB9A 5C4WB 5HCBA 2A75A 4IV3A 4AHWA 4EN7B 5FPZA 4IE6A 1R093 3A23A 4EJRA 5ISLA 4INDA 2LM3A 3M3OA 5EYYA 5LBBA 2K46A 3THTA 4MG2A 2Q1FA 3ACGA 2VL4A 4YW3A 1W04A 2CSGA 1HRI1 2R32A 3SC7X 1YO8A 3H3UA 4HKOA 4KI5M 4Q4Y1 1ND3C 5IAXA 1QQP2 2GMEA 1FV2A 1SFNA 1SCRA 4HXCA 4CDQB 5CG9A 3M70A 1JYCA 4TLGA 1D4M1 2HEVF 4LIUA 5C8CA 4Y5TA 1HB1A 3R4DB 4JKKA 4CEYC 2C6SA 3OBTA 5E16A 3VBUC 1O4ZA 3GNEA 1Q8PA 2CGNA 3POIA 1F4AA 1DIWA 5FPVA 1X8MA 1D4VB 1GWLA 1SFPA 2UWAA 4TTGA 1K3IA 1V9U1 3MFCA 4N53C 4YGEA 5C3OA
chains in the Genus database with same CATH topology
4GQ7A 3MW3A 2B39A 3OY8B 1O3RA 3E5QA 1TQ5A 4LO6B 2UY8A 4CDWA 3I7DA 2YMZA 3WUCA 4Y1ZA 5BV6A 4QM8A 1DQ2A 4Q1RA 2DTYA 3FWEA 4QPYA 4FOQA 3ZN6A 4ISQA 1O3QA 5K7PA 1S0EA 3GZAA 1G6NA 4BOWA 2XKOA 1RUG2 1RUI3 2VQAA 1DQ4A 2WKKA 2C0ZA 1QQP1 2D5HA 3PMEA 1KS4A 4CTEA 2RMU1 2JD4A 4QPIA 1LEDA 4YFZA 3QH7A 1PO12 1RUJ3 1W6MB 2UWBA 2WT1A 1QJY2 5BNNB 2CY6A 3VDDC 1BVVA 2HWE2 4WVVA 1W6PB 3N35A 2ZTNA 4XFCA 3LZZA 2PELA 1NQDA 3E6CC 4XHXA 5AC92 2WA3A 3VZKA 1PZ9A 1LULA 1XE7A 1REEA 3KSCA 1POV3 4AEDC 5DUWA 3WLUA 3N7MA 4LUMA 1GZCA 3FFZA 4P9YA 3VHPA 4YGDA 3BODA 2BNOA 3CL1A 3IDEA 5KC6A 1NY71 2XVLA 1H0BA 1X50A 4AXOA 1UN1A 3L2YA 3NAPC 1GKBA 3HBZA 4FBFA 2H0BA 3MPBA 4YVWB 3TN92 4YM3A 1QXRA 1D2QA 5BNPC 4FOWA 1MZ5A 2DCZA 2TEPA 3D0JA 4UW6A 4C91A 1AJOA 2XPJA 1MZEA 2VECA 5E1RA 3TNQA 4YNIA 4YSFA 1IZ3A 4Q4Y3 2BPA2 2V73A 1S0IA 1QOTA 1J59A 1XYNA 4OLLA 4RHV1 1BYHA 1POV0 4HT1T 2WS91 3EBRA 4Z07A 4LA2A 4LHKA 3VUOA 4PLOA 3ELNA 1S0BA 3SHRA 4D7SA 1XNKA 4HETA 2JKBA 5L7OC 1DDLA 1KITA 1WD4A 4KWLA 4FAGA 2PAMA 4NPRA 5IUQA 1PO11 2ZHLA 4LLOA 4HSJA 4BMBA 2E63A 1ASJ1 3ZFFA 3H1MA 1PVC1 4LBJA 4HVOA 1W0PA 4YW1A 1PVC3 2NYYA 3DGTA 4FOYA 4I0WB 1VJ2A 2PHRA 1H2MA 1LOGA 1NE6A 1R081 1RUI1 4LE4A 5T5OA 3B7MA 3NWKA 3ZXLA 3TB0A 2FMYA 1KFUL 4GB31 4UW5A 4RS5A 2EXJA 1I9RA 3FLTA 4FP2A 1YJKA 5DUXA 1BMV2 3WG1A 1WCDJ 5DG2A 5IK4A 2E7AA 4F8AA 2WZR2 4NWWA 2E51A 2HWF3 1S0GA 2IFRA 3WVJA 3OYWA 4CDUB 3BALA 2XHKA 5T5LA 2OYZA 1JTZX 3VGIA 5T3NA 2WA4A 5GLTA 2Q1MA 2ZGTA 3WY6A 4P9JA 4Q0PA 4Y1XA 4IEPA 1J1TA 5C8WA 1ZRDA 1Y3TA 4WVMB 5K0UA 3JD73 3N4MA 1YHFA 4Z82A 4XOGA 3PVBB 1REDA 2B45X 3ZYPA 3O0XA 2HWE1 3M3EA 1JH5A 1LGNA 3VKLA 5I0TA 1WLDA 1J58A 2R063 4HZFA 3WDXA 3VBRA 4Q2FA 1EPZA 5A32B 2K2SA 3ZN5A 4Q4X3 3AJYA 1Z0HA 3I2DA 1DQ6A 4PDWC 4XJAA 1H4GA 2DCJA 4Q4X2 1S0FA 4MGYE 5JSRA 4LO7A 2XJRA 5CFCB 4WVMA 1LOEA 2WNUA 3TN91 3MIHA 3RQ0A 3BIWE 3ZIXA 2XBO2 2RS11 1AR62 2BNMA 3ZDSA 1NYWA 1ZZ9A 3OBRA 5J36A 4YFWA 1YIFA 3E97A 4NWVA 2RS33 3T1LA 2CTVA 1H30A 3ZYGA 4BWOA 2E9QA 1HXS3 2WZR1 4DRRA 2LTNA 3D5OA 2VPVA 1AR93 1QY4A 5EYXA 3E6DA 2EALA 3JUUA 4I0AA 1AVBA 2OW4A 3R05A 4K1YA 3MEPA 1HRI2 1FPN3 1LECA 1Q3EA 4FPHA 1Z7S1 1G9BA 4X8NA 4Q8LA 1HQWA 2GC0A 1SDWA 3VBRB 5FLJA 3VBFC 2D5FA 4C1WA 4GKXA 3HD8B 4CEWC 3NV2A 4YM0A 4IEQA 1LKNA 1N3QA 1J3PA 2WFF3 4Y24A 5I91A 1LHWA 3U10A 2XL9A 3VZMA 2SLIA 3G6JB 3RZZA 1DQ5A 5A3MA 2NP0A 1BEV2 3POSA 3KM5A 1ZBA3 3BOWA 2O0OA 5E89A 1AR91 4LBMA 4N9HA 4WM8A 1O91A 1C4RA 1EP0A 1XYOA 2H6CA 2HWB3 4PLNA 1V6NA 2QZ2A 4YVWA 1NCQB 1N1VA 4QGLA 4JGYC 1O3SA 5SV5A 4Y1UA 3M8LA 4K8FA 1LGBA 3MGUA 1VRH3 4M00A 1UIKA 1Q8OA 3AFGA 3POWA 1BBT1 4RR3B 3GBFA 5H9QA 4MH0E 3B69A 5KXEA 1MVEA 2CL2A 3O7OA 3BPZA 4NVPA 2X8KA 5DZEA 4YW4A 3UKNA 4MVTA 5FRAA 1S1AA 1XYPA 4G3YC 1D2SA 4MXWA 2FZ1A 1HDKA 2A3YA 5JZGB 4LTAA 2ZA9A 1F2NA 4Y26A 1DZTA 2D3PA 5I8YA 1C1FA 4BA6A 1ULFA 4B7EA 2O1QA 2CGPA 1UPSA 2GNTA 3SCGA 5FPXA 2X5IA 1C8NA 2N7GA 4YZ5A 1DQ0A 1QJU2 1EAH2 5IK8A 1C8M3 3S7EA 4F7ZA 2IFWA 1BK1A 4DB5A 3PJQA 3J8F1 4R4XA 4XETA 4S2FA 3ZFEC 5CIRA 4KBBA 3S30A 4M3CF 1C28A 1MR5A 4U36A 3SISA 4FTBA 3P3NA 1G9DA 5KBFA 1R1A3 5GLZA 2XJQA 1GV9A 1T6GC 3A0NA 1IGOA 3H9AA 3OY8A 4H14A 5ABJC 1G8WA 1AR92 1FNYA 1DU3D 5DXDA 3USUA 1VBA2 2W39A 3VL9A 3C2UA 4N53B 3IDBB 1B35B 3RMXA 2GDFA 3WQ7A 1OQDA 4P9IA 2WT0A 1YI9A 2RR12 4PIYA 4S2DA 1BCXA 4XF3A 4EWAA 4D94A 1ND2B 4XJWA 3WP3A 1LHUA 2WFF1 4FVVA 1RUE3 1BBT2 2Y26A 3ENRA 2GSYA 3SH3A 1NA1B 2VVFA 1GZWA 2RS53 3JBG2 4IEVA 3AJZA 4JRLA 4Y20A 3NV4A 1JUIA 2R071 5I8SA 4RHV3 2ZGUA 4HPKB 1NXMA 3DPRC 3T2TA 4RQPC 1ZVFA 4HPKA 1W6PA 1MEC3 3LOIA 4AEMA 1O3TA 3WQ0A 2DWRA 2NPIA 3VHOA 2HWD3 2VOKA 4Y22A 2X53S 4LNVA 3LA3A 2OIIA 4KH9A 2H0VA 3NV3A 4CDXC 4GWMA 1IS6A 1WMDA 4BH9A 2CGOA 4JQRA 3AKQA 4EN8B 1S2BA 4YM2A 4OHYA 1A8DA 3GHNA 1VP6A 1ZM1A 2A7AA 1SBFA 4AEDB 1NQJA 1SCSA 1NLSA 3NAPA 4WM7A 3RNSA 3PNAA 1M4WA 1H1MA 3FBYA 4XJ8A 3GALA 1N1YA 4HN1A 5ACA1 1CAUB 2ZOEB 3DL3A 5DZGA 2JG9B 4J6GA 1RHI2 4AFDA 1BBT3 4C0BA 4XIOA 1FI2A 2Z42A 4DY5A 1LOFC 1RJ7A 3MICA 1D0HA 4AFMA 1Z78A 4FPKA 4K1ZA 5GLWA 1PIV2 2RS52 2D6PA 3JBG3 3ZYIB 3ZSMA 5C33A 2V09A 1WGPA 2KA3A 1PGL1 3CJIC 4FPCA 1MS8A 5IK5A 1KD7A 3AP5A 3WHTA 3KT1A 4K7JA 1OPOA 2WFF2 3ZO0B 3RG0A 3RI8A 4QPIB 5J37A 3MW2A 3KT7A 1O7FA 4AEDA 2XL7A 3BU7A 1ZZCA 1D4M2 2ARBA 3RJRA 1C8M1 2BNNA 1COV2 2ZAAA 2WZPP 2PHTA 1GANA 3ILRA 2DVBA 4EN0A 2X5IB 3JB4C 4HFSA 4P9LA 1I3HA 3EJKA 5BNPA 2JE9A 4RGGA 1AF9A 4Z1VA 1KXGA 1U5ZA 4CRQA 4XFIA 4C1XA 2Q0AA 4AGVA 1PVC2 3KCYA 4IV3B 2ZHMA 4Y1YA 3ZIWA 5J09A 2BFUL 2W52A 4B8EA 1KRIA 5JVVA 1CONA 4BIOA 4TZDA 4CEYB 1Y7BA 1AL21 5DDJ1 4N43B 2NMNA 4RD7A 5BNOC 2DFBA 2Z5WA 5DDJ3 1OMIA 3WCSA 2DU0A 1V6OA 2WIIB 3MF9A 1PGW1 3ZVXA 1S55A 2NMOA 3QBQA 1C5IA 1WCKA 3FBMA 4IV1C 2DCKA 2GC2A 1DYPA 1ZZ6A 3IDCB 4ORFA 4MZUA 2FZ2A 1DQ1A 2P3KA 3KT4A 1CIWA 4MGZE 1X36A 2ZMNA 2QUOA 2C9AA 3MIBA 3OCPA 3WDTA 3SMHA 2RE9A 3I8TA 1W6OA 1PO13 3O14A 1XNBA 1IQAA 1JW6A 1QJX1 3WG3A 4XXPA 4L92A 1NCRB 2SBAA 5C4WA 1QMJA 1V9U3 1PNGA 4B3NA 1QWRA 2ZGSA 4LHNA 4HSLA 4NHKA 1ZRRA 5HI0A 2I45A 5CA6A 2IXCA 4DRVA 1BVP1 1JYIA 1ASJ3 3ZXDA 3N36A 4P9GA 4FPGA 3L2HA 4IEOA 4JDMA 1GZWB 2BUKA 4WVZA 4IXLA 3SH4A 1Z7S3 4R9CA 2DUPA 1GICA 3AP9A 1H8TB 3W59A 3VBUB 2D97A 2WINB 2VNRA 1WW7A 4EROA 2RR13 3VBUA 2IXHA 2HYKA 5H9RA 3I59A 3RSJA 3GBGA 4LULA 1I1EA 4LT5A 5ACA3 3DPRB 1AHSA 5JSOA 1OSGA 3V56A 4FT8A 1LU2A 3NV1A 1TNFA 1F5JA 1ZBA2 4LHLA 4B29A 3CJIA 1FX5A 3ZPYA 1AR72 3MDPA 3H0OA 1HXS2 1OOPB 4IEUA 5EV7A 4AI0A 3ATGA 5GZDA 4OI0A 1EV11 1HKDA 1PGL2 3VBSA 4RGAA 1RUH2 5EFUA 4FPLA 2FHRA 1WBFA 3QD6A 4COWA 1IS4A 2RHPA 2EXHA 5CVRA 3QACA 1PK6A 2PAEA 5L7OB 4OFGA 4MGIE 3DKWA 4JGYB 1RHI1 2AR6A 2QVSB 1JBCA 1V70A 3AYAA 1OA4A 1GR3A 4CDQC 4XBQA 2RM22 1QKQA 5J96B 1OPMA 3URFA 1QJY3 4W6YA 4KG8A 3QLQA 3WUDA 2IC1A 4QXKA 3FFQA 5L19A 1R083 1LOAA 4QU2A 4COZA 4H7MA 1K5MB 4EN6B 3OF1A 4FTEA 2ZPXA 1V6LA 3AMMA 3HMYA 1HXS1 2WZR3 4LBNA 1AYM2 2ZZQA 4XZPA 3VBFB 2CWSA 5FO7B 3FHIB 4IV1B 3SCFA 5BNQA 1WLCA 1QHDA 1DGLA 2EVXA 2HEWF 2ENRA 2VNOA 5F6LB 1D4M3 4AVVA 1R092 4AVTA 4C0HA 2RJKA 4Q4W1 3BOPA 1I6XA 1RVF1 4QPGA 4KU8A 2ILMA 2RM21 2RS31 3OJBA 3HN1A 4AFCA 1VLNA 1LGCA 2A6YA 1DG6A 2XJVA 2PHWA 1J3RA 1W6NA 4X8PA 1QJZA 3GHMA 4YARA 3VBSB 3APBA 3FC0A 2MEV2 4Y22B 1PO23 2DV9A 4Q4V1 3MLJA 3NSTA 5GZCA 2CNAA 3ZMNA 3AZZA 1HRV1 1OQ1A 4Q4V3 5C9AC 2P3JA 1MQTA 1QH7A 1VBC3 2PLV3 2QDRA 3UKTA 1Y9QA 2P2KA 4PDWB 1OA3A 4OI2A 5KHJA 1K5MA 4DFSA 1QJX2 1YI7A 3RYPA 1PVXA 1UL9A 1O4TA 2JE7A 5JPMB 3SH5A 1MEC1 3PMSA 1DF0A 5F6KA 4EN9B 3B94A 3WW4A 1UF2C 2BBVA 1QNYA 1RUD3 3O0WA 1SLLA 3PVNA 1JN2P 1SMVA 2ZGOA 2TUNA 2EAKA 2YXSA 1NG0A 1RUG3 3USSA 1R1A1 2HWB1 4Q0VA 1YCIA 2BFUS 3NKGA 4XHBA 2A3XA 4YZ3A 1YLLA 4DMIA 3IPVA 1LODA 1Q8QA 1UW8A 5GJ6A 1FPN1 1SLAA 4XJZA 1W2UA 1NA1A 2PHLA 1VBB2 3WG2A 4BYYA 1C1LA 2XKPA 5GZGA 1AYN2 1ND3B 1ONAA 2W0XA 4DXZA 3QOPA 1CGPA 4GIQA 4OULA 1NLRA 5IK7A 1WUVA 3JU9A 4E4ZA 1LB2A 4PJYA 1XU2A 1AJKA 1RUF1 3AP7A 1VBA1 5BNOA 5JOXA 5C8CC 4BCUA 5JR7B 3DPRA 2UY9A 1RUD1 3VHRA 4MXWB 4AK3A 2QFEA 3OGGA 3R0RA 4LLFA 1GZ9A 1AXZA 1OQEA 4LBLA 1XQNA 5T50A 2WT2A 5C4WC 3V64A 3ZFFB 2VOWA 2WNUB 3DF0A 4H7LA 1DBNA 1RUH3 3GF6A 1ZREA 4AGGA 2VMGA 1UMZA 2GC1A 3RYKA 2Q1ZB 1DHKB 5GM0A 2LUWA 1SQ4A 1LENA 3WP6A 4YW2A 2WNVB 1ZBE1 3ES1A 1XNDA 2DVAA 2GU9A 4FO9A 4Q27A 4GA9A 1TMF3 2DVDA 4GMP1 3ZXFA 3BB6A 5KHGA 1V6MA 1RL3A 3U11A 2XJSA 4GH4B 4FPEA 4YM1A 1VBE1 4ZKTB 2Q8OA 5LK5A 5BNNC 1IKQA 4K21A 1FOD2 3R6SA 5JDBA 2RM23 3SNMA 5F9TA 3VKNA 3WQ1A 4QM9A 1PO21 1QJU1 2A70A 2PFWA 4JVAA 1WD3A 1A3KA 4QD2A 1DYKA 2WQ4A 4F3JA 3WDUA 2ETEA 2OZ6A 1EAH3 3ALQA 4JCKA 4QX5A 3LA2A 4CDQA 5I0RA 2ZGQA 1X82A 2YROA 2MPFA 3WV6A 2D43A 1KDMA 3IM0A 4Z92B 2D6NA 2VH9A 2YGLA 4CEYA 3B01A 3ZXJA 1VRH1 1UU4A 4COVA 3JQWA 1RUD2 3KLSA 4PCRA 1J3QA 1D0GA 3LSDA 3WP5A 1IOAA 2MHFA 2Q30A 1F9KA 1XNCA 3M3QA 4RS5B 1G7YA 4EWDA 3KGL