1E0JA

Gp4d helicase from phage t7 adpnp complex
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
289
structure length
287
Chain Sequence
IPDGVVSALSLRERIREHLSSSVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIALERNQQGDMPNLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSYSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of T7 Gene 4 Ring Helicase Indicates a Mechanism for Sequential Hydrolysis of Nucleotides
pubmed doi rcsb
source organism Phage t7
molecule tags Helicase
molecule keywords DNA HELICASE
total genus 81
structure length 287
sequence length 289
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2000-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03796 DnaB_C DnaB-like helicase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1e0jA00
5AUQA 1JJ7A 2Y8EA 1N6HA 1Z07A 2R6DA 3BE4A 4YDHB 3K1JA 1WDTA 2WOOA 4R98A 1YRAA 1AA9A 2QM8A 3V4FA 1RRGA 4Q1AA 2O0KA 2QG6A 3K8YA 5C2JB 4URZR 4Q4AB 4B2LA 1XXHA 4WIAA 2RHMA 4D4LA 1D9XA 5FTLA 2VL7A 1TU4A 3MWKA 4TMKA 2OM2A 3EXAA 4QKQA 4M1YA 4LHYA 4KFSA 2B8TA 1TTTA 2FG5A 3SZRA 4S2EA 2A5YB 2G6BA 2FZ4A 3K09A 4G3XA 4OK5A 1TEVA 4P4UA 5JWOA 4EPWA 5DYGA 1CJMA 1F6BA 3AVOA 1SVLA 3TBKA 1YQTA 4H9GA 4JL8A 3RANA 2A9KA 3KJIA 4LJ9A 3UWKA 2GVDC 4DLZA 5FH9A 2XB2A 2FFHA 2IYLD 4HLUC 3N2EA 2EFCB 4BLSA 5J4YA 2IXGA 2J0QA 1CTQA 2J46A 1LTQA 2ZR7A 2NPFA 2F3TA 4TYQA 4C2UA 4O25A 1NN1A 2QE7A 3R7WB 2P67A 3E70C 4HAYA 1ZIPA 1F48A 1W7AA 2ZRMA 4Q18A 4WVFA 1MKYA 4A9AA 2WJIA 2PEYA 1A5TA 4Q1BA 1UEIA 2IEZA 4JLMA 5TDHA 3EPKA 2W58A 2R6CA 2J0VA 4IOKA 3W90A 3SYKA 3CRW1 4CT4B 3CIOA 1D6JA 2GJSA 2D06A 4U7DA 1QBKC 3QF7A 3LLMA 4MYHA 4TMTA 1BIFA 1QHHA 4BZPA 3U6KA 1IY1A 2SHKA 3NHBA 2BDTA 1R5NA 3IKJA 3CPJB 2WPDA 4O2RA 1S8FA 4L5BA 2Z0MA 4FMCB 4LBVA 4DDVA 1WA5A 5KDOA 4A2WA 1D9ZA 2LCFA 2RHDA 4FWIB 4AG5A 3FOZA 4DDTA 1CR2A 2W2TA 3GLIE 4TLAA 5EZ5A 4XOIA 1ESNA 5EE9A 2DWQA 1G64A 2FGJA 2C2HA 1KTVA 1BS1A 4M1TA 1IOZA 4LRWA 4KYIB 4C0HA 4XWKA 2D7DA 5IDVA 4ITRC 1IM2A 2ONKA 4PC6A 4WZAE 2ZUDA 5HZHA 3EZ6A 4ZCLA 2IUTA 2JIZD 4W7SA 2ZJ8A 2K5UA 1HEIA 3VKWA 1VYUA 2DR3A 1WMSA 1E9AA 1ZD9A 3R9XA 4URXR 2OFWA 1HH4A 1SZPA 3I61A 3FFBA 1T9HA 4ESHA 4D0GA 1SXJC 1UDXA 3KKQA 4LX0A 2BBTA 4QC2A 3FKSA 2MMGA 2CDNA 5KNCA 2QTHA 4CW7A 3AB3A 1E2DA 1FQJA 2KSQA 2Q9AA 4PC2A 2BMJA 3GLHA 3P1JA 2WWFA 1DO0A 4H1VA 1F5NA 2CL7X 3H2YA 4OQXA 1Z6GA 5HKKD 2XAUA 4QGAA 2VBCA 1YKSA 1P2SA 2V4ZA 4M1KA 2ZRKA 5EXTA 2XNDD 5EE3A 5H70A 5CDFA 5B57C 3H4MA 3B9PA 2WJJA 3I4LA 4OQFA 4PO8A 5F3WB 1DAFA 3U61B 1YVDA 2ZU6A 4GPTA 3EAQA 3MSXA 4TMWA 2IXFA 5IF9A 2GCPA 2QZ4A 3QVVA 1KJWA 1UFQA 4JBXA 2IUSA 1W2GA 4DHEA 5A5GA 2XJ9A 4V0ME 2BWJA 3AVWA 1RJ9A 2VHCA 2NO1A 1TUEA 3FDIA 3IILA 1E9SA 3RSOA 4DLUA 1JNYA 4ZKDA 1ZP6A 3AUYA 1GL9B 3HYRA 2O8FB 4Z1MD 3A4MA 3NIBA 4HSEA 1QHGA 3N2IA 4LPKA 2Z6VA 1E2JA 1EX6A 1JR3D 2OILA 4Q4AA 221PA 4JLVA 4XWAA 2JIZA 3U3OA 5DIFA 2WICA 1P73A 2QPOA 3DL0A 4FCWA 4M1MA 3A1VA 3C5HA 1JAIA 2D2FA 2ZEJA 1Z3IX 2CVHA 2V54A 2BMDA 1XCPA 3CZPA 4MGKR 1HV8A 2P0EA 3EW9A 2IYUA 2C5LA 3F3YA 3T61A 1OFUX 4MKGA 3RRZA 1W36C 3WYAA 2CCGA 4D4JA 3LVQE 3AGQA 4MITA 2WSMA 2QROA 4PXAA 1HQCA 1ZNWA 4K46A 4UJ3A 3FWYA 1IXRC 4DSOA 3MD0A 4QBFA 4HDOB 5GJVC 4DZZA 2VA8A 5FBQB 4QNMA 2NZ8A 5A4JA 4KYUA 4PANA 2ZR0A 3H86A 1KSHA 1HTWA 4DXAA 4B6EA 2HT6A 1E0JA 2RGAA 4C0AC 5FTMA 2KB0A 1NVXQ 1Z2CA 2BIFA 3A4NA 1Z0KA 1US8A 3TSWA 1KI4A 4EPTA 4US2R 4ZKEA 1CKEA 3QY0A 1OB5A 4IJMA 3H0KA 1J8YF 1GG2A 1R0YA 5B58C 1II9A 2CCKA 1Z6AA 4HDQB 3FMOB 3SDZA 2H5EA 2OFOA 4M8NE 1JBKA 1JQLB 1NBMA 4KSCA 3OAAA 1WB9A 3QPWA 5AR1A 3B60A 2OBMA 4OHZA 1LS1A 4FIDA 4IDQA 4PPNA 5DGXA 3GEHA 4EKDA 2ZJYA 4B3BA 3CO5A 1KAGA 5JSZA 4GZMA 3THYA 2WWWA 2GTPA 1Q3TA 4A15A 4TZ0A 4DVGA 1CXZA 3V9PA 2F55A 4M9QA 2CNWA 2OZEA 1WCV1 5AJYA 4G01B 1I4LD 4YMUA 4LSGA 3VKGA 1NL3A 3MLEA 1T5LA 5DO9A 2REOA 3G0HA 1X8LA 1DAIA 3KB1A 4S35A 2JLSA 5CJ2A 3GLFB 1W44A 1J90A 4FMDB 4OK3A 2JLXA 2OT3B 2A5GA 3U3KA 2OLJA 5CIWA 5FPSA 2IYYA 4JKIA 2X77A 2ZYUX 1NBME 2QPAA 5TXGA 3DKVA 3E1SA 1E2IA 1SVOA 1TQ6A 1CU1A 1FUUA 2OSBA 3TKLA 4BRUA 4U02A 4X8HA 2QT1A 2ATVA 2BEKA 4OBEA 2RB4A 3DMNA 3MFYA 1E9FA 3GMTA 2ZM5A 1QG2A 4GP7A 4RZ2A 1XB2A 2IYRA 3K0AB 3MWYW 1UKEA 2VPPA 1VG0B 2QP9X 1PVOA 2VSFA 3OIYA 4MDFA 4Q9JA 2IYVA 1Z0JA 1M34E 2CVFA 2PL3A 4KFTA 4MKHA 4BFXA 4LOAA 4Q5IA 1EFUA 3HP1A 4IKEA 4YQFA 4MRSA 1EWRA 4JVNA 2L0XA 1LF5A 2QQ0A 2R6AA 2FSFA 3GFTA 1Z6XA 2DHRA 4D81A 1NLFA 1RVDA 1SGWA 1MOZA 4CEJA 1NF3A 4IOJA 1KGDA 1KI6A 1XJCA 3KQNA 3HU2A 2PZFA 2CEAA 4AKGA 4KCGA 2ZQ5A 1KMQA 2HCJB 3SS8A 4A92A 3KDSE 1W0JA 2NO0A 1T0JB 3ZH9B 5F9FA 4C30A 3SNHA 1EFCA 2QUZA 3FGNA 5KSZA 1KO4A 3ZD6A 3IEVA 4RZ3A 1CR1A 1IXZA 3ZVNA 2IF0A 3SU8A 1IJFA 4QGFA 5G40A 3SJBA 1RW4A 4B6FA 4YMSA 2R6FA 3BIFA 1S9HA 1P60A 1IBRA 4Q02A 821PA 1M7BA 1GRRA 4M9SA 1ZCBA 3MCAA 4QGHA 2H8KA 2QNRA 5FOVA 4XWOA 2D4HA 5B2ZA 2ONJA 3WYGA 3QXJA 1JEDA 5E3HA 4PZYA 5JHHB 3Q3JB 4MYUA 2QPTA 3EARA 1ZYUA 4TTQA 3BFXA 4BFYA 1RRPA 3T1VA 4NCHA 2IC5A 3K70B 3QJYA 3W8RA 4W5HA 4B2PA 2GVZC 2IS4A 1P2UA 2GRJA 4A4DA 2YOGA 5K8LA 1UBCA 3LA6A 2HF9A 3CNOA 2EFHB 4GMXA 3CR7A 2C9YA 5FBLB 2AFHE 4LUCA 2F43B 2A2ZA 3EZFA 5CDFE 1HQYE 2XTZA 1RPZA 1XF9A 2DYKA 1XMJA 2XGJA 5JSZB 1OFTA 2B6HA 2QAGA 2WZQA 4B44A 5IT5A 1G18A 1OHHD 2W00A 2EWWA 3R8CA 1YJ5A 2C78A 3GJ6A 2BVNA 1NNEA 5G41A 1H8HA 1AS3A 1Z22A 1MO6A 2IYZA 5JCPA 3AF2A 2ZJ2A 1XPUA 4KHZA 1Z6YA 4GL2A 3ADKA 1E1RD 3LWNA 4G5RA 3ZJYA 1BO6A 5JLJA 4EJSB 1G41A 4AIIA 4LI0A 4LJ8A 4A0GA 4B71A 5FBWB 3PENA 1HUQA 1KMHA 3DKPA 1KI1A 2XEXA 5FPHA 1OXUA 2QAGC 1A2BA 1KMHB 4JIMA 2GF0A 4RVCA 4YXWD 4KODA 4PZZA 2GJ9A 3L0OA 4BFUA 2Q6TA 4LC1A 2H92A 2JLWA 5FI1B 4TYYA 1UBEA 1P9WA 3PITA 4HLDA 1WP9A 2GF9A 4PAMA 2HF8A 1CP2A 3LQQA 4D0LB 4I81A 1CRQA 4IFEA 3VHXA 3DDCA 3AKDA 3LY5A 5KPDA 3REGA 2VF7A 1O87A 1RJ9B 2IEYA 2WJYA 4ERNA 4HI0E 1XBTA 5JHGB 4DB2A 4EFLA 4KBFA 1WBDA 2FV8A 2FNAA 4FXPA 2RGBA 1N6OA 2Z5FA 4U00A 3B8HA 4PO9A 5FBVB 1JEEA 2VP0A 3X2SA 3ADCA 1UBGA 2FH5B 4JL5A 3X1DA 2Q3HA 4CZ2A 3QKTA 1KY2A 3LNCA 4PPQA 3QUSA 2OE2A 1R7RA 3B9QA 2ORWA 2PLFA 2RAPA 2OCYC 5J4LA 4QRHA 3OIVA 4A36A 2W2XA 4HUQB 4JVMA 5ANRB 1XZQA 1U9IA 3TVTA 1SQ5A 3GJ3A 5DI9A 3GLHB 1A2KC 3CRVA 4NKRA 3CRRA 1UDWA 2A5DA 4LHXA 5FOWA 3VFDA 2WKPA 4IFBA 3B1YA 3UMSA 1XJQA 1V43A 3IQXA 3TAUA 3VMFA 2Q21A 1DAMA 1LF0A 3RS0A 4FINA 3MWLA 1NKTA 4C0BA 1GOTA 1FZQA 4R2IA 3B5JA 3GJ5A 3VKHA 2JA1A 2H16A 3BS4A 3DZ8A 1UPTA 4NYMQ 4GZLA 1UKZA 1RE0A 1R5OA 2XOKD 2E9SA 4DLXA 3I72A 3X1YA 1OV4A 1GFIA 2H1LA 1MO5A 4I1OA 3VQTA 1W36D 4GNKA 1QVRA 2KBEA 3LXRA 4PO1A 3WP0A 4O2LA 3GD7A 3RS3A 3UKDA 4BEJA 3GLFA 1G7RA 2VTKA 4JLPA 4QNRA 2XITA 1IXSB 1U81A 2P65A 2WSSA 4QBGB 1NBMD 3LW8A 4X8OA 5KPJA 2FPLA 1MRNA 5TMPA 1AQUA 3QQ5A 2ZYTX 1OFIA 3QBVA 3QE0A 2KI5A 1W4CA 2ASEA 1XX6A 4D0NA 3VR3A 421PA 3RVBA 3TIFA 2G1KA 4M9XA 3T06B 4MUBA 3ZD7A 3RS4A 1KIMA 3CH4B 3VNVA 1ZC4A 4II7A 3DMDA 3S1AB 1IN8A 1ZUIA 3ETLA 4MYCA 2ZRLA 2CHGA 1KO8A 3L8YA 3WYFA 1UEJA 2FJUA 4DT1A 2ZTSA 1XTIA 1GNQA 2O8BB 1W0KD 2QMEA 2V1XA 3T1QA 1Z0FA 4GI7A 3BFKA 5JEDA 3TAHA 3CONA 4F91B 1VCMA 3NEJA 1XDBA 1D8TA 4B75A 3GFPA 3GLHE 1RC8A 1EESA 3SHFA 4ZDJA 3NH9A 4OI2A 1QHYA 1U94A 4L4UA 3HPQA 5FI0B 2CLDX 4WXRA 3THWB 3A6PC 2P6RA 4WA7A 1GKYA 4US1R 3SI7A 1OF1A 3AP1A 3BORA 1OH7A 4BECA 4RFVA 5JWRA 3EWSA 3L0PA 1U0JA 3R9IA 2QTFA 3GEEA 5CYOA 3CH5A 4LJ4A 2ZRDA 2BMEA 4PR0A 3Q9LA 3IIKA 1M6NA 2CMKA 4QJ3A 2HXYA 1KO7A 2FN4A 3BD9A 1OXXK 3L43A 5G3YA 3IQWA 4QG7A 3Q72A 2JLRA 4RY2A 3CF6R 3ND9A 1UM8A 4GFDA 5CLQA 2PLRA 2YVUA 2ODBA 1X8JA 1G5TA 4TLBA 4TN1A 4MA4A 4BQSA 1J99A 1G4UR 1G3IA 4L16A 4URYR 3A58B 5IK2D 3SBEA 1KSJA 3KQUA 2ZS9A 4NE2A 4TYPA 3FHCB 2XZPA 4Q9IA 1E2MA 2QL6A 3RNLA 5JWHA 1R6BX 5DHFA 2MSCB 4Q4HB 4MKIA 3PG5A 5J40A 4ACAA 4XSGA 1W4AA 1SXJD 4HB2A 4GDFA 4KBGA 2OG2A 2JLUA 3BOSA 4ABYA 2AK2A 2ZI6A 1U99A 1U98A 2IK8A 4KO8A 3SE0A 3EPHA 1IY2A 4OJKA 3SYNA 4PPFA 3U5ZB 5AK0A 3KUDA 3CNLA 3FMFA 5J4HA 2JJ2A 4PC7A 1PZNA 1TUIA 5E7MA 1ZUHA 3AGPA 1PV4A 1LVGA 2ZSBA 1AS0A 5FUXA 1G3RA 2HLDA 1G7SA 2ZRCA 4LY6A 5LB2A 1M2OB 2J0UB 4C3ZA 1BYIA 1XMIA 3K53A 3PEVA 3HPRA 3PUVA 1B0UA 3SYLA 2IWHA 4AD8A 5HKKA 5CLLA 2NQ2C 3TNFA 5IRCD 1ZAKA 3UANA 4A2QA 3B1XA 3RABA 5EP3A 5JEEA 3U7HB 3VHLB 1UADA 5CYPA 5DH9A 2IYXA 4Q7MB 2BHRA 5HTKA 1J7KA 1NVVQ 2P5TB 4J0QA 3RRYA 1Q12A 2KE5A 3DVLA 1G3MA 1UKYA 2F1RA 1E9BA 1KHTA 4DLRA 2ODNA 1CJKC 1JALA 1E9CA 1TAGA 1WE2A 4OHWA 5EQTA 3TQFA 2XNSA 3I62A 1PUJA 3OE7D 2WPDD 4QJ5A 4NHOA 4DCTA 1VG8A 3L82B 1E1QD 5E7IA 1DADA 5FUVA 3KX2A 4FD2A 4TLDA 3AP3A 4PQRA 4Q1FA 2GBLC 4RKEA 3WRXC 1II0A 1RIFA 4Q21A 3RS5A 2CK3A 1XP8A 1N3BA 2J87A 1NKSA 4TZ6A 1CJUC 4C0KA 4LYAA 1SKYB 3W5JA 4P31A 4DEXA 3NH6A 4AI6A 5C18A 4E5UA 2RGXA 3SFZA 1XEWX 2I4IA 1YE8A 2WAXA 4LHWA 1FL9A 3D8BA 4B74A 5FR2A 3KQHA 4AURA 2IHBA 4IVPA 2RMKA 3ND8A 2WHXA 4Q1EA 1XMVA 3JVUA 4A6PA 4M4SA 3THOA 3VTKA 5D3MA 1SVMA 1E4VA 2REXB 2JASA 1LFDB 1ZMXA 2RGCA 3ASYA 4A0RA 1EGAA 1DE0A 1RZ3A 4L15A 2BCJQ 2EQBA 5C4GB 5KO2A 3NXSA 4LV5B 1I4DD 3IHLA 2B7CA 2GCNA 4LGMA 1NMYA 1R0WA 3CX8A 4LBYA 3OAAD 1DAKA 1GL7A 4TSFD 2G83A 2O8BA 2ZSAA 4JVLA 4G0NA 4NYMR 1GITA 4B34A 4JLBA 4Q4LA 3IEUA 1XD8A 2BMFA 3C7KA 5CB6A 1P9NA 1N0UA 1KK0A 3VU9B 2AFIE 1US8B 2ZUBA 2NTYC 2Z4SA 4WZBE 1L4UA 2YV5A 3LDAA 1S3SA 3B82A 1NSFA 3FE2A 4N0EA 4OHVA 5F98A 1S1MA 2XNDA 2F9LA 4LJYA 4C9BA 2FU5C 3KQLA 2NPIA 4I4LA 3WNBA 4PSAA 3TQCA 1TU3A 2OBLA 1YZLA 3PV0A 2FMXA 4US0R 4I1UA 1EFRA 1SXJB 5FUWA 4BLTA 1CLUA 1Z0DA 1Z06A 1XTRA 4PX9A 2V55B 1E2KA 4XSHA 3HDTA 2DCUA 4ZCMA 4OL0A 1FX0A 3DPUA 2VP9A 5AUNB 4MDEA 1F60A 2O8DB 3EA5A 3JZAA 1YRBA 4W9MC 2QN6A 1U8YA 5E4FA 2GXSA 1VMAA 3K0FB 2NMVA 1OLOA 4QHSA 4UNSA 1CF4A 2EYUA 3SQXA 1E2GA 4XVQA 2ANCA 8OHMA 2WOJA 1L4YA 2F9MA 3L2OB 2ECKA 4RCZA 3T15A 2CE2X 4DSUA 2QRZA 4TQAA 1KSGA 1JQJC 2CLCX 1TQ2A 4HB4A 2VH5R 3PVSA 4ZIRB 3GLGA 3KZ1E 1DAEA 1H8HD 2WAYA 1GUAA 2VHTA 4DC9A 3I92A 3P27A 1W4BA 2QU8A 4HB3A 2A5FA 2OV2A 2GZDA 1KJYA 4ZDIA 3ADDA 5SZKB 1ZC3A 3ICQB 2HUPA 4JT2A 2OO7A 2QM7A 1Z8FA 3EIEA 1OB2A 1A4RA 4NONA 1AM4D 1Z2AA 4EDHA 1G7CA 1JXMA 1OH8A 1NLYA 4CVNA 2UZ3A 3PXGA 2YWGA 5JS7A 5JZVA 4UKDA 4NBSA 4AKHA 1G16A 1KK1A 1G3UA 3BH0A 1KO1A 2YHSA 1QHIA 1NVVR 1QHSA 5GVRA 2RGNA 1NIJA 3Q7PA 5TY0A 4XTRA 3NBYC 3THXA 3H84A 2ZI5A 1ZD8A 1XCMA 4RD1A 2ERYA 3B6EA 4DLYA 2PJRA 4FMDF 2ZR9A 2Q9CA 1SVWA 1EWQA 1H8ED 1X1SA 2PH1A 5BN3A 4HUTA 1ONBA 2J7PD 2WM9B 3NC1C 2FOLA 1G1MA 1NVWQ 4M22A 3U44B 3I1FA 1GVNB 5IK2A 4LJ5A 3CB4A 1COWA 3R7WA 4ARZA 4B3FX 4EJSC 3KXKA 1A7JA 1E2QA 4DSNA 2V9PA 3ZGXA 4IHQA 1JPNA 3U7GA 4IOLA 3MGCA 4NMMA 1L7VC 2UZIR 2W6IA 4M9ZA 3WRYC 1XWIA 2VP5A 4Z1MA 4P3YA 5C1BA 3DO6A 4NH0A 1I2MA 2O0JA 4Q4JA 3X1ZA 4B33A 4DLVA 2CE7A 1E79D 5D3QA 3BBPA 1TPZA 1G6HA 1BOFA 4HB0A 2P2LA 2XSZA 2E87A 2AN9A 2GKSA 1SXJE 2WWHA 3LV8A 1JR3E 3EWAA 2IXEA 3VU9A 5JECA 1VYVA 1R2QA 1IN5A 1ZUNB 4D6PA 4NZYA 4FMBB 2IT1A 4FI3C 2FF7A 4RKFA 3IGFA 3BB4A 5EUQB 4NYJQ 5L3QA 1Z83A 1G9XA 4V0OA 3B78A 1VCOA 1P5ZB 2VP2A 3L8ZA 1Z5ZA 4RD3A 3O8RA 3NEYA 3ZS9A 4BFVA 2PCJA 3A1SA 3RDPA 2QI9C 1CR4A 1QRAA 2NG1A 4WW0A 5CK5A 4CEIA 1BH2A 2A5JA 5G3ZA 3ZIAA 5JI2E 1TNDA 3GFOA 5KUTA 5DI3B 1LS6A 2ZPTX 2EYQA 4G5OA 3GLGE 4MKFA 5GJWC 2WJVA 5DI3A 4IEEA 5LD2B 2OAP1 3PEUA 4W5WA 5BYJA 4B73A 1IJEA 4C0QC 4V03A 2RGDA 2IX3A 2Q0HA 5H8WA 4BGDA 1Q1QA 2NZJA 2GILA 3BH6A 3CM0A 3HR8A 4LV6A 2R6GA 4Z51A 5K8UA 1Q22A 5BN5A 4AG6A 2JJ1D 2C96A 1X3SA 2HYIC 1E6CA 2IS2A 1E2HA 4AK9A 3RRMA 2O8FA 2AX4A 3QVUA 3TSZA 4LDJA 3QENA 1N5IA 4BE7B 2QAGB 2MMCA 2IL1A 3PIRA 5H68A 3ZYCA 3CWZA 5KYKA 4W5JA 1T3SA 3K9NA 4HZUA 3GLIB 2C8VA 5FOUA 3IIMA 5C4MA 3T5DA 3G82C 1P2TA 3T1OA 3ZDQA 2R44A 2AWNA 2A7QA 1MRSA 4Q4JB 1FMLA 2H17A 2WKQA 2ZVPX 3K0CA 5C46F 1GDDA 1AS2A 2V8OA 4B3XA 5BN4A 2ZJOA 1HYQA 3T35A 4LBZA 1Q1BA 1ETUA 4MGZR 4DIDA 1U0HC 3K70D 3EZ9A 4IXNA 3BH7A 2R9VA 2ZRIA 1S0UA 2W6JD 4O3MA 2IYQA 3BC1A 5GVSA 4OHYA 1LNZA 2DB3A 1P2VA 4PHFA 4UXHA 6Q21A 2GZHA 2PCLA 3EZ2A 5FBRB 1MR3F 4HLUA 1ANKA 2FFQA 3OEHA 2UKDA 3AVQA 3I73A 3U44A 2V6IA 1IY0A 4DCNA 3SN6A 1BYUA 3O8CA 4BEBA 2ZSFA 4HZIA 1XTSA 1YZUA 1YZGA 1P9RA 2ZS7A 2JDID 4Z54A 4B76A 4XTCS 3MJRA 5CJPA 2WSSD 4MH0R 2EVWX 4DLWA 3QKRB 1CR0A 3BJIC 1M74A 4TLCA 1M1YE 5JJKA 3W3ZB 1EG7A 1XMSA 4JLDA 4BLPA 5FPTA 2PMDA 3BGWA 5AJWA 5FR1A 4B48A 1CULC 1E99A 1TL7C 4BLOA 1AZSC 5IHPA 1VDZA 1ZM3A 2KBFA 2NIPA 3OESA 4OI4A 5G53C 1KAOA 2VIIA 3TUJC 2VP4A 2A78A 2RGEA 1FFHA 2ATXA 4Q48A 5BXQC 3W6OA 4A8JC 3I8SA 3TMKA 3A37A 2R8RA 3V00A 5KSYA 1X6VA 4LJ6A 2GCOA 2QSYA 2XSZD 3EASA 4LYJA 4NYJR 4P4SB 5E7JA 2OCPA 2FSGA 3UPUA 4M2LA 4OKSA 4TT3D 1N0WA 1GRQA 3NC0C 4DRZA 3QIAA 3UG7A 4NCJA 3IUYA 3TW4A 1JPJA 2WMNB 3PQCA 4P4TA 5FTJA 4IVQA 1E2FA 2PT7A 4TL9A 5KDLA 4C2TA 4KJZA 2QA5A 2FFBA 4C0LA 5DN6A 2C99A 4R71A 3F0TA 2EFEB 4DWJA 3P4XA 1OHHA 4NCIA 3BFVA 3DM9B 4MRVA 4TSFA 1E0SA 4FWTA 4R9UC 1ZNYA 1Q1EA 4A8JA 2BJWA 2QGZA 5FPKA 2G9NA 5J5CA 1CS4C 1E0KA 1ZBDA 1Y3AA 1ZW6A 3LVRE 4BLQA 4DBLC 1IAQA 5SZHB 2FFAA 3QEOA 1T8UA 3AV0B 1SXJA 4PSVA 4TMVA 5F9HA 2GK7A 5AJXA 3T12A 2GXUA 5BWMA 3NBFA 4KXFB 1NG1A 1HA3A 1OYWA 3FVQA 2OEPA 2W6ID 4CEIB 1DG3A 1J2JA 1C4OA 5HR5A 3U7EB 1QZXA 1FUKA 1M7GA 2HEIA 1J8MF 2IWRA 1Q57A 1T3HA 2WWIA 2XZLA 3QG5A 1DEKA 3F5FA 4JLKA 3U60B 4ZI3A 2HYDA 3I8XA 4PAOA 4XJXA 3TK1A 5J4VA 3PEYA 1B23P 1CEEA 2GZAA 1YZTA 5EE5B 1OIVA 2EWVA 4IRUB 2BOVA 4HUQA 1GL6A 1DG1G 1FTNA 3I32A 1OT3A 1VTKA 2PZGA 3QBTA 3TR5A 4H1UA 1O3YA 2O5VA 3NWJA 2CHQA 2HJVA 4C7OA 2G88A 1RYFA 1TMKA 1KI9A 1LB1B 2JJ1A 121PA 1SVSA 3VAAA 5AUOB 2VLIA 1W1WA 3ZVLA 4EFMA 3W5IA 2F6RA 1Z6TA 3UMRA 1W36B 3AUXA 1W0JD 2ZI3A 2BKUA 1SKYE 1FOEB 2P6UA 5K8IA 1M7HA 2DFKB 3U4QB 1YZQA 3ONWA 4AYWA 4MQBA 2VRWA 3D3QA 3ZZTA 5FL7D 3AF1A 3NBZC 5EP1A 3RWMB 1UBFA 1TQ4A 1WBBA 2NOAA 1Q44A 2XOKA 2QMHA 3HU3A 1NVUQ 4JYBA 4DB4A 3A1WA 2JCSA 4BFZA 3UIEA 1JECA 2PBRA 4YMWA 4AYTA 2ZI4A 2YJTD 4HAUA 1Q1ZA 2JLYA 1T5IA 1P4SA 2ZRPA 3Q5EA 4HAXA 5L3SB 5LB4A 3LBIA 1ZNXA 2EU8A 2IHYA 1N5JA 5EUMA 1GM5A 1FQKA 1KY3A 4RFSB 4TL7A 2IS1A 2QORA 3AF3A 2HV8A 4BZXA 2AKAB 5DHAA 1G17A 2BM0A 1GP2A 5KNBA 4O0MA 4OYHA 2ZAMA 5K8TA 2WWGA 2JLVA 1ZD1A 3AVYA 1GZSA 1OYYA 3CNNA 3W3AA 2X19A 3KKMA 1E96A 1G5PA 3KJEA 5L3RA 4WAUA 1FP6A 5HPYB 2WVJA 4IDNA 2D2EA 4IXMA 2ZS8A 2ZE6A 2GBLA 3PUZA 1S9DA 4PHHA 2AK3A 1PUIA 3KKNA 4N0DA 1QHHB 2IW3A 1G4AE 3RWOA 3IO5A 3NHAA 4ZIRA 3V4RA 3BK7A 3K0SA 4EUNA 4RZUA 1S3GA 4BFSA 2R65A 5JJLA 1R10A 1EFTA 1G20E 4TYWA 1AGRA 3T5GA 4C7OB 2PX0A 1EX7A 2YYZA 5KHOC 1D5CA 2FEMA 4HAWA 1P61B 2GJKA 2ZITA 1VECA 4CYMA 4FW9A 1JJVA 3OHMA 1TF5A 1NY6A 1KNXA 4D82A 2XTMA 2FPMA 1P7CA 3A4LA 3QXSA 1OXSC 2JJ8A 3MG9A 4JKYA 2Q3MA 4OHXA 2OAQ1 3KJHA 4OQLA 3FHTA 4QL3A 2FX3A 2AR7A 1MABA 3RC3A 1NY5A 3A1UA 1NN3A 1UF9A 1KI2A 1XD9A 5JMTA 4HAVA 4CT5A 4XVUA 1X86B 4BRWA 4AKIA 1II8A 3AKEA 3CPHA 4ZDKA 4Q1DA 4OI0A 1Z29A 2GEUA 4R7ZA 1PLKA 3U3MA 1F2UA 2RGGA 3WNCA 2BC9A 3KB2A 4B3CA 4L8GA 3VR2A 2GETA 3AH8A 5CB8A 4XH9B 2QT0A 3FPAA 4F4CA 1XPRA 1W5TA 1NMXA 3ZVRA 621PA 1ZVQA 4OQNA 4B32A 5LDDC 4F7WA 1MO3A 3BWDD 3WBJA 4EIWA 2FDCA 1SULA 4D25A 1SHKA 1YU9A 1N2CE 1VHTA 4LYFA 4LJAA 2JEOA 1N0VC 1QHNA 4IVRA 1VIAA 3U4QA 1MT0A 3R8FA 3LQRA 3W9YA 5CK4A 1E98A 3FKSD 2LKDA 1M8PA 3CBQA 1UJ2A 1NI3A 3CF0A 3CX7A 1Y63A 3TW8B 4BLRA 3U3JA 2HT1A 3R20A 4F4IA 4NPHA 4FCVA 3FTQA 3EIQA 2GWHA 4JMPA 4JBWA 2YWFA 3EPLA 1HT2E 5GJBA 2JLZA 1VCIA 2P6NA 2OXRA 4EQ6B 1S4QA 1NSTA 1KO5A 1KDTA 2QMUA 3OE7A 4CEHA 3FMIA 5CIQA 1E1RA 2ERXA 4NYIQ 1C9KA 4LHVA 2QP4A 1YZKA 1XRJA 2VSXA 5EP2A 4TL8A 5P21A 3NBXX 1CJTC 2MSEB 3U2QA 3FKQA 1NN5A 3I5YA 4KVAA 3TJZA 4Q66C 1H65A 1T4GA 1HY3A 1WRBA 2VF8A 4UXJA 1Z0AA 1YR8A 1R5BA 1G19A 3QXHA 2ZSDA 3ECCA 4EAQA 2G0TA 5DE3A 3ZS8A 5M04A 5CM9C 1N5LA 2H57A 3HYTA 4HLCA 3GJ8A 1RKBA 1K8RA 3KXLA 3UWOA 2J9RA 3QOFA 3QXXA 3W6NA 1KNQA 1E79A 2GCOB 4CIDA 2OHFA 4LC0A 1X1RA 4LV8B 2D62A 2RH5A 1FPMA 3RHFA 2HLDD 2DPXA 3ZZ0A 4F92B 3C41J 2O8CA 3SR0A 4M1SA 3VX3A 1ZCAA 1IN4A 2J59A 3ZQ6A 2FE4A 1ZU4A 2REBA 3C16C 4Y0VA 3W8NA 2J0SA 1R0XA 1XTKA 1YHNA 1COWD 4IDPA 3WMGA 4CEHB 4YC7A 3GLGB 1T8TA 1FMJA 3B1ZA 2X2EA 4KSBA 1K5DA 5D3MB 2CLSA 4TMZA 4LK2A 2HDNB 2VP6A 2C9CA 4Q9LA 4PHTA 4QXAA 4M0LA 4C4PA 4EJSA 4NDZA 3AVVA 1JAHA 3CWQA 3RSLA 4D4KA 1E2PA 3DZDA 3C15C 1ZM7A 1D2EA 4LYHA 2GJAA 1VG9B 4JSTA 2ODWA 1DS6A 3GQBA 4URWR 5DYIA 4GOXA 4B35A 1KDPA 3EZ7A 3LLUA 1GSIA 1EFHA 3WNDA 4BUJA 1FTSA 1ZJ6A 3L0IB 4V0MA 1MH1A 4V02A 1XEXA 2PX3A 3H1TA 2GAOA 4TTRA 1T3LA 3SFVA 1FNNA 2CNWD 2VHQA 3KFVA 2KJQA 2A3RA 2J5XA 4Q47A 1OSNA 1KK3A 4UNQA 3RRNA 2DBYA 4Q7JB 1TADA 5SZIA 4HZUB 1XXHE 4YDSA 1RYHA 1U0LA 1R0ZA 1W48A 4GOJA 1EK0A 3QPVA 3SJCA 3TSOA 4C0JA 3ICEA 1E9EA 3HWSA 1F3OA 2GJ8A 2WKRA 2X8AA 2RCNA 3IBGA 1GWNA 3AF4A 4QBHA 3NKVA 4DCVA 1G291 4P33A 2JJ2D 2IS6A 1NIPA 1MABB 3UATA 3WHLA 2ZETA 2BM1A 2O52A 1ZRHA 5F2EA 2ZJZA 1GNPA 3DOEA 4UXIA 4A6XA 1XEWY 3JZMA 2CXXA 1CBUA 3LFUA 4TL6A 1KZGB 3LXXA 3RYTC 3IHWA 4UNRA 1U9IC 2OBNA 2CHVA 2NO6A 4OI1A 3JVVA 3M6AA 2YC2C 4G5SA 5TV2A 2ZRJA 1JXOA 2ZRBA 2ORVA 4A82A 2FSIA 2AD5A 3MWJA 3GLIA 3KXIA 2QE7D 4D2IA 1E4YA 2D74A 4BZQA 3UK6A 3MJHA 5J47A 1S2MA 2EFGA 4NCNA 2NGRA 4LJ7A 4FCTA 4IOMA 3KTAA 2FEOA 3SJZA 3K70C 4PTLA 1Z0IA 1V5WA 2GK6A 1G8HA 1F2TA 3W6PA 2RGNC 3KUCA 3CUEF 2OCAA 1P72A 1H8EA 1XZPA 1L8QA 3GPLA 1KK2A 4A1FA 1W47A 4U5XA 4DEYA 2BEJA 4D4MA 5DNYB 2V3CC 4WZ6A 4UQOA 1PJRA 3BAFA 3MAAC 2YKGA 2ZROA 1U8ZA 5FOSA 1OXVA 1EFRD 2DFLA 1E2EA 3K0EA 2NO7A 3C5CA 2PJZA 4ZI2A 4LWZA 4PC3A 4RFSA 1GIAA 1OW3B 4MGYR 2Q9BA 4FMCF 4HATA 5LBIA 4KLZA 1KI6B 1KYIA 2CJWA 1VPLA 2FGKA 4JVSB 3Q85A 4ON9A 2VSOA 5GJCA 1S1CA 4RD4A 4DLTA 1FW6A 3EG5A 4ARZB 1NN0A 1VYTA 3OEED 3OEHD 4G5GA 4JLOA 4K81B 1KI7A 1Q21A 3GEIA 2ZE5A 4PAQA 3UMFA 4A8JB 5JJIA 1G8YA 1XD2A 2J1LA 2VYFA 4JBYA 2WIBA 4M1OA 4TQ9A 1ZIOA 3N5CA 5HCNA 4KV9A 4AWXA 4N1AA 2ORIA 1NLZA 4NYIR 1NRJB 2ZJAA 1Q20A 3ZVMA 5L8VA 4EPRA 3K9LA 1ZM4A 5JI3E 1DVRA 1G3QA 2F3RA 1RRCA 4EPYA 4KU4A 1SVKA 2A30A 4I99A 1U2RA 5BW8A 4M1WA 1LV7A 4L9WA 4NCKA 3C4JA 4JS0A 4IDHA 4CDGA 5EXSA 4P0TA 1N6KA 4LZZA 2QP3A 1KKLA 3K9HA 1KDRA 1KI3A 5FFMA 1DELA 3OF5A 1N6PA 2ZE8A 3PEWA 3QSYA 1MV5A 4EQ6A 3OIWA 4HDCA 3VNUA 4XD7D 2GEDA 1TX4B 3OFND 2WBLC 1DAGA 1T6NA 4AY2A 4DJTA 4TLEA 3WXMA 2GEVA 3U6BA 3OZXA 5HCIA 1GNRA 2D3WA 4PQYA 1PLLA 4A2PA 4DDWA 4Q9HA 4QBIA 2IYWA 1E94E 1ODFA 2XB4A 3NTUA 3SBDA 2J7PA 4NU0A 1E0AA 3QPUA 4Z8XA 1HE1C 1XU4A 2IBMA 4Q01A 1II8B 5B30A 3U7FB 3P4YA 2DY1A 1JI0A 3C14C 4E07A 4D26A 2F1IA 1P62B 4OQMA 3K09C 3QXCA 1J70A 2FZLA 3E2IA 3QKSB 4RZXA 4KI0A 1OJLA 2C95A 2QEQA 4C0SA 3Q8XB 4MRPA 4HAZA 3WBKA 2F7SA 4QFMA 4YXWA 1XNJA 3KQKA 1WF3A 2G1JA 2O8CB 1UKVY 1N6NA 4Q03A 3TUIC 1N5KA 2QTVB 3EC2A 1GKIA 1GRNA 1XCGB 3FFAA 1C1YA 2TMKA 2XTNA 2GESA 3IPXA 3ZIAD 3TR0A 1E2NA 4ILEA 4PFSA 1QF9A 1VG1A 3PFIA 4POAA 1ZU5A 3LD9A 4RD0A 4F4JA 2IYSA 3LBNA 4IW3B 3WHKA 1I4TD 2CL0X 2H7VA 4Z8YA 3L0SA 3GJXC 4P4SA 2ZRGA 3BB3A 3X1WA 2EFDB 4CGZA 3NVAA 3KL4A 2CBZA 3MRSA 1BMFD 3T34A 2ZYVX 3GCGA 4V0NA 4PSKA 3CRMA 5FL7A 4F38A 2GNOA 4TMXA 2ZIAA 2ZU0C 1Q3HA 3B1WA 3CKLA 3TH5A 3MMPA 3KTAB 3AKCA 2VQSA 1GILA 3J81k 4URUR 2J45A 1TQDA 3TUZC 4Q7LA 2HXSA 5KOYA 1KSFX 2XZOA 2QSZA 3KJGA 2W0SA 2F43A 2E1RA 1SKQA 4ASUA 1W46A 1R4AA 5DLQC 5AWFC 3PJRA 1NMZA 3O8BA 5FPYA 1E3MA 1YR6A 1KOFA 1XPOA 2AL7A 3CX6A 2N46A 5L3SA 1Z08A 3HU1A 3D6TB 3RC8A 1XTQA 3WY9A 4MUAA 2FPKA 1AGPA 4TT3A 3SJAA 1NG9A 5TARA 4P32A 2D7CA 5GADl 3PUXA 4NTZA 4B47A 3D7MA 2CJWB 2N1BA 4OJQA 4BFTA 5E95A 1P6XA 2YOFA 2AHOA 4BASA 4KLNA 2GHIA 5DSZA 3D31A 1WQ1R 2FA9A 1DBSA 2YOHA 4AC9A 1W2HA 1T0HB 1XFAA 2G77B 4CRWB 2HJGA 3ZZUA 1TEXA 2F1JA 3BERA 2WV9A 3QF4A 4QOSA 3TLXA 2UVQA 521PA 4RD6A 3GP8A 2QAJA 1F2UB 2J0UA 2ZI7A 5HE8A 1HT1E 2W83A 4A0HA 1A1VA 4JJKA 2BCGY 1DAHA 3BB1A 2C98A 3EIHA 2P3SA 1KJZA 2O0HA 2QGNA 1KKMA 3C8UA 4DSTA 3FHOA 2JDIA 2LKCA 1G7TA 2CCJA 3CF2A 4Q00A 1FNMA 1MO4A 1D2MA 1SVIA 2J3EA 3QKUA 4HYYA 3BXZA 2ZREA 3E5HA 2XJ4A 2ZRAA 3AVPA 3B7GA 4G1UC 4ZPXA 4ACBA 5FL3A 5FOXA 1G5RA 4XVRA 4B3GA 4PPGA 5B64A 4GSYA 1W0KA 4JZKA 4L9SA 3DEFA 5AJZA 2FWRA 4Q4HA 1OH6A 2B7BA 4ZO4A 1KZ7B 4XD7A 2GDJA 1VHLA 3OFNA 4AKEA 3K0FA 3LX8A 3KKPA 3RAPR 5JRJA 2X2FA 2I1QA 3Q5DA 2YC4C 4AYXA 2OESA 2ZJ5A 4HEJA 4PC1A 3WMEA 4EPVA 2ZRNA 1KDOA 3IDQA 3RS2A 3O8DA 2G0NA 2VO1A 3IIJA 5KU1A 3ADBA 2PMKA 2FSHA 2QRNA 3AEZA 2C9OA 1IHUA 1E2LA 3WP1B 2QQEA 3VR4A 4RSGA 4YONB 2AWOA 4UJ5A 2ZYWX 4GRAA 4YLGA 1E32A 2MSDB 1G6OA 2VHUA 2YWHA 5DISB 5FUYA 1CIPA 4EPXA 1XJ0A 3LX5A 1XTJA 1CJVC 2DFTA 1DO2A 3REFA 1N6RA 4E03A 4QM6A 4JLNA 4KFRA 3FB4A 2V6JA 5KDDA 5JRZA 4GMDA 3THYB 2IUUA 4JT4A 1YR7A 2WMOB 5J4KA 3LW7A 4RJLA 2W6JA 4LBWA 2BBOA 3N70A 2QY9A 3LAWA 1K5GA 1WXQA 2IF2A 2G3YA 3OIUA 3QKSA 2ZSEA 2B21A 1I2DA 2CK3D 2JLQA 1ESMA 3AVTA 4DLSA 1XEFA 3WMFA 4IDOA 4TTPA 1TF7A 1W5SA 4MRNA 1R8SA 1W4RA 3QG1A 1IONA 1AIPA 5L3VA 1EXMA 2IA5A 1HURA 3CR8A 3EC1A 4QJ4A 1NJGA 1ZM2A 2PEZA 3I5XA 4V0LA 1Z63A 3TGPA 2B92A 1HE8B 3THWA 2AXPA 1N6IA 4UNPA 3K0AA 5EE1A 4Q1CA 3SC3A 4HLQB 4Q7KA 4KFUA 3THXB 2ZANA 2Z43A 1XXHB 1E9DA 1X8KA 3W34A 1FX0B 4EFNA 2ZXUA 2O8DA 4X8MA 4B3DA 2BBWA 4DIEA 5AUPB 2WWYA 5A0FA 4JL6A 4RCYA 5KSPA 2RKOA 3MUFA 4DUGA 1PLJA 2KWIA 3AM1A 1E69A 4DCUA 2ZJBA 1FP7A 4G5QA 4GT1A 5SZJA 1ZM9A 1U90A 3CRQA 2JAQA 2GAAA 4CEJB 2IYTA 3P32A 3PR1A 2JATA 3ZLJA 4PHGA 1OIWA 3CZQA 1P3JA 3S1AA 1E1QA 1GKUB 3FYHA 2GXAA 3ZQJA 5JCZA 1NP6A 2XXAB 1E9RA 1QDEA 3LBHA 2ZE7A 2NO9A 2C03A 3P26A 3PCRB 1LY1A 1DTSA 2DWOA 4N3NA 4TQUS 3TE6A 3NG1A 1Q0UA 3B1VA 1P75A 3SOPA 5CITA 1JB1A 3OEEA 1KI8A 4YMVA 3I3SR 4TYNA 2OLKA 2Z4RA 1K6MA 2OFXA 1BMFA 3O47A 2VEDA 2OXCA 1GAJA 5BYKA 1IN7A 3PUYA 3ASZA 1OFHA 3X1XA 5H1YA 4X8LA 1A82A 1RFLA 1W49A 4KAXA 1N25A 3GJ7A 4XIGS 2N42A 2ZVQX 2V7QA 2WJHA 4DT1B 3QF4B 3A1TA 1GTVA 5EE0A 3U3RA 1AKEA 3KFXA 1R8QA 4E09A 3TVDA 1JR3A 2V1UA 4BPBA 5JS8A 2WTUA 5AJVB 2I1VB 4JLJA 5EXPA 1AZTA 2H18A 3IPYA 3SHWA 4F93B 2C04A 2O8EB 4CF7A 1XD2B 4YMTA 4JLAA 4ASUD 1DARA 4QHYA 4NL4H 3EPJA 2AD1A 3KKOA 2B8WA 1U8AA 4URVR 1OE0A 3F8TA 4M21A 2J41A 4BFWA 3GJ0A 3TRFA 3GJ4A 2GXQA 2Q3FA 3B2EA 1ZNZA 1G8FA 3IBYA 3IO3A 3M4YA 1VKJA 2HCBA 3QEJA 4QHTA 3AP2A 2PZEA 5JFGA 2V7QD 3LH5A 3QNUA 2X1VA 5HZKA 4GOKA 5TB5A 1ZINA 3RS7A 1L2TA 3VX4A 3LO5A 5HE9A 3GLFE 3R9WA 4JSYA 2QBYB 2OCBA 5LD2C 1S96A 4A0FA 2R2AA 2WWXA 3K9GA 2BV3A 3A36A 1LW7A 4UNNA 5EZ6B 1G8GA 1XEXB 1D2NA 5BQ5A 5TVKA 3UXMA 1DPFA 4WXPA 4MYTA 2AKYA 2WIAA 2ZUCA 3NDBB 4RD2A 2ANBA 3SQWA 3K0CC 3AVUA 4LCBA 2P5SA 2Z83A 4I1VA 4JYCA 3EA0A 2BJVA 4PQFA 1AKYA 2BKEA 5L3QB 5ELXA 4WBSA 4WOPA 2WJGA 3FMPB 3NDPA 1VIYA 2JGNA 4MGIR 3RLFA 4GBMA 5JBQA 5DN6D 3HJNA 2J7KA 3VR1A 2QENA 3B13B 1Z47A 1AN0A 2ZAOA 3VR5A 5UKDA 1OH5A 3CLVA 1QHXA 4V0KA 2YNMA 5LPNA 2XX3A 3B85A 3BRWD 4DUGD 2W2VA 2CL6X 1AJEA 3CPEA 5EJEA 2EW1A 1T91A 1ELOA 4GP6A 3M1IA 4K8OA 3QI2A 4Q19A 1YZNA 4ZDWA 3G5UA 1SHZA 2VHJA 3HR7A 4JJZA 1NJFA 4LPSA 2BBSA 4B43A 5FTNA 3AKYA 1OIXA 2ZRFA 3T1TA 4DKXA 4D80A 5KSOA 5EXXA 3UG6A 2R62A 1OKKA 1AQYA 2YINC 4B2IA 2YZ2A 4IEIA 3M0EA 2QMOA 2PT5A 2GA8A 1QG4A 2ZRHA 1VCNA 1OXTA 1N6LA 1QVAA 4QGGA 4OK6A 5CM8B 4FN5A 4BWYA 4DDUA 5KNDA 3P20A 3DM5A 3PUWA 4M53A 4ZV4A 4PZLA 721PA 4DCSA 4E22A 4TWZA 1TF2A 3AQ4A 4MRRA 4KITB 2W0MA 2DWPA 1YR9A 4QM7A 2F1HA 3EX7C 2ODEA 2YWEA 2ZI9A 4Q9KA 3Q7QA 1BKDR 4R2HA 1F2TB 4I1SA 2OUKA 1IN6A 5FOTA 1CRPA 2C77A 3LRPA 4KVGA 1IQPA 1JR6A 1G8PA 5FTKA 1G21E 3SEAA 2QBYA 2AXNA 2O8EA 4LHZA 3CW2A 2LWIA 5KTYA 1DOAA 1Z28A 3QKRA 3DOFA 1OKKD 2XXAA 3A8TA 4NP6A 3AF0A 4Y0AA 1AK2A 3AVXA 2I3BA 1RRFA 4ZCIA 3VR6A 1UAAA 5EP4A 3DHWC 1OPXA 4ESVA 2DFNA
chains in the Genus database with same CATH superfamily
5CDSA 2VYVD 1CIJA 4FU0A 2B94A 5K0ZA 3E4CA 2R6DA 1YRHA 5EKUA 3ZBPA 2WMYA 2XVMA 5WRFA 3ZW9A 5CW1A 1MZPA 3CLRC 2H1IA 4K9PA 3FNIA 2P90A 3G2JA 1H3NA 2OGSA 2I5PO 5CAEB 4F85A 1W8DA 3PJGA 1J0EA 2QG6A 5CCXA 1S2DA 2R5WA 5ALDA 2EP8A 4YRIA 1SXHA 2OHGA 3D3KA 3OCVA 4OUDA 4EJ0A 5JFOA 2RHMA 1QIJA 4AULA 1D9XA 4O4HA 5DHUA 2OFFA 4WE3A 4FHEA 4JSRA 3AJRA 4D4LA 4TMKA 1DRUA 2WMDA 2Z30A 5B7GA 5JDCA 3KQMA 3W2TA 3E15A 2FP4B 4QOHA 3H75A 4LHYA 4QKQA 2WIDA 1KMNA 4KFSA 2B8TA 4L78A 1GLVA 3EDOA 3SZRA 1W88A 3P9CA 1WY5A 5KC9A 2VNHA 3P9RA 3OZVA 2TMGA 1TEVA 1PFVA 2WU0A 2YZ7A 4UAJA 3UGKA 5DYGA 5BURA 5FYDA 3Q9SA 1FBTA 5B53A 3AVOA 1XVUA 3DNPA 3TBKA 4ZFNA 1DNPA 1G63A 1YQTA 2HA4A 3H18A 5DASA 4Z3OA 3GPDG 1MVLA 3L6EA 2YV4A 3Q12A 4LJ9A 4DLZA 5FH9A 1F8FA 2WD8A 5C81A 2HJRA 4TWIA 4HRXA 1QPGA 4I4TA 1MXHA 2N0SA 5F2KA 1P80A 3G8DA 1GEGA 3DUFB 3RRXA 1CTQA 2F3TA 5FWNA 4RPCA 3UB4A 5LJIA 1DGQA 4JJ6A 1I5EA 3R7WB 4F3KA 1PV2A 1N3IA 4FDMA 4JUBA 3HZOA 1IUOA 1LVHA 3LTEA 4HDRB 4F46A 4HFRA 5CBPB 1N9GA 4CHTA 2ZRMA 2ZCUA 4XPIA 2D0IA 3O26A 2CT8A 1MOPA 2W6QA 3M5PA 1MKYA 3DDZX 4A0SA 2WJIA 2KYRA 4DJAA 5LIRA 3I8OA 4HH3C 1WKVA 4NESA 1CZKA 2IPAB 4JLMA 1NM5A 4DV1B 3J7AC 4Z4FA 2R6CA 1BWPA 3W90A 4MMYB 4WNYA 3TE7A 3X3HA 3A4TA 3HCEA 1YL5A 5LXTF 2X4IA 4GS5A 2V0NA 4HWGA 4WRRA 4DIKA 4YRPA 5SY4A 3LLMA 2QLNA 3E84A 3GAFA 4TMTA 3ZHRA 1GCAA 3GZNA 4M83A 5EFZA 4YPVA 1C7JA 2SHKA 5HFNA 1R5NA 1HNNA 5I6DA 1P4RA 1R9NA 4O2RA 3HWRA 5CNJA 1S8FA 3IP3A 4FLEA 2MINA 3V1TC 1WA5A 3MTBA 3NJ4A 2HK9A 5KDOA 5LP6B 1D9ZA 1F4VA 1PW5A 3UB3A 3QXGA 4RTLA 4R69A 2BHNA 3QM1A 3QYPA 3UWMA 4TLAA 3GLIE 1PWHA 4IHJA 1QYIA 2RH9B 2VJDA 3JXEA 4I4TB 4XOIA 4DDKA 2RBGA 2DWQA 2HJHA 3AT1A 3TECE 3LDUA 1ZOPA 1L5LA 4X44A 3F3KA 1SCNE 3ZBUA 3ZU3A 4UHFA 4BNUA 1IM2A 1CB7A 2QG4A 4GLLA 4PSDA 2ZLBA 3UFBA 1BHQ1 3DOOA 2KHZA 3EZ6A 1VOTA 2EKLA 5GONB 4ZAVA 2Z2ZA 1CUUA 1TZMA 4PIVA 4ZCLA 1E1YA 1YOVB 1J23A 2JIZD 4XDHA 5C8YA 2K5UA 3RVLA 3ZWDA 3VKWA 1WXFA 3IUPA 4GLBA 1E9AA 1PBNA 3TEJA 1IJKA 2I66A 4CNQA 5A3QA 2WI8A 3SX4A 1SZPA 4HD8A 1TI7A 3A26A 5KYUB 3AJ8A 2AG6A 3GDWA 4JBNA 1QMPA 2BBTA 1BQ3A 5HCUA 2MMGA 4AS3A 4R7GA 1XRMA 1UDRA 3AB3A 4GF5A 5KQRA 2Q9AA 5D2CA 2BMJA 2HA5A 3F5DA 4PGHA 3HQ4O 1WPGA 3T7SA 2CL7X 4OQXA 3VNSA 2E6KA 3OOJA 2XAUA 3HCNA 4TVBA 3WDLA 5LOVB 2CYBA 4TS4A 1P2SA 2FHPA 2ZRKA 2XNDD 3H4MA 4UBKA 5SYAA 3IVMA 3KRTA 4CIBA 1DAFA 4GDMA 5H3CA 1Y6ZA 4DR1B 4AJIA 1FY2A 1YVDA 1W4ZA 3U61B 2AEJA 3ZXUB 2HPVA 2K2QB 2MSLA 4GPTA 5JAQA 1YVEI 4DJEC 1DX9A 4OM7A 1RTTA 1TUGA 4HFNA 3G0OA 2GCPA 2NZYA 4LZAA 2QZ4A 1I6LA 3JQGB 2HFJA 3TL2A 2IUSA 4RY8A 5CPFA 1G8JA 5AHWA 3O8OA 3T9EA 3WMWA 4V0ME 2BWJA 3AVWA 2VHCA 3E22B 3F6RA 3GYGA 3OURA 2JHGA 5DYTA 3WGJA 3AUYA 2GZSA 2L82A 4NJOA 2DUMA 1GL9B 2JFBA 1L3BA 2O8FB 3ZNPA 1VL0A 4BMSA 1MF7A 2FK7A 3DDSA 4WFJA 5I9SA 1FDWA 1E2JA 1TM4E 5BUQA 1NVKA 2ECOA 2OILA 2Q8NA 1PJCA 5DIFA 2IXTA 2WICA 3I6BA 3RK0A 1MW9X 3RK4A 1P0CA 5JS6A 3A1VA 3HZZA 3JRWA 4Z0HO 1JAIA 1ZWKA 2E5LB 1RP7A 1CY7A 1JRLA 3WX0A 4KZPA 2CVHA 4WY2A 1CEQA 1IVNA 3S2GA 1XCJA 4ZTUB 2BMDA 1XCPA 4M0CA 3C5VA 5EHZA 3VPBA 3VNQA 1HV8A 2B8JA 2FQYA 4TKMA 4MI1A 4E4RA 1M34B 3DLCA 4O1MA 3CJTA 2H1HA 1JHPA 2JI7A 1JJIA 4GC5A 3NHPA 4RIEA 4C89A 3LVQE 1E61A 3A7DA 2J3HA 2WSMA 4N5NA 2QROA 1KA9H 3DE4X 3B3FA 1SPBS 1FTYA 3PQ2A 4UJ3A 5BYBA 5A3JA 2GK4A 4H35A 4HDOB 5G2OA 3G02A 1CLEA 4PRZA 4HWKA 4QNMA 5BN5B 1FFBA 5BSVA 3QELA 3KHUA 4PANA 2MYNA 2ZR0A 2WC1A 3IVGA 5HG0A 5MF6A 1HTWA 2JL1A 3RG8A 1DQRA 4B6EA 2X7JA 2HU2A 2AA3A 3U4DA 1XROA 1O5OA 3DLPX 1NVXQ 2GEFA 3G1WA 1A9YA 2BAGA 2Q99A 5IUJC 4QOJA 2BIFA 2GARA 2PGDA 4BJHB 2B30A 3ZE2B 3I42A 1ZD4A 4EJFA 1V8PA 3QY0A 4YV1A 2DLCX 3CEMA 4BN5A 2LGJA 5EG5A 3CG4A 3F7TA 1XRRA 3PTAA 3P5SA 3U39A 2BISA 4HDQB 1YB5A 1NXVA 2HBYA 2H5EA 3ZOZA 4PYNA 2Z6UA 4M8NE 3JTEA 3C8ZA 1Q5PA 3AY3A 1CQJA 3OZAA 1ZMRA 4KSCA 1WB9A 5AR1A 1RCFA 1SXGA 1CDDA 1A69A 1WPRA 2OBMA 3H5WA 4HNSA 4E4YA 3HADA 4IDQA 4YBZA 5BOSA 3G7NA 4PLTA 4ZVNA 3JVEA 4B3BA 1KFEB 1Z33A 3U09A 1KAGA 4GZMA 1EIZA 4FS3A 4HN9A 1H5QA 2W98A 1M10A 3KOZA 3R75A 5CM2Z 1UWCA 4AZVA 2W42A 4BTEA 4S05A 3AUKA 1I4LD 3BMNB 3QMPA 3T94A 3VKGA 2O59A 1VJ1A 2QN8A 1HETA 5HRUA 2REOA 3ITEA 3G0HA 1DAIA 3KB1A 3TTVA 1J4AA 1CUAA 1HDOA 5IABA 3OICA 1TTPB 5CJ2A 5JH7A 4R8MA 2WF8A 3MILA 3GLFB 1AQ6A 1MQSA 1WNFA 3KELA 3KQOA 2HMWA 2I3AA 4OTZA 3UHPA 3U3KA 2OLJA 5IZCC 1A76A 1LD3A 4YBRA 3GK3A 4C3VA 1NBME 4LOJA 4PCLA 2PQMA 5G0UA 4D3ZA 4DNPA 3E1SA 4AMGA 5HKBA 1WETA 2ZSHA 1FUUA 1VLLA 1YIAA 1KYWA 2BONA 1BE0A 4QUIA 4U02A 3PC6A 4OHUA 3L41A 5K4AA 2X0DA 2XQVA 2ATVA 1YC2A 1SEPA 2W48A 1G21A 1G60A 1X9HA 1NW5A 2RB4A 1O8BA 3DMNA 3DT8A 3L84A 3QBDA 2C3UA 3GMTA 5JCOA 5HILA 1EHIA 4N9QA 2XCSB 1ZHHA 3U0VA 1XB2A 1KRXA 3WLIA 3A9RA 1UKEA 2HSZA 1VG0B 2VSFA 3GC6A 3KAJA 5CT8A 2R1TB 3KBBA 1GL3A 1EUCA 2O23A 3OX2A 4G1MB 2IYVA 1K08A 2DEUA 1Z0JA 3H11B 4JBHA 4RMIA 4OBXA 4LOAA 3U81A 3FNRA 1EFUA 2IY7A 1OFUA 3FWPA 5K6AA 4BHTA 1EWRA 2IGBA 5DBOA 5IZCA 2L0XA 4R2LA 4D99A 1RAIA 2FSFA 3K9WA 1DRVA 4MQUA 4EKIA 4YRTA 5F23A 4FGJA 2ZPUA 3EEOA 4D8VA 1WXGA 1QP8A 2RHOA 2C00A 4HGQA 4R83A 3PQEA 4G8CA 2YN4A 2VQDA 3IEPA 3AR5A 5AT1A 3WNQA 5I3ZA 2PUHA 1WJGA 2NSLA 1CE8A 2PZFA 4UHKA 3KQNA 3R2JA 2ZGVA 4KCGA 3DTVD 3EXFB 4KO3S 4C6TB 5IYZB 4LVCA 3KDSE 3IA7A 2NO0A 2J3IA 3PQ5A 4KAJA 3R3JA 4MB6A 3RLIA 4W82A 3ZLVA 3SNHA 3VNAA 3FGNA 5KNBH 2VZ8A 3SZLA 5KSZA 2GLTA 4A16A 4ZI7B 4NRDA 1ZGJA 3ABSB 3ZU4A 4CUZA 2AB0A 2YWXA 3UT5B 2VJLA 3ZVNA 2YUIA 4I36A 1N1DA 4QGFA 5CNKA 3SU8A 1RW4A 4PAWA 2NTJA 2WU4A 3BIFA 5K3EA 1YBFA 1P60A 3T9CA 2PG3A 2OENG 4Q02A 821PA 1M7BA 4UAGA 2BZ0A 1GRRA 5LYJA 4XQ9A 4P5DA 3C97A 1WW3A 4D3DA 4YV0A 5JCXA 1J8FA 2H8KA 4EI9A 3R3UA 5FOVA 1FXWA 3TFQA 5B2ZA 1N7HA 4IIJB 3WYGA 1LX7A 3WK5A 2GM9A 1O6BA 3Q3JB 1RYZA 4OUDB 3ZDRA 2Y1KA 4IUCS 3BFXA 2QK4A 4LMRA 1I4OA 1A9XA 3GN1A 3ZU2A 3ZLTA 2JLCA 3GJQA 3IAM1 1T2NA 1ZXBA 3QJYA 4UZFA 1FS4A 4BBZA 2IS4A 1P2UA 1EX1A 2GRJA 3Q10A 4A4DA 1W76A 4QEZA 3UCXA 1UBCA 4CKWA 3PL1A 3WL7A 3CNOA 4JR2A 2F3QA 3RUHA 2AFHE 1B42A 3KCQA 3R76A 3RVSA 3ZR4B 4ESEA 2QJOA 4JI3B 5CDFE 2AVNA 1RPZA 2YDYA 3STYA 2XGJA 1RWQA 5BUZA 4WK6A 2DY0A 3EF0A 1VP9A 2B6HA 2D2VA 5BMVB 1AQJA 3U13A 3CVUA 3KB6A 2W00A 5F1PA 1NXPA 4DM3A 1B74A 2IZ0A 3GVHA 3R8CA 4NMXB 1VJGA 3GJ6A 2JH3A 3SEQA 4BPRA 2AJTA 5IXSA 2O50A 1U8EA 4BNIA 4QDXA 4EZIA 2AW5A 1GNTA 2VSNA 1V5FA 3AF2A 3CT4A 4DUZB 4BP9A 1JFSA 2VJBA 2XA9A 1PTJC 4KHZA 1Z6YA 5A62A 2P69A 5ADUS 2QM0A 3LQYA 5JDIA 3QTBA 4XQCA 2RHBA 2ZT5A 3DOHA 4I46A 2HHLA 5ARDA 3PC7A 3OPYB 3UZUA 4B71A 5FBWB 4EK9A 1RJDA 2X0EA 3GPCA 1KMHA 3SZGA 3OWOA 3ABRB 3W2HA 2GLUA 1OXUA 2FWJA 1A2BA 4JIMA 4ZA2A 2O2XA 1A9XB 3K73O 1GQRA 2EQAA 4EG0A 2WUDA 5E1BA 1FNSA 2O4UX 1FS6A 2Q6TA 3HCRA 3UICA 3T5BA 4BFUA 2HDOA 2H92A 3L4BC 3NWOA 2JLWA 4M36A 1PNVA 4TYYA 1YI8A 1P9WA 2Y71A 1E1LA 3LRXA 2ZTVA 4HLDA 3WFIA 1D2GA 1LJ8A 2GF9A 4PAMA 2UYHA 1OU0A 3LQQA 4QT0A 4E88A 3QX9A 2UZ4A 3CCBA 3KFLA 2JB9A 1BWSA 2XZTA 3JZDA 3UJ7A 2Q1WA 4TXMA 3VHXA 3ABQB 3O84A 3ZI7A 4MVJH 4MVJF 5FWXA 3REGA 1O87A 3V8BA 3X1MA 5C5CA 4EEXA 3NGLA 1H05A 4MQEA 3H3FA 5A3RA 4O4IA 1C9EA 2DVMA 4U00A 3IXMA 1TFUA 1IZYA 3ZIDA 3T54A 5K99A 4PSCA 3QWIA 5FBVB 1XAIA 3H1EA 3UJNA 3ZZMA 2D5LA 2FH5B 3X1DA 3H17A 4KXVA 4PPQA 3LNCA 3S2UA 4FZVA 4EBBA 3ZK7A 4D3FA 5EKSA 4NENB 3QI7A 3QJ5A 1JIVA 3WR5A 1JHZA 2Q07A 3BSYA 1NNI1 1SKMA 3GLRA 3LKVA 2RK3A 4AJ1A 2YV2A 4Z7JA 2Y1WA 1T1RA 4JVMA 1XZQA 3TVTA 4N7RA 3GJ3A 5B3AA 1YK1A 1A2KC 2DH5A 3CRVA 4U6QA 5H4HA 5B4TA 5K0BA 1PHRA 2A5DA 3DXXA 4LHXA 4EYKA 2VFAA 4COOA 1VJCA 3BE5A 3B1YA 3FPGA 3UMSA 1WHTA 1XJQA 2QZPA 1NRWA 5C52B 1S7CA 2ILVA 1VRWA 3MT7A 5A7GA 3WQBA 5IJ9A 2WDZA 4AIRA 1UK7A 4FFSA 2DBZA 2IHUA 2JBAB 2J9YB 5B3KA 1XQ1A 2Y05A 4TM7A 5ICCA 2R8EA 4LNUB 3B5JA 4MW5A 3H19A 1C0KA 4EECA 3VKHA 3JQ8B 1PKEA 3AINA 2QLLA 3DZ8A 3EIOA 4FILA 4O4IF 5B7NA 1W5EA 3RIXA 2ZT6A 1R5OA 3T7RA 4AZTA 1LWNA 1SWWA 2D5IA 2OTCA 2YY7A 4I1OA 2ZB2A 1W36D 5FD8A 3BCSA 1QVRA 2IQ5A 2KBEA 3LXRA 5B7QA 4PO1A 3H0EA 2ZYAA 3VOBA 3TLBA 2RHHA 3IVRA 4LVUA 3RS3A 3T99A 1Y1SA 1PT9A 1G7RA 3EZYA 2IEAA 1B15A 3IV9A 3HKBB 1VYHA 5KPJA 5TMPA 3LW8A 4X8OA 2FPLA 2IOYA 2R96A 1WTAA 2W6OA 1JGTA 2HPZA 1YI1A 3BMQA 4FB5A 5KWEA 3A3YA 2CUTA 4UATA 2ASEA 4H08A 4G2NA 3VR3A 1HK7A 2Z5VA 3TIFA 1FMTA 3ZD7A 4XM1A 4NSNA 4F45A 1CCWA 1KBOA 2NYRA 5D87A 5EIWA 5AVWA 5KMGA 3DMDA 3S1AB 1ZUIA 3ETLA 3KXDA 1JHOA 5CIYA 3FF4A 1P5JA 4M0KA 3VC7A 1KC1A 2CL5A 1Y1PA 5EIOA 5CLFA 2GEBA 4WKOA 2E4VA 2PUJA 3ZLBA 4Q1VA 3QVGA 3STWA 2WQZA 3ZTWA 3GFSA 1LUAA 4HXYA 3IE0A 1W0KD 4X20A 2V1XA 1DXHA 3H2KA 4RTRA 4C22A 2ONYA 1J0AA 1N2IA 2R6JA 2QLFA 2XT6A 5FADA 1FNDA 3UUEA 2JIQA 1XZ8A 4U2GA 4B75A 3GFPA 3GLHE 2PU5A 4FKZA 4ZDJA 1VL5A 1FFEA 3NH9A 4HLNA 1Q7CA 5IMBA 3AJAA 1U94A 3ZJVA 2CLDX 2QUBA 4WXRA 1UZLA 4F04A 1JHXA 3GG2A 4WA7A 3SI7A 4US1R 5A6SB 4ZOAA 4BECA 1PX0A 7MHTA 1RD4A 1U0JA 4Y2QA 2QTFA 3TLJA 3R0ZA 3KR0A 3W7AA 2YFHA 3AOEC 3H83A 5K0EA 1PG5A 2VTEA 4PR0A 3Q9LA 3ELYA 1KRWA 4F8YA 3IIKA 1QGDA 4QJ3A 1UJCA 2HXYA 5CEFA 1KO7A 3MF4A 4MJ7A 4WJZA 2FN4A 1CQJB 4ZHQF 1P1KA 4KN5A 4W1RA 2DT8A 4CUKA 4AZ0B 3GLKA 1A77A 3Q72A 4NAUA 1U0TA 5CLQA 5CUQA 3X2EA 2W43A 2XRZA 2ODBA 1YXMA 2YN0A 1CUIA 1LI7A 3UK7A 4QOFA 4TLBA 2XGOA 4OD0A 4BQSA 4F2WA 1F0NA 4RABA 1G3IA 5AP9A 3IP7A 3AIKA 3WJ7A 2HDHA 1KSJA 4RLFA 5JYEA 4ZRDA 2A9OA 2PXHA 3E03A 2PRZA 2ZS9A 1E6WA 1UBMS 3JQEA 1S01A 3ELDA 4GYKA 1QX4A 4NE2A 2X58A 1NLUA 5ALPA 2WF5A 4WBNB 5K3FB 4PLVA 5JWHA 3B9BA 3A14A 4CKEB 3JALB 4FFBA 1K8QA 2MSCB 4Q4HB 3RKUA 3TINA 4HDSB 4EWLA 3FTCA 5J40A 2H1SA 1MJHA 3BIXA 4RAOA 1OLUA 4HB2A 3EDYA 3G8AA 4KBGA 4ID3A 4ND5A 4ZEXA 1H2XA 4FNOA 4DJ5X 1M72A 1AX9A 5DTEA 1KDYA 1IXKA 4F6LA 2E4XA 1IY2A 5BWCA 1U0GA 2BE9A 1SQFA 1CUWA 2WVHA 4HAIA 1T4CA 2FRDC 5KCZA 1K9VF 1D6NA 3N75A 2JJ2A 1PZNA 1S8NA 1TUIA 5E7MA 5EKDA 1KZHA 4KXXA 1VZ2A 2HLDA 3WTCA 4DA4A 4LZLA 4MB2A 1PD1A 3DZHA 2NU9A 2C5SA 1SCKA 1Q1AA 2XTAA 5T41A 4G67A 3LWBA 4NBWA 2X5XA 4H1TA 4S12A 5F98A 1JI3A 3K53A 1VXOA 1XHFA 2F64A 5EJGA 4X3CA 5CLLA 4OSEA 1TLTA 2JK0A 3B1XA 3OECA 3PQFA 2PH3A 3ITKA 4L4YA 5EP3A 2C2ZA 3K5IA 4MV4A 3L7JA 3ERCA 2RONA 4QYIB 2OPBA 3PRKE 1HFJA 4GOMD 2CJPA 2FHSA 2AXEA 5CHEA 1JTEA 1UKYA 1RQRA 2FN9A 3INGA 4B5KA 1KHTA 1ZN7A 2QR3A 2WJZB 4DLRA 4ZHQA 2ODNA 1JALA 3FOAA 5H7XA 4D4GA 1WCXA 3VR3D 4OHWA 3QX3A 5H59A 4KXQA 5DBGA 4I9FA 4NHOA 3NKFA 4KRYA 5JV5A 3EISA 1RZUA 5E7IA 1N8TA 5FUVA 1NXOA 1BXGB 4FD2A 3AP3A 4Q1FA 3I6YA 4XB2A 1BHSA 3VDRA 4UBIA 1U0NA 1Y89A 3AW8A 4QT4A 3HA7A 4U2EA 1JEQA 1U31A 2PAFA 4WL0A 3G2NA 2IW1A 4MVWA 3UUGA 1N3BA 1GYPA 1YDGA 2J87A 2VF4X 1CJUC 1U28A 3KLPX 2V5VA 4K03A 4M60A 1SKYB 2VH2A 1WZ2A 1CQPA 1GGEA 1UMCB 2XMZA 3PHJA 2BGJA 4X71A 4ZO6A 4ARAA 2R6ZA 1O9HA 4BBJA 2RGXA 1H6AA 1RWVA 3TM5A 3DFZA 2YRFA 1IU9A 4RDHA 1C1DA 1XEWX 3L5OA 3T52A 5EZYB 4J7CA 2X5KO 2CSUA 3U49A 2FCAA 1FL9A 2I99A 2VH1A 3HJAA 4X90A 3KQHA 5BN3B 1RRVA 1QGZA 2XH8A 1PFKA 2RMKA 3ND8A 4Q1EA 2QVXX 3FZGA 3NBQA 4GX1A 3JVUA 4ZVPA 4YP7A 3FOBA 5BSTA 1A4IA 2G70A 4OKNA 2JASA 1FFGA 1L6IA 1KY4A 3GELA 3G0IA 3AEXA 3O4JA 2O1XA 4ZAWA 4RYLA 1DE0A 1RZ3A 4L15A 1RM4A 4UCQA 3TG8A 1HZZA 4LV5B 3MT9A 2BP7A 2IU6A 3PNYA 2HA3A 1N2OA 4M9RA 3O92A 3QW4B 4LBYA 5LXTA 2FEAA 3VSBA 2JD0A 2Q2WA 3CCFA 2XODA 3CJRA 7YASA 1PU2A 2OUIA 3A6ZA 3ZE8A 3VNBA 4UEOA 1D0VA 3HKEA 2OCDA 2XNJA 3LECA 4IQ4A 1QNFA 2R4QA 4H6WA 5ECYA 1Q19A 3IRVA 4YP0A 3GRKA 2HCRA 3G9UA 4JLBA 4JJ4A 2W11A 3ABZA 2NM0A 4AAYA 1BXKA 3FSGD 3U56A 1GPMA 4JCOA 5CB6A 4DRYA 1TQ8A 1KK0A 4R1SA 3BCRA 1L8XA 1L5SA 1PJ2A 1ZGGA 1JG6A 1JYFA 1LLCA 3CKKA 3UQZA 4GGPA 3F3SA 3OF3A 3PGVA 4WZBE 1L4UA 1G2PA 3W8DA 3U9TA 4EG3A 5COAA 4LKRA 3FE2A 2MR6A 4MVJP 4QU8A 2IPNA 3RYCA 4C9BA 2ZRQA 2W6MA 3BDVA 4Q6WA 3QVLA 5JR3A 1JA1A 4PSAA 5AOBA 2O19A 1ZH0A 2A7XA 1K0UA 3A3PA 1R5JA 2FMXA 1L5HB 1N9GB 1EP3B 1SXJB 2IZ7A 4UDOA 3W77A 1IPEA 2BGNA 1CDZA 4QQ8A 4C0WA 1ZK4A 3T9FA 1W75A 2GCGA 3ZDXB 4QDZA 1FU7A 5CHYA 1CY2A 4RK1A 4OL0A 2ZYIA 2ERCA 3DPUA 2QRVB 3QUBA 4IIYA 3ONDA 2YFYA 3IJEB 3LTNC 1ZVMA 3EQZA 2QN6A 4XYLA 3DEYX 4BMXA 3ZGLA 4M99A 1TZJA 1QQAA 3IPAA 4EG8A 5DM0A 3EVZA 5KU7A 3AUUA 2JKVA 2F9MA 4R81A 4EL0A 5K3FA 3ZQKA 1KSGA 3D4BA 4DEVA 1C3JA 1SPXA 2CLCX 2L19A 1AHHA 1M66A 2VH5R 1HZJA 4H7IA 5JAUA 2IYPA 4EUKA 3GLGA 3S8EA 3G49A 4CM6A 5CA1B 2VHTA 4MUYA 4ZGGA 4JI6B 2MSWA 3KBOA 3OBBA 1QB8A 3ADDA 2AS0A 4L9AA 4U9HS 2XRFA 4JJEA 4EGSA 3UV3A 2HUPA 2OO7A 3EIEA 2ADFA 5AW9A 3ANLA 1QORA 4MCJA 5ARBA 1OB2A 5DHTA 4EDHA 2L18A 4QUHA 3NOXA 2UZ3A 1NASA 2OBYA 2PO7A 1SQGA 2G5PA 3C5WP 5EAIA 5JZVA 1E1CB 1PEAA 3TTSA 3J81A 3K1AA 1G16A 2PH5A 3DLIA 4LZWA 2CDCA 3PX2A 3KQYA 4PFQA 3DYIA 4ZQEA 4F2GA 1J1ZA 3S28A 3R3HA 5DT9A 3P5BA 5DWDA 1SJ9A 4NNJA 3KKEA 3NBYC 3WK6A 3H84A 2ZI5A 1ZD8A 1DBWA 4L4RA 4RD1A 4RV5A 4FM9A 2PJRA 4KQ2A 2UVPA 1JXAA 2ZR9A 4MKZA 1AZLA 3IOMA 5E1MA 3HV0A 1CUBA 1J2EA 5L4LA 2J7PD 1IIRA 2WM9B 4D5EA 3H7IA 2D0DA 1NBEA 4IEFB 4G97A 1NNSA 3GL9A 3AETB 3I01M 3FNGA 5HDBB 1UC9A 3RC1A 4CQMB 1ENZA 4YUWA 3CB4A 1COWA 3R7WA 4D45A 3PP8A 4FUQA 3TRJA 1KP2A 4UC0A 1E2QA 2EJWA 1XQWA 2DAPA 2V9PA 3EZXA 3ZX5A 3ZGXA 4IHQA 5A4FS 2X86A 1NOKA 2HJ9A 3MGCA 1O89A 4NMMA 2HLNA 4CG2A 1SUEA 3DF7A 1XNGA 2AI2A 3KVRA 3MK31 3BRCA 4M9ZA 4AO8A 2VP5A 3I9FA 1NRIA 1UFKA 2JJMA 3P45A 4GPEA 4P3YA 1I2MA 1E3IA 3OWHA 3X1ZA 2A0KA 3P4UA 1E79D 3D81A 3P94A 2ZOSA 3HDJA 1M73E 3PT5A 5D3QA 3OQPA 3ESXA 5CT6A 5F73A 3W3AD 1U4OA 3ICVA 1L7PA 5JNLA 1KYVA 1XU9A 4PTYA 2WWHA 3MZ0A 3WWDA 3BILA 3VUFA 4XB6B 4A8HA 3QEMB 5G0TA 2YWDA 4RQBA 4RPIA 4FZ5A 1YI0A 1TJ4A 4NZYA 2Y4NA 3KDAA 4FMBB 5EJ9A 3M1AA 2M6KA 4FI3C 2FF7A 4N6NA 5PNTA 4DJFC 2VQEB 1H1DA 1GV1A 1RJGA 3C6KA 2ZKIA 2B8EA 1Z5VA 2CFOA 3TTTA 2PS1A 4GPD1 2JGFA 3QU4A 1YNSA 4E6PA 1C7RA 5GMOA 3VO9A 3L8ZA 1JHMA 1Z5ZA 1QWOA 3ANNA 3LOPA 5EWLA 5J2TA 1N9ZA 4BVGA 1Y7PA 4CMIB 1YB6A 2SKEA 2PCJA 3A1SA 1IEWA 2YN2A 3B6ZA 4REMA 3VVBA 1CR4A 5ER6A 4RTMA 2NG1A 4R7TA 4WW0A 1QV9A 1BH2A 3IELA 4CEIA 3ZIAA 4A10A 2E4WA 5JXIA 1YZHA 1UT6A 4AMBA 1MGOA 1ZOIA 3EIFA 4KIWA 4Q3NA 2WFMA 4CN9A 1L8LA 1LS6A 1SC4A 2ZPTX 4IQ0A 4NX2A 3LS2A 2XADA 4L8YA 1KZ6A 2HIMA 4W9NA 4JIGA 5CGZA 2ODQA 3L92A 5BYJA 3JAKB 5BR8B 1Z4OA 3LWZA 3REOA 1MJFA 1MH9A 1YL7A 1AUPA 2O1SA 2QTRA 3DTVB 3OZUA 4CV2A 5H8WA 3EH1A 3L8GA 4MVJI 2G28A 4Z51A 5ALWA 3PB3A 2JIMA 1GZHB 1EX9A 2OZLA 4AG6A 2FVXA 2E21A 1PR6A 3TQQA 3RYFB 5HNKA 2IS2A 1E2HA 2P4UA 3DYBA 2Q5OA 2WT4A 2XNCA 3RRMA 4FK8A 1FDUA 1DC8A 3QVUA 4AK9A 1LPOA 2BJHA 4AY5A 3TSZA 1Z5OA 4BE7B 4AJNA 2CNNA 2HJSA 3ESBA 3PIRA 1G0OA 5ALMA 5H68A 1XEAA 3SF8A 3CWZA 5IH7A 1RXVA 4P3KA 2PRKA 4YJGB 4F2PA 2CN1A 4ZCPA 1M2VA 2C8VA 1FDTA 3D5TA 2XI4A 3D8HA 5FOUA 4OJYA 1GT6A 1HX7A 4JYAB 2AXQA 3K1YA 4Q4JB 1FMLA 2MTBA 3M4JA 2KW5A 5E4TA 5A2QA 3LVBA 3K0CA 1NGSA 3HXKA 1AS2A 4B3XA 1QIKA 2ZJOA 3TTUA 1PNTA 4F5WA 1TZKA 3EXHC 4IDAA 1YBHA 3W06A 3GCZA 1S0UA 4Z7NB 4BTLA 3U5TA 2Q4BA 1LNZA 2RG7A 1P1HA 3ZVKA 4UXHA 2HHHB 3BRWA 2O5RA 3EZ2A 4IGIA 3FPEA 3I9NA 4JLUA 3ZHOA 4QRDA 5FWAA 2FFQA 2GAJA 3RFUA 2JHPA 4HBGA 2P9ZA 2QRMA 3LQ4A 2C4MA 3AVQA 3E7WA 3I73A 1SELA 3SQOA 3BDAA 3O8CA 1DO8A 1JWLA 2DPLA 1EK1A 3UK2A 3S0JA 2R1ZA 1UANA 1P9RA 1XGKA 2ZS7A 3MTEA 4RLQA 4YAIA 1U0BB 5JSFA 4CTMA 4W4TA 2A0FA 1FVFA 4HNUA 5A4MS 4DLWA 5DNDA 1Q92A 1M74A 4TLCA 2RIPA 5JJKA 4LFAB 3QA9A 2WTBA 1XMSA 4UBJA 3G79A 3MTIA 4RZIA 3S4YA 3BGWA 1VBMA 4EF6A 4UVEA 5HA5A 3WSTA 5KB3A 3B5EA 1ZM3A 3G0DA 3OESA 3MJVA 3RBZA 3OZ7A 2NXCA 1CPYA 2XAAA 4PLWA 1WABA 2VIIA 3TUJC 4E4TA 2C83A 2XUHA 4JP5A 5EJFA 2RGEA 4YQEA 1QSGA 3HUTA 3RADC 3DE1X 3BYZA 2AEEA 2DXIA 4N5DA 3QPDA 4QXPA 1L4FA 3TMKA 2DH6A 4WJLA 1TVMA 3A37A 3BGIA 2R8RA 3F90A 3G2PA 4EUFA 3NORA 4HQLA 2CWWA 4LJ6A 4UFNA 5DHRA 3ZDAA 3GD5A 4NYJR 5E7JA 2OCPA 2FSGA 4RL4A 4RJKA 3OFKA 4GU5A 16PKA 2BGTA 3NIGB 4D79A 2PUEA 3HEMA 1Z7GA 4Q34A 5JSKA 1GRQA 3NC0C 4MWEA 3SDSA 1ISHA 3QIAA 4AF6A 1SFRA 1XKXA 2P3LA 3GH1A 4PYKA 1JPJA 1ADYA 4Y2UA 4B4UA 3IAFA 1HWYA 5LQKA 1XZDA 1YA4A 4RTJA 3K5PA 3C1TA 5HFJA 2GWRA 5HP4A 1VL2A 4KJZA 2VAXA 5B1SA 2QWXA 3LLSA 2QA5A 2C99A 3G5AA 1X1QA 5H82A 3DE0X 2V9ZA 2W7TA 3PLRA 2VYQA 4MRVA 4NCIA 2QD3A 4W6ZA 3U16A 1JHRA 1VBKA 5LQJA 1DP4A 2NVWA 3T3NA 2DTXA 2QGZA 1O6ZA 1EDEA 1Y3AA 3LVRE 5ES3A 4DDVA 3D1VA 2MU1A 4BLQA 3PF9A 2ODPA 2R11A 5FCDA 4OH7A 3BHIA 5F33A 1JMVA 5HS4A 4B8ZA 1M0WA 5J2UB 3CEPB 1VHWA 4PSVA 4TMVA 4S1WA 5ECWA 3GR6A 2GK7A 3NTOA 3T12A 2CJFA 3ZK9A 1TCUA 3F4KA 3AZOA 5DTRA 5DYWA 3FVQA 1UPXA 2OEPA 1QQBA 3UA3A 4DG8A 3WQSB 1R0BA 2YVQA 1DG3A 3DBLA 1B6RA 3LT4A 3CT6A 3I9V1 1V95A 3INTA 2ZTMA 1FUKA 1WMFA 2P0YA 2VAVA 3OM0A 3A6GA 2O3SA 3ZDBA 3WLQA 4IHAA 2RI1A 1ESEA 4U2BA 2PZBA 3PQ6A 1THZA 4TV9B 3TK1A 3H5OA 5FO0A 4D9FA 1SIWA 1E3TA 1OC2A 5EE5B 2JLBA 4U2KA 1WXIA 3AFGA 2Q41A 2W9XA 3WLNA 1HEUA 1DG1G 3HKEB 4R2JA 4LWPA 2QY6A 2PZGA 1N2JA 3HJFA 2SBTA 2GBIA 1O7JA 3IQIX 3QBTA 3TR5A 1YC5A 2QTCA 2VVTA 3NWJA 2DTDA 3TQIA 1GU1A 4C7OA 3TW8A 5AW2A 1KI9A 2GA9A 4N8DA 2JJ1A 1V0JA 3KWFA 4TS3A 3PC8A 4RVDA 3SQNA 3VPFA 4EFMA 2PGOA 3K32A 3QX7A 3DC7A 2O2GA 2RARA 3R3WA 3AERA 3GEDA 2CHUA 2DFVA 3W05A 1LPAB 3EVCA 2Z98A 1SKYE 2Y27A 2P6UA 3ES9A 1N5RA 1M7HA 3ORQA 3B5IA 1I0IA 4AYWA 2SICE 2VRWA 4MQBA 3ZZTA 1WPQA 4REQB 2NLOA 3AF1A 3G0CA 1U7DA 5IJZA 2BZSA 3ZK8A 4LRQA 3CUSA 1DPGA 5J1SB 2ENWA 5E4YA 1RLOA 2NOAA 5LYYA 5BV7A 5KTOA 1ZRSA 3U17A 4PX3A 1RJFA 1MIOB 3EGDB 4PAGA 3G2LA 3GJYA 3GF4A 3T3PB 4BLUA 5KTNA 3OQNA 2JCSA 3PNVA 4FEGA 4BFZA 1ABEA 4YMWA 4AYTA 3GW8A 4Y1FA 3QVTA 4LDZA 2YJTD 4Q3AA 4XCQA 1M76A 1QE5A 1T5IA 2ZRPA 3OLCX 3QFTA 3Q8WA 2YRXA 3TL3A 5KWIA 1UJ4A 2K7ZA 1KR5A 1WXEA 3QHPA 4Z4IA 2QT9A 4EI2A 4ZN6A 2EU8A 3OUTA 3CZ4A 3MPUA 4JT9A 4O3FA 4PYOA 4F21A 1M8KA 4F8EA 4TRRA 5DW0A 1GM5A 2Q49A 2WD7A 1SHTX 3BXEA 2Q3DA 5CXSA 4BZXA 4CLEA 2BMAA 2BM0A 2H4WA 4JI7B 5BNTA 5DXAA 2POQX 2WWGA 1QTQA 3KE8A 2VDOB 1N34B 1RCTE 4NZOA 4C7JA 1XVVA 3R0QA 4BZWA 3E9ZA 2F8LA 2PX6A 5FWXB 1E96A 3L4SO 4J75A 3F98A 4AZSA 4QU0A 1G5PA 1T10A 3GJTA 1UDCA 2ZB8A 3GDHA 2CXPA 1OTXA 4LC9A 4X7RA 1W5FA 1FP6A 1SD1A 3LCJA 2ZS8A 4JYPA 2QSJA 2VKQA 2ZE6A 1M5RA 4JOBA 1EGVB 1Z8DA 3KKNA 2IW3A 1G4AE 3IO5A 2CLEB 3EFOA 1FNBA 3DO5A 2OBBA 4N0MA