1E0OA

Crystal structure of a ternary fgf1-fgfr2-heparin complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
129
structure length
129
Chain Sequence
KPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBROBLAST GROWTH FACTOR 1
publication title Crystal Structure of Fibroblast Growth Factor Receptor Ectodomain Bound to Ligand and Heparin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Growth factor
total genus 22
structure length 129
sequence length 129
chains with identical sequence C
ec nomenclature
pdb deposition date 2000-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1e0oA00
2LIQA 3A23A 4IZXA 1AXMA 3NBCA 4LO3C 3TC2A 2VSEA 1OQLB 1IHKA 1IJTA 2Y9XE 1NUNA 1Z4SA 1L2HA 3NBEA 2MIBA 2QN4A 2NTDA 1BARA 1JY0A 1AVUA 5DSSB 1WBCA 3BAVA 3NBNA 3BX1C 1K5VA 3R4SA 3FJAA 1BLAA 4ZA3B 3PHZA 3V0BB 1Q04A 1JT7A 2ZQNA 1R8NA 3AH4A 3FJKA 4ZFYB 1HWOB 1W3AA 4I4QA 5F8YA 5GAQA 1JT5A 3FJEA 1D0HA 2DRZA 2Q9XA 4IY9A 3O3QA 3O4BA 1ISWA 4QALA 1V6XA 3Q7WA 3HN1A 3FJ8A 5DZUA 2DRYA 1IRPA 1II4A 3V0BA 3AJ6A 2IHOA 3FFZA 1TIEA 4EFPA 1PWAA 2NYYA 1FMMS 4OWLA 5B2HA 3AZVA 4ZBVB 1BFBA 4HR6C 2FO1A 2Q3NB 4I7IA 2WRYA 3N7JA 2F2FA 4I4RA 4HJJA 4OW4A 3FJIA 9ILBA 3BRDA 2D20A 1YYNA 3WO2A 4KEJA 3AH2A 3RSJA 1ABRB 5FNXA 4ZOTA 5JMCA 2L5XA 3RTIB 3AKFA 4LO2C 3PG0A 3S8JA 4KEKA 2F2FC 1A8DA 2VLCA 5FNWA 3E8LC 1XZZA 3A07A 3BRGC 1FN0A 3UJ0A 1DFQA 1AVAC 1HCEA 4A7YA 4OWKA 1S0DA 2D22A 2FFUA 3FGMA 3WMVA 2K8RA 2RQ9A 3FUOA 1FV2A 3UJ4A 1PC8B 1JT3A 3UD7A 4F34A 1HKNA 1G9CA 4DCKC 5EHAA 3KMVA 4G9MA 3I2AA 1P63A 1DQOA 2M49A 4I96A 3ZX7A 2E4MA 2AXMA 2MC2A 2RSTA 2QYIB 4QKSA 4ISRA 7I1BA 3BA7A 4IZEA 4QKRA 1E0OA 3O5WB 1T9FA 4IY8A 5BXTA 3EF2A 4P0JA 4GAFA 1FV3A 1AVXB 4I4PA 3HOMA 3WINA 1IOBA 4ZGRB 21BIA 3CRGA 3OGFA 3LLPA 3CA6A 3FJFA 2E4MC 3BAHA 2D7IA 4ZFWB 3ILAA 4A7KA 3FJ9A 4L4IA 3CA3A 2BEAA 1G9DA 4I6IA 4P0LA 2J3PA 3N7KA 4EEEB 3AKHA 4ENDA 3WINC 1RMLA 1IRAX 4I4YA 4GAIA 3H6SE 2IWTB 2D24A 4LO1A 1ISVA 1UPSA 2VUAA 3ZXGA 5D61A 3FJJA 3BAGA 3WMUA 3A21A 1T4QA 4EFQA 2KKIA 3CA0A 3IM6A 2NP0A 2HWAA 5I1BA 1Z2VA 4OEGA 3I2XA 5BXPA 3OGGA 4JP0A 3AZWA 1DLLA 1RG8A 4CJMA 1TFMB 4J2YA 4YOLA 4R6UB 3OJ2A 4G6JA 1KNMA 5F8WA 3VEQA 2ESUA 3OBTA 2R9KB 5HPZA 4D0ZA 3FJHA 2D43A 4XFSA 3WO4A 5BVPI 5FZUA 2ZR1B 3PMEA 1FWVA 2X2TA 4P0KA 4P6AA 4I3NA 3S8KA 4F83A 3RMYA 1FMZA 3CQAA 2FGFA 4LO7B 3HMYA 3OBRA 1QQLA 3IAGC 5EG6C 3ZC8A 4JAWA 3IIRA 4XFTA 3V0AB 2AQZA 2XOAA 4Q9GA 3UD8A 3MPPG 3JRRA 4FVVA 2UUSA 3POKA 3LTQA 4ISQA 2Z49A 2MLLB 3P6JA 4Q91A 1DFCA 4I2SA 2AFGA 1CVSA 1XG6A 1JLYA 3O4CA 3AH1A 2F8XC 4OWJA 4X38A 3IM7A 4EB2B 4H9WA 1DJSB 4KEIA 1EVTA 5BQUA 6I1BA 3HSMA 1S0BA 1PUMB 1S0EA 1Q1UA 1YXWA 3V0AA 4GOVA 1G82A 4LO0A 4J2XA 1DZDA 3D7WB 3PUBA 1SR4A 3O4AA 3CA5A 4GOYA 4LO8B 4QD2B 1M2TB 2D7RA 5BXSA 4D0TA 2DREA 1ILR1 1WD4A 3H6RB 1FQ9A 1S0CA 4JPZA 5FZYA 1G9AA 4DENA 3CA1A 2LIEA 1Z0HA 2Y9WC 3Q7YA 2I1BA 4LO0C 4KBBA 3CU1B 2Z48A 4ZFUB 5DVHA 1SR4C 5D63A 4OUJA 3A22A 3N7MA 1AFCA 1XHBA 2NM1A 3C9ZA 1N4KA 3ZXDA 3B9UA 1J0SA 1V6WA 3CA4A 4JRAA 3FUQA 1NZKA 1DQGA 2D44A 3CRIA 4I1EA 4XKIA 1AF9A 4IYBA 1M16A 3H6RA 1S0LA 3UDAA 4EKXB 1FWUA 4II0A 1DZCA 3VSZA 3K1XA 3IM5A 1HWPB 3HBWA 1I1EA 2ET2A 2YUGA 2WBCA 3NBDA 4I37A 4DEPA 1JTCA 3Q7XA 4G9NA 4WBCA 5E24E 4GP0A 2FFVA 3RTJB 4Q9PA 2D23A 1F31A 3O49A 4LO3A 3VUOA 3I29B 2HW9A 4I1BA 4LO1C 4ZLBB 1TOOA 1ONKB 4I4UA 4JKQA 4GP3A 1MD6A 2KH2A 2VXRA 2ZQOA 4H04A 1QXMA 1SZ6B 4IQPA 2Y9FA 4L4HA 4JQ0A 3BRFA 4I4SA 4USPA 4ZKTB 2ERMA 1EYLA 3RMXA 1HCDA 1S0FA 1V6UA 3FJDA 1BLDA 2FDBM 4JKXB 1W3GA 1BA7A 1MC9A 3W9TA 2KLLA 1CE7B 3R4UA 1JT4A 3O4OA 1YF8B 1TWMA 3H6QA 4QBVA 1PZZA 1VCLA 4QO3A 5FZZA 3FJBA 2DS0A 1TTUA 1PUUB 2GO2A 3AKIA 1ISZA 3BA4A 3T8SA 1ISYA 2HWMA 1IILA 4TLPA 2X2SA 4X37A 2K4AB 3BADA 2D1ZA 2GZBA 3QR5A 1FGAA 4X39A 3FJCA 1I1BA 4J2KA 4X3AA 3HALA 4HA2A 3WA1A 1HWNB 2P23A 4J2SA 1TWEA 4I4OA 3WO3A 1V6VA 3O44A 3JUTA 31BIA 4OEEA 4LO2A 3VT1A 4Z8SB 4G1RA 3BAOA 1WD3A 3CAHA 3CRHA 4USOA 4J23B 2VSAA 41BIA 2NZ9A 1YTOA 3BTAA 3VT0A 1S0GA 4A7ZA 4D8HA 3F1RA 5G00A 1RZOB 4IONA 3QYDA 1EPWA 5BOWA 1Q03A 1HWMB 2Y9GA 4LO7C 4XFUA 5BQUC 1ISXA 3N0KA 4Z9WB 3P53A 4QBCA 3F62B 4OEFA 2NVHA 1BFCA 1W3FA 4IHZA 1YBIA 3BB2A 2HZ9A 4G6MA 1AVWB 1DIWA 4I8MA 5JLVA 3VSFA 1TP0A 3P6IA 4I4VA 4QC4A 3UD9A 1GGPB 3N7LA 1JLXA 1WBAA 3OJVA 3SNVA 1K5UA 1RY7A 4I4XA 1JQZA 3BAQA 4AN6A 5DUYA 8I1BA 2RG9B 5F8SA 2AAIB 5BP5A 3VWCA 3BAUA 2VU9A 4FGFA 3V79C 2VXTI 1BASA 4QD2C 1BFFA 3ZC9A 1QQKA 2KI6B 4KC3A 3VT2A 2K43A 4PC4A 1G9BA 1EV2A 3OJMA 4EFRA 3MALA 1HIBA 1XYFA 5BP5C 3AKGA 2KI4A 3BA5A 2P39A 5F90A 5BXRA 4I0YA 4AN7B 2BFHA 1BFGA 2BEBA 5D62A 1ITBA 3NJ5A 5EC5A 3AJ5A 3O4DA 1IT0A 1R8OA
chains in the Genus database with same CATH superfamily
4MZFB 2LIQA 3A23A 4IZXA 1AXMA 3NBCA 4LO3C 3TC2A 2VSEA 1OQLB 1IHKA 1IJTA 2Y9XE 1NUNA 1Z4SA 1L2HA 3NBEA 2MIBA 2QN4A 2NTDA 1BARA 1JY0A 1AVUA 5DSSB 1WBCA 3BAVA 3NBNA 3BX1C 1K5VA 3R4SA 3FJAA 1BLAA 4ZA3B 3PHZA 3V0BB 1Q04A 1JT7A 2ZQNA 1R8NA 3AH4A 3FJKA 4ZFYB 1HWOB 1W3AA 4I4QA 5F8YA 5GAQA 1JT5A 3FJEA 1D0HA 2DRZA 2Q9XA 4IY9A 3O3QA 3O4BA 1ISWA 4QALA 1V6XA 3Q7WA 3HN1A 3FJ8A 5DZUA 2DRYA 1IRPA 1II4A 3V0BA 3AJ6A 2IHOA 3FFZA 1TIEA 4EFPA 1PWAA 2NYYA 1FMMS 4OWLA 5B2HA 3AZVA 4ZBVB 1BFBA 4HR6C 2FO1A 2Q3NB 4I7IA 2WRYA 3N7JA 2F2FA 2NS2A 4I4RA 4HJJA 4OW4A 3FJIA 9ILBA 3BRDA 2D20A 1YYNA 3WO2A 4KEJA 3AH2A 3RSJA 1ABRB 5FNXA 4ZOTA 5JMCA 2L5XA 3RTIB 3AKFA 4LO2C 3PG0A 3S8JA 4KEKA 2F2FC 1A8DA 2VLCA 5FNWA 3E8LC 1XZZA 3A07A 3BRGC 1FN0A 3UJ0A 1DFQA 1AVAC 4MZHA 1HCEA 4A7YA 4OWKA 1S0DA 2D22A 2FFUA 3FGMA 3WMVA 2K8RA 2RQ9A 3FUOA 1FV2A 3UJ4A 1PC8B 1JT3A 3UD7A 4F34A 1HKNA 1G9CA 4DCKC 5EHAA 3KMVA 4G9MA 3I2AA 1P63A 1DQOA 2M49A 4I96A 3ZX7A 2E4MA 4UY4A 2AXMA 2MC2A 2RSTA 2QYIB 4QKSA 4ISRA 7I1BA 3BA7A 4IZEA 4QKRA 1E0OA 3O5WB 1T9FA 4IY8A 5BXTA 3EF2A 4P0JA 4GAFA 1FV3A 1AVXB 4I4PA 3HOMA 3WINA 1IOBA 4ZGRB 21BIA 3CRGA 3OGFA 3LLPA 3CA6A 3FJFA 2E4MC 3BAHA 2D7IA 4ZFWB 3ILAA 4A7KA 3FJ9A 4L4IA 3CA3A 2BEAA 1G9DA 4I6IA 4P0LA 2J3PA 3N7KA 4EEEB 3AKHA 4ENDA 3WINC 1RMLA 1IRAX 4I4YA 4GAIA 3H6SE 2IWTB 2D24A 4LO1A 1ISVA 1UPSA 2VUAA 3ZXGA 5D61A 3FJJA 3BAGA 3WMUA 3A21A 1T4QA 4EFQA 2KKIA 3CA0A 3IM6A 2NP0A 2HWAA 5I1BA 1Z2VA 4OEGA 3I2XA 5BXPA 3OGGA 4JP0A 3AZWA 1DLLA 1RG8A 4CJMA 1TFMB 4J2YA 4YOLA 4R6UB 3OJ2A 4G6JA 1KNMA 5F8WA 3VEQA 2ESUA 3OBTA 2R9KB 5HPZA 4D0ZA 3FJHA 2D43A 4XFSA 3WO4A 5BVPI 5FZUA 2ZR1B 3PMEA 1FWVA 2X2TA 4P0KA 4P6AA 4I3NA 3S8KA 4F83A 3RMYA 1FMZA 3CQAA 2FGFA 4LO7B 3HMYA 3OBRA 1QQLA 3IAGC 5EG6C 3ZC8A 4JAWA 3IIRA 4XFTA 3V0AB 2AQZA 2XOAA 4Q9GA 3UD8A 3MPPG 3JRRA 4FVVA 2UUSA 3POKA 3LTQA 4ISQA 2Z49A 2MLLB 3P6JA 4Q91A 1DFCA 4I2SA 2AFGA 1CVSA 1XG6A 1JLYA 3O4CA 3AH1A 2F8XC 4OWJA 4X38A 3IM7A 4EB2B 4H9WA 1DJSB 4KEIA 1EVTA 5BQUA 6I1BA 3HSMA 1S0BA 1PUMB 1S0EA 1Q1UA 1YXWA 3V0AA 4GOVA 1G82A 4LO0A 4J2XA 1DZDA 3D7WB 3PUBA 1SR4A 3O4AA 3CA5A 4GOYA 4LO8B 4QD2B 1M2TB 2D7RA 5BXSA 4D0TA 2DREA 1ILR1 1WD4A 3H6RB 1FQ9A 1S0CA 4JPZA 5FZYA 1G9AA 4DENA 3CA1A 2LIEA 1Z0HA 2Y9WC 3Q7YA 2I1BA 4LO0C 4KBBA 3CU1B 2Z48A 4ZFUB 5DVHA 1SR4C 5D63A 4OUJA 3A22A 3N7MA 1AFCA 1XHBA 2NM1A 3C9ZA 1N4KA 3ZXDA 3B9UA 1J0SA 1V6WA 3CA4A 4JRAA 3FUQA 1NZKA 1DQGA 2D44A 3CRIA 4I1EA 4XKIA 1AF9A 4IYBA 1M16A 3H6RA 1S0LA 3UDAA 4EKXB 1FWUA 4II0A 1DZCA 3VSZA 3K1XA 3IM5A 1HWPB 3HBWA 1I1EA 2ET2A 2YUGA 2WBCA 3NBDA 4I37A 4DEPA 1JTCA 3Q7XA 4G9NA 4WBCA 5E24E 4GP0A 2FFVA 3RTJB 4Q9PA 2D23A 1F31A 3O49A 4LO3A 4MZGB 3VUOA 3I29B 2HW9A 4I1BA 4LO1C 4ZLBB 1TOOA 1ONKB 4I4UA 4JKQA 4GP3A 1MD6A 2KH2A 2VXRA 2ZQOA 4H04A 1QXMA 1SZ6B 4IQPA 2Y9FA 4L4HA 4JQ0A 3BRFA 4I4SA 4USPA 4ZKTB 2ERMA 1EYLA 3RMXA 1HCDA 1S0FA 1V6UA 3FJDA 1BLDA 2FDBM 4JKXB 1W3GA 1BA7A 1MC9A 3W9TA 2KLLA 1CE7B 3R4UA 1JT4A 3O4OA 1YF8B 1TWMA 3H6QA 4QBVA 1PZZA 1VCLA 4QO3A 5FZZA 3FJBA 2DS0A 1TTUA 1PUUB 2GO2A 3AKIA 1ISZA 3BA4A 3T8SA 1ISYA 2HWMA 1IILA 4TLPA 2X2SA 4X37A 2K4AB 3BADA 2D1ZA 2GZBA 3QR5A 1FGAA 4X39A 3FJCA 1I1BA 4J2KA 4X3AA 3HALA 4HA2A 3WA1A 1HWNB 2P23A 4J2SA 1TWEA 4I4OA 3WO3A 1V6VA 3O44A 3JUTA 31BIA 4OEEA 4LO2A 3VT1A 4H75A 4Z8SB 4G1RA 3BAOA 1WD3A 3CAHA 3CRHA 4USOA 4J23B 2VSAA 41BIA 2NZ9A 1YTOA 3BTAA 3VT0A 1S0GA 4A7ZA 4D8HA 3F1RA 5G00A 1RZOB 4IONA 3QYDA 1EPWA 5BOWA 1Q03A 1HWMB 2Y9GA 4LO7C 4XFUA 5BQUC 1ISXA 3N0KA 4Z9WB 3P53A 4QBCA 3F62B 4OEFA 2NVHA 1BFCA 1W3FA 4IHZA 1YBIA 3BB2A 2HZ9A 4G6MA 1AVWB 1DIWA 4I8MA 5JLVA 3VSFA 1TP0A 3P6IA 4I4VA 4QC4A 3UD9A 1GGPB 3N7LA 1JLXA 1WBAA 3OJVA 3SNVA 1K5UA 1RY7A 4I4XA 1JQZA 3BAQA 4AN6A 5DUYA 8I1BA 2RG9B 5F8SA 2AAIB 5BP5A 3VWCA 3BAUA 2VU9A 4FGFA 3V79C 2VXTI 1BASA 4QD2C 1BFFA 3ZC9A 1QQKA 2KI6B 4KC3A 3VT2A 2K43A 4PC4A 1G9BA 1EV2A 3OJMA 4EFRA 3MALA 1HIBA 1XYFA 5BP5C 3AKGA 2KI4A 3BA5A 2P39A 5F90A 5BXRA 4I0YA 4AN7B 2BFHA 1BFGA 2BEBA 5D62A 1ITBA 3NJ5A 5EC5A 3AJ5A 3O4DA 1IT0A 1R8OA
chains in the Genus database with same CATH topology
4MZFB 2LIQA 3A23A 4IZXA 1AXMA 3NBCA 4LO3C 3TC2A 2VSEA 1OQLB 1IHKA 1IJTA 2Y9XE 1NUNA 1Z4SA 1L2HA 3NBEA 2MIBA 2QN4A 2NTDA 1BARA 1JY0A 1AVUA 5DSSB 1WBCA 3BAVA 3NBNA 3BX1C 1K5VA 3R4SA 3FJAA 1BLAA 4ZA3B 3PHZA 3V0BB 1Q04A 1JT7A 2ZQNA 1R8NA 3AH4A 3FJKA 4ZFYB 1HWOB 1W3AA 4I4QA 5F8YA 5GAQA 1JT5A 3FJEA 1D0HA 2DRZA 2Q9XA 4IY9A 3O3QA 3O4BA 1ISWA 4QALA 1V6XA 3Q7WA 3HN1A 3FJ8A 5DZUA 2DRYA 1IRPA 1II4A 3V0BA 3AJ6A 2IHOA 3FFZA 1TIEA 4EFPA 1PWAA 2NYYA 1FMMS 4OWLA 5B2HA 3AZVA 4ZBVB 1BFBA 4HR6C 2FO1A 2Q3NB 4I7IA 2WRYA 3N7JA 2F2FA 2NS2A 4I4RA 4HJJA 4OW4A 3FJIA 9ILBA 3BRDA 2D20A 1YYNA 3WO2A 4KEJA 3AH2A 3RSJA 1ABRB 5FNXA 4ZOTA 5JMCA 2L5XA 3RTIB 3AKFA 4LO2C 3PG0A 3S8JA 4KEKA 2F2FC 1A8DA 2VLCA 5FNWA 3E8LC 1XZZA 3A07A 3BRGC 1FN0A 3UJ0A 1DFQA 1AVAC 4MZHA 1HCEA 4A7YA 4OWKA 1S0DA 2D22A 2FFUA 3FGMA 3WMVA 2K8RA 2RQ9A 3FUOA 1FV2A 3UJ4A 1PC8B 1JT3A 3UD7A 4F34A 1HKNA 1G9CA 4DCKC 5EHAA 3KMVA 4G9MA 3I2AA 1P63A 1DQOA 2M49A 4I96A 3ZX7A 2E4MA 4UY4A 2AXMA 2MC2A 2RSTA 2QYIB 4QKSA 4ISRA 7I1BA 3BA7A 4IZEA 4QKRA 1E0OA 3O5WB 1T9FA 4IY8A 5BXTA 3EF2A 4P0JA 4GAFA 1FV3A 1AVXB 4I4PA 3HOMA 3WINA 1IOBA 4ZGRB 21BIA 3CRGA 3OGFA 3LLPA 3CA6A 3FJFA 2E4MC 3BAHA 2D7IA 4ZFWB 3ILAA 4A7KA 3FJ9A 4L4IA 3CA3A 2BEAA 1G9DA 4I6IA 4P0LA 2J3PA 3N7KA 4EEEB 3AKHA 4ENDA 3WINC 1RMLA 1IRAX 4I4YA 4GAIA 3H6SE 2IWTB 2D24A 4LO1A 1ISVA 1UPSA 2VUAA 3ZXGA 5D61A 3FJJA 3BAGA 3WMUA 3A21A 1T4QA 4EFQA 2KKIA 3CA0A 3IM6A 2NP0A 2HWAA 5I1BA 1Z2VA 4OEGA 3I2XA 5BXPA 3OGGA 4JP0A 3AZWA 1DLLA 1RG8A 4CJMA 1TFMB 4J2YA 4YOLA 4R6UB 3OJ2A 4G6JA 1KNMA 5F8WA 3VEQA 2ESUA 3OBTA 2R9KB 5HPZA 4D0ZA 3FJHA 2D43A 4XFSA 3WO4A 5BVPI 5FZUA 2ZR1B 3PMEA 1FWVA 2X2TA 4P0KA 4P6AA 4I3NA 3S8KA 4F83A 3RMYA 1FMZA 3CQAA 2FGFA 4LO7B 3HMYA 3OBRA 1QQLA 3IAGC 5EG6C 3ZC8A 4JAWA 3IIRA 4XFTA 3V0AB 2AQZA 2XOAA 4Q9GA 3UD8A 3MPPG 3JRRA 4FVVA 2UUSA 3POKA 3LTQA 4ISQA 2Z49A 2MLLB 3P6JA 4Q91A 1DFCA 4I2SA 2AFGA 1CVSA 1XG6A 1JLYA 3O4CA 3AH1A 2F8XC 4OWJA 4X38A 3IM7A 4EB2B 4H9WA 1DJSB 4KEIA 1EVTA 5BQUA 6I1BA 3HSMA 1S0BA 1PUMB 1S0EA 1Q1UA 1YXWA 3V0AA 4GOVA 1G82A 4LO0A 4J2XA 1DZDA 3D7WB 3PUBA 1SR4A 3O4AA 3CA5A 4GOYA 4LO8B 4QD2B 1M2TB 2D7RA 5BXSA 4D0TA 2DREA 1ILR1 1WD4A 3H6RB 1FQ9A 1S0CA 4JPZA 5FZYA 1G9AA 4DENA 3CA1A 2LIEA 1Z0HA 2Y9WC 3Q7YA 2I1BA 4LO0C 4KBBA 3CU1B 2Z48A 4ZFUB 5DVHA 1SR4C 5D63A 4OUJA 3A22A 3N7MA 1AFCA 1XHBA 2NM1A 3C9ZA 1N4KA 3ZXDA 3B9UA 1J0SA 1V6WA 3CA4A 4JRAA 3FUQA 1NZKA 1DQGA 2D44A 3CRIA 4I1EA 4XKIA 1AF9A 4IYBA 1M16A 3H6RA 1S0LA 3UDAA 4EKXB 1FWUA 4II0A 1DZCA 3VSZA 3K1XA 3IM5A 1HWPB 3HBWA 1I1EA 2ET2A 2YUGA 2WBCA 3NBDA 4I37A 4DEPA 1JTCA 3Q7XA 4G9NA 4WBCA 5E24E 4GP0A 2FFVA 3RTJB 4Q9PA 2D23A 1F31A 3O49A 4LO3A 4MZGB 3VUOA 3I29B 2HW9A 4I1BA 4LO1C 4ZLBB 1TOOA 1ONKB 4I4UA 4JKQA 4GP3A 1MD6A 2KH2A 2VXRA 2ZQOA 4H04A 1QXMA 1SZ6B 4IQPA 2Y9FA 4L4HA 4JQ0A 3BRFA 4I4SA 4USPA 4ZKTB 2ERMA 1EYLA 3RMXA 1HCDA 1S0FA 1V6UA 3FJDA 1BLDA 2FDBM 4JKXB 1W3GA 1BA7A 1MC9A 3W9TA 2KLLA 1CE7B 3R4UA 1JT4A 3O4OA 1YF8B 1TWMA 3H6QA 4QBVA 1PZZA 1VCLA 4QO3A 5FZZA 3FJBA 2DS0A 1TTUA 1PUUB 2GO2A 3AKIA 1ISZA 3BA4A 3T8SA 1ISYA 2HWMA 1IILA 4TLPA 2X2SA 4X37A 2K4AB 3BADA 2D1ZA 2GZBA 3QR5A 1FGAA 4X39A 3FJCA 1I1BA 4J2KA 4X3AA 3HALA 4HA2A 3WA1A 1HWNB 2P23A 4J2SA 1TWEA 4I4OA 3WO3A 1V6VA 3O44A 3JUTA 31BIA 4OEEA 4LO2A 3VT1A 4H75A 4Z8SB 4G1RA 3BAOA 1WD3A 3CAHA 3CRHA 4USOA 4J23B 2VSAA 41BIA 2NZ9A 1YTOA 3BTAA 3VT0A 1S0GA 4A7ZA 4D8HA 3F1RA 5G00A 1RZOB 4IONA 3QYDA 1EPWA 5BOWA 1Q03A 1HWMB 2Y9GA 4LO7C 4XFUA 5BQUC 1ISXA 3N0KA 4Z9WB 3P53A 4QBCA 3F62B 4OEFA 2NVHA 1BFCA 1W3FA 4IHZA 1YBIA 3BB2A 2HZ9A 4G6MA 1AVWB 1DIWA 4I8MA 5JLVA 3VSFA 1TP0A 3P6IA 4I4VA 4QC4A 3UD9A 1GGPB 3N7LA 1JLXA 1WBAA 3OJVA 3SNVA 1K5UA 1RY7A 4I4XA 1JQZA 3BAQA 4AN6A 5DUYA 8I1BA 2RG9B 5F8SA 2AAIB 5BP5A 3VWCA 3BAUA 2VU9A 4FGFA 3V79C 2VXTI 1BASA 4QD2C 1BFFA 3ZC9A 1QQKA 2KI6B 4KC3A 3VT2A 2K43A 4PC4A 1G9BA 1EV2A 3OJMA 4EFRA 3MALA 1HIBA 1XYFA 5BP5C 3AKGA 2KI4A 3BA5A 2P39A 5F90A 5BXRA 4I0YA 4AN7B 2BFHA 1BFGA 2BEBA 5D62A 1ITBA 3NJ5A 5EC5A 3AJ5A 3O4DA 1IT0A 1R8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LIQ A;  3A23 A;  4IZX A;  1AXM A;  3NBC A;  4LO3 C;  3TC2 A;  2VSE A;  1OQL B;  1IHK A;  1IJT A;  2Y9X E;  1NUN A;  1Z4S A;  1L2H A;  3NBE A;  2MIB A;  2QN4 A;  2NTD A;  1BAR A;  1JY0 A;  1AVU A;  5DSS B;  1WBC A;  3BAV A;  3NBN A;  3BX1 C;  1K5V A;  3R4S A;  3FJA A;  1BLA A;  4ZA3 B;  3PHZ A;  3V0B B;  1Q04 A;  1JT7 A;  2ZQN A;  1R8N A;  3AH4 A;  3FJK A;  4ZFY B;  1HWO B;  1W3A A;  4I4Q A;  5F8Y A;  5GAQ A;  1JT5 A;  3FJE A;  1D0H A;  2DRZ A;  2Q9X A;  4IY9 A;  3O3Q A;  3O4B A;  1ISW A;  4QAL A;  1V6X A;  3Q7W A;  3HN1 A;  3FJ8 A;  5DZU A;  2DRY A;  1IRP A;  1II4 A;  3V0B A;  3AJ6 A;  2IHO A;  3FFZ A;  1TIE A;  4EFP A;  1PWA A;  2NYY A;  1FMM S;  4OWL A;  5B2H A;  3AZV A;  4ZBV B;  1BFB A;  4HR6 C;  2FO1 A;  2Q3N B;  4I7I A;  2WRY A;  3N7J A;  2F2F A;  4I4R A;  4HJJ A;  4OW4 A;  3FJI A;  9ILB A;  3BRD A;  2D20 A;  1YYN A;  3WO2 A;  4KEJ A;  3AH2 A;  3RSJ A;  1ABR B;  5FNX A;  4ZOT A;  5JMC A;  2L5X A;  3RTI B;  3AKF A;  4LO2 C;  3PG0 A;  3S8J A;  4KEK A;  2F2F C;  1A8D A;  2VLC A;  5FNW A;  3E8L C;  1XZZ A;  3A07 A;  3BRG C;  1FN0 A;  3UJ0 A;  1DFQ A;  1AVA C;  1HCE A;  4A7Y A;  4OWK A;  1S0D A;  2D22 A;  2FFU A;  3FGM A;  3WMV A;  2K8R A;  2RQ9 A;  3FUO A;  1FV2 A;  3UJ4 A;  1PC8 B;  1JT3 A;  3UD7 A;  4F34 A;  1HKN A;  1G9C A;  4DCK C;  5EHA A;  3KMV A;  4G9M A;  3I2A A;  1P63 A;  1DQO A;  2M49 A;  4I96 A;  3ZX7 A;  2E4M A;  2AXM A;  2MC2 A;  2RST A;  2QYI B;  4QKS A;  4ISR A;  7I1B A;  3BA7 A;  4IZE A;  4QKR A;  1E0O A;  3O5W B;  1T9F A;  4IY8 A;  5BXT A;  3EF2 A;  4P0J A;  4GAF A;  1FV3 A;  1AVX B;  4I4P A;  3HOM A;  3WIN A;  1IOB A;  4ZGR B;  21BI A;  3CRG A;  3OGF A;  3LLP A;  3CA6 A;  3FJF A;  2E4M C;  3BAH A;  2D7I A;  4ZFW B;  3ILA A;  4A7K A;  3FJ9 A;  4L4I A;  3CA3 A;  2BEA A;  1G9D A;  4I6I A;  4P0L A;  2J3P A;  3N7K A;  4EEE B;  3AKH A;  4END A;  3WIN C;  1RML A;  1IRA X;  4I4Y A;  4GAI A;  3H6S E;  2IWT B;  2D24 A;  4LO1 A;  1ISV A;  1UPS A;  2VUA A;  3ZXG A;  5D61 A;  3FJJ A;  3BAG A;  3WMU A;  3A21 A;  1T4Q A;  4EFQ A;  2KKI A;  3CA0 A;  3IM6 A;  2NP0 A;  2HWA A;  5I1B A;  1Z2V A;  4OEG A;  3I2X A;  5BXP A;  3OGG A;  4JP0 A;  3AZW A;  1DLL A;  1RG8 A;  4CJM A;  1TFM B;  4J2Y A;  4YOL A;  4R6U B;  3OJ2 A;  4G6J A;  1KNM A;  5F8W A;  3VEQ A;  2ESU A;  3OBT A;  2R9K B;  5HPZ A;  4D0Z A;  3FJH A;  2D43 A;  4XFS A;  3WO4 A;  5BVP I;  5FZU A;  2ZR1 B;  3PME A;  1FWV A;  2X2T A;  4P0K A;  4P6A A;  4I3N A;  3S8K A;  4F83 A;  3RMY A;  1FMZ A;  3CQA A;  2FGF A;  4LO7 B;  3HMY A;  3OBR A;  1QQL A;  3IAG C;  5EG6 C;  3ZC8 A;  4JAW A;  3IIR A;  4XFT A;  3V0A B;  2AQZ A;  2XOA A;  4Q9G A;  3UD8 A;  3MPP G;  3JRR A;  4FVV A;  2UUS A;  3POK A;  3LTQ A;  4ISQ A;  2Z49 A;  2MLL B;  3P6J A;  4Q91 A;  1DFC A;  4I2S A;  2AFG A;  1CVS A;  1XG6 A;  1JLY A;  3O4C A;  3AH1 A;  2F8X C;  4OWJ A;  4X38 A;  3IM7 A;  4EB2 B;  4H9W A;  1DJS B;  4KEI A;  1EVT A;  5BQU A;  6I1B A;  3HSM A;  1S0B A;  1PUM B;  1S0E A;  1Q1U A;  1YXW A;  3V0A A;  4GOV A;  1G82 A;  4LO0 A;  4J2X A;  1DZD A;  3D7W B;  3PUB A;  1SR4 A;  3O4A A;  3CA5 A;  4GOY A;  4LO8 B;  4QD2 B;  1M2T B;  2D7R A;  5BXS A;  4D0T A;  2DRE A;  1ILR 1;  1WD4 A;  3H6R B;  1FQ9 A;  1S0C A;  4JPZ A;  5FZY A;  1G9A A;  4DEN A;  3CA1 A;  2LIE A;  1Z0H A;  2Y9W C;  3Q7Y A;  2I1B A;  4LO0 C;  4KBB A;  3CU1 B;  2Z48 A;  4ZFU B;  5DVH A;  1SR4 C;  5D63 A;  4OUJ A;  3A22 A;  3N7M A;  1AFC A;  1XHB A;  2NM1 A;  3C9Z A;  1N4K A;  3ZXD A;  3B9U A;  1J0S A;  1V6W A;  3CA4 A;  4JRA A;  3FUQ A;  1NZK A;  1DQG A;  2D44 A;  3CRI A;  4I1E A;  4XKI A;  1AF9 A;  4IYB A;  1M16 A;  3H6R A;  1S0L A;  3UDA A;  4EKX B;  1FWU A;  4II0 A;  1DZC A;  3VSZ A;  3K1X A;  3IM5 A;  1HWP B;  3HBW A;  1I1E A;  2ET2 A;  2YUG A;  2WBC A;  3NBD A;  4I37 A;  4DEP A;  1JTC A;  3Q7X A;  4G9N A;  4WBC A;  5E24 E;  4GP0 A;  2FFV A;  3RTJ B;  4Q9P A;  2D23 A;  1F31 A;  3O49 A;  4LO3 A;  3VUO A;  3I29 B;  2HW9 A;  4I1B A;  4LO1 C;  4ZLB B;  1TOO A;  1ONK B;  4I4U A;  4JKQ A;  4GP3 A;  1MD6 A;  2KH2 A;  2VXR A;  2ZQO A;  4H04 A;  1QXM A;  1SZ6 B;  4IQP A;  2Y9F A;  4L4H A;  4JQ0 A;  3BRF A;  4I4S A;  4USP A;  4ZKT B;  2ERM A;  1EYL A;  3RMX A;  1HCD A;  1S0F A;  1V6U A;  3FJD A;  1BLD A;  2FDB M;  4JKX B;  1W3G A;  1BA7 A;  1MC9 A;  3W9T A;  2KLL A;  1CE7 B;  3R4U A;  1JT4 A;  3O4O A;  1YF8 B;  1TWM A;  3H6Q A;  4QBV A;  1PZZ A;  1VCL A;  4QO3 A;  5FZZ A;  3FJB A;  2DS0 A;  1TTU A;  1PUU B;  2GO2 A;  3AKI A;  1ISZ A;  3BA4 A;  3T8S A;  1ISY A;  2HWM A;  1IIL A;  4TLP A;  2X2S A;  4X37 A;  2K4A B;  3BAD A;  2D1Z A;  2GZB A;  3QR5 A;  1FGA A;  4X39 A;  3FJC A;  1I1B A;  4J2K A;  4X3A A;  3HAL A;  4HA2 A;  3WA1 A;  1HWN B;  2P23 A;  4J2S A;  1TWE A;  4I4O A;  3WO3 A;  1V6V A;  3O44 A;  3JUT A;  31BI A;  4OEE A;  4LO2 A;  3VT1 A;  4Z8S B;  4G1R A;  3BAO A;  1WD3 A;  3CAH A;  3CRH A;  4USO A;  4J23 B;  2VSA A;  41BI A;  2NZ9 A;  1YTO A;  3BTA A;  3VT0 A;  1S0G A;  4A7Z A;  4D8H A;  3F1R A;  5G00 A;  1RZO B;  4ION A;  3QYD A;  1EPW A;  5BOW A;  1Q03 A;  1HWM B;  2Y9G A;  4LO7 C;  4XFU A;  5BQU C;  1ISX A;  3N0K A;  4Z9W B;  3P53 A;  4QBC A;  3F62 B;  4OEF A;  2NVH A;  1BFC A;  1W3F A;  4IHZ A;  1YBI A;  3BB2 A;  2HZ9 A;  4G6M A;  1AVW B;  1DIW A;  4I8M A;  5JLV A;  3VSF A;  1TP0 A;  3P6I A;  4I4V A;  4QC4 A;  3UD9 A;  1GGP B;  3N7L A;  1JLX A;  1WBA A;  3OJV A;  3SNV A;  1K5U A;  1RY7 A;  4I4X A;  1JQZ A;  3BAQ A;  4AN6 A;  5DUY A;  8I1B A;  2RG9 B;  5F8S A;  2AAI B;  5BP5 A;  3VWC A;  3BAU A;  2VU9 A;  4FGF A;  3V79 C;  2VXT I;  1BAS A;  4QD2 C;  1BFF A;  3ZC9 A;  1QQK A;  2KI6 B;  4KC3 A;  3VT2 A;  2K43 A;  4PC4 A;  1G9B A;  1EV2 A;  3OJM A;  4EFR A;  3MAL A;  1HIB A;  1XYF A;  5BP5 C;  3AKG A;  2KI4 A;  3BA5 A;  2P39 A;  5F90 A;  5BXR A;  4I0Y A;  4AN7 B;  2BFH A;  1BFG A;  2BEB A;  5D62 A;  1ITB A;  3NJ5 A;  5EC5 A;  3AJ5 A;  3O4D A;  1IT0 A;  1R8O A; 
#chains in the Genus database with same CATH topology
 4MZF B;  2LIQ A;  3A23 A;  4IZX A;  1AXM A;  3NBC A;  4LO3 C;  3TC2 A;  2VSE A;  1OQL B;  1IHK A;  1IJT A;  2Y9X E;  1NUN A;  1Z4S A;  1L2H A;  3NBE A;  2MIB A;  2QN4 A;  2NTD A;  1BAR A;  1JY0 A;  1AVU A;  5DSS B;  1WBC A;  3BAV A;  3NBN A;  3BX1 C;  1K5V A;  3R4S A;  3FJA A;  1BLA A;  4ZA3 B;  3PHZ A;  3V0B B;  1Q04 A;  1JT7 A;  2ZQN A;  1R8N A;  3AH4 A;  3FJK A;  4ZFY B;  1HWO B;  1W3A A;  4I4Q A;  5F8Y A;  5GAQ A;  1JT5 A;  3FJE A;  1D0H A;  2DRZ A;  2Q9X A;  4IY9 A;  3O3Q A;  3O4B A;  1ISW A;  4QAL A;  1V6X A;  3Q7W A;  3HN1 A;  3FJ8 A;  5DZU A;  2DRY A;  1IRP A;  1II4 A;  3V0B A;  3AJ6 A;  2IHO A;  3FFZ A;  1TIE A;  4EFP A;  1PWA A;  2NYY A;  1FMM S;  4OWL A;  5B2H A;  3AZV A;  4ZBV B;  1BFB A;  4HR6 C;  2FO1 A;  2Q3N B;  4I7I A;  2WRY A;  3N7J A;  2F2F A;  2NS2 A;  4I4R A;  4HJJ A;  4OW4 A;  3FJI A;  9ILB A;  3BRD A;  2D20 A;  1YYN A;  3WO2 A;  4KEJ A;  3AH2 A;  3RSJ A;  1ABR B;  5FNX A;  4ZOT A;  5JMC A;  2L5X A;  3RTI B;  3AKF A;  4LO2 C;  3PG0 A;  3S8J A;  4KEK A;  2F2F C;  1A8D A;  2VLC A;  5FNW A;  3E8L C;  1XZZ A;  3A07 A;  3BRG C;  1FN0 A;  3UJ0 A;  1DFQ A;  1AVA C;  4MZH A;  1HCE A;  4A7Y A;  4OWK A;  1S0D A;  2D22 A;  2FFU A;  3FGM A;  3WMV A;  2K8R A;  2RQ9 A;  3FUO A;  1FV2 A;  3UJ4 A;  1PC8 B;  1JT3 A;  3UD7 A;  4F34 A;  1HKN A;  1G9C A;  4DCK C;  5EHA A;  3KMV A;  4G9M A;  3I2A A;  1P63 A;  1DQO A;  2M49 A;  4I96 A;  3ZX7 A;  2E4M A;  4UY4 A;  2AXM A;  2MC2 A;  2RST A;  2QYI B;  4QKS A;  4ISR A;  7I1B A;  3BA7 A;  4IZE A;  4QKR A;  1E0O A;  3O5W B;  1T9F A;  4IY8 A;  5BXT A;  3EF2 A;  4P0J A;  4GAF A;  1FV3 A;  1AVX B;  4I4P A;  3HOM A;  3WIN A;  1IOB A;  4ZGR B;  21BI A;  3CRG A;  3OGF A;  3LLP A;  3CA6 A;  3FJF A;  2E4M C;  3BAH A;  2D7I A;  4ZFW B;  3ILA A;  4A7K A;  3FJ9 A;  4L4I A;  3CA3 A;  2BEA A;  1G9D A;  4I6I A;  4P0L A;  2J3P A;  3N7K A;  4EEE B;  3AKH A;  4END A;  3WIN C;  1RML A;  1IRA X;  4I4Y A;  4GAI A;  3H6S E;  2IWT B;  2D24 A;  4LO1 A;  1ISV A;  1UPS A;  2VUA A;  3ZXG A;  5D61 A;  3FJJ A;  3BAG A;  3WMU A;  3A21 A;  1T4Q A;  4EFQ A;  2KKI A;  3CA0 A;  3IM6 A;  2NP0 A;  2HWA A;  5I1B A;  1Z2V A;  4OEG A;  3I2X A;  5BXP A;  3OGG A;  4JP0 A;  3AZW A;  1DLL A;  1RG8 A;  4CJM A;  1TFM B;  4J2Y A;  4YOL A;  4R6U B;  3OJ2 A;  4G6J A;  1KNM A;  5F8W A;  3VEQ A;  2ESU A;  3OBT A;  2R9K B;  5HPZ A;  4D0Z A;  3FJH A;  2D43 A;  4XFS A;  3WO4 A;  5BVP I;  5FZU A;  2ZR1 B;  3PME A;  1FWV A;  2X2T A;  4P0K A;  4P6A A;  4I3N A;  3S8K A;  4F83 A;  3RMY A;  1FMZ A;  3CQA A;  2FGF A;  4LO7 B;  3HMY A;  3OBR A;  1QQL A;  3IAG C;  5EG6 C;  3ZC8 A;  4JAW A;  3IIR A;  4XFT A;  3V0A B;  2AQZ A;  2XOA A;  4Q9G A;  3UD8 A;  3MPP G;  3JRR A;  4FVV A;  2UUS A;  3POK A;  3LTQ A;  4ISQ A;  2Z49 A;  2MLL B;  3P6J A;  4Q91 A;  1DFC A;  4I2S A;  2AFG A;  1CVS A;  1XG6 A;  1JLY A;  3O4C A;  3AH1 A;  2F8X C;  4OWJ A;  4X38 A;  3IM7 A;  4EB2 B;  4H9W A;  1DJS B;  4KEI A;  1EVT A;  5BQU A;  6I1B A;  3HSM A;  1S0B A;  1PUM B;  1S0E A;  1Q1U A;  1YXW A;  3V0A A;  4GOV A;  1G82 A;  4LO0 A;  4J2X A;  1DZD A;  3D7W B;  3PUB A;  1SR4 A;  3O4A A;  3CA5 A;  4GOY A;  4LO8 B;  4QD2 B;  1M2T B;  2D7R A;  5BXS A;  4D0T A;  2DRE A;  1ILR 1;  1WD4 A;  3H6R B;  1FQ9 A;  1S0C A;  4JPZ A;  5FZY A;  1G9A A;  4DEN A;  3CA1 A;  2LIE A;  1Z0H A;  2Y9W C;  3Q7Y A;  2I1B A;  4LO0 C;  4KBB A;  3CU1 B;  2Z48 A;  4ZFU B;  5DVH A;  1SR4 C;  5D63 A;  4OUJ A;  3A22 A;  3N7M A;  1AFC A;  1XHB A;  2NM1 A;  3C9Z A;  1N4K A;  3ZXD A;  3B9U A;  1J0S A;  1V6W A;  3CA4 A;  4JRA A;  3FUQ A;  1NZK A;  1DQG A;  2D44 A;  3CRI A;  4I1E A;  4XKI A;  1AF9 A;  4IYB A;  1M16 A;  3H6R A;  1S0L A;  3UDA A;  4EKX B;  1FWU A;  4II0 A;  1DZC A;  3VSZ A;  3K1X A;  3IM5 A;  1HWP B;  3HBW A;  1I1E A;  2ET2 A;  2YUG A;  2WBC A;  3NBD A;  4I37 A;  4DEP A;  1JTC A;  3Q7X A;  4G9N A;  4WBC A;  5E24 E;  4GP0 A;  2FFV A;  3RTJ B;  4Q9P A;  2D23 A;  1F31 A;  3O49 A;  4LO3 A;  4MZG B;  3VUO A;  3I29 B;  2HW9 A;  4I1B A;  4LO1 C;  4ZLB B;  1TOO A;  1ONK B;  4I4U A;  4JKQ A;  4GP3 A;  1MD6 A;  2KH2 A;  2VXR A;  2ZQO A;  4H04 A;  1QXM A;  1SZ6 B;  4IQP A;  2Y9F A;  4L4H A;  4JQ0 A;  3BRF A;  4I4S A;  4USP A;  4ZKT B;  2ERM A;  1EYL A;  3RMX A;  1HCD A;  1S0F A;  1V6U A;  3FJD A;  1BLD A;  2FDB M;  4JKX B;  1W3G A;  1BA7 A;  1MC9 A;  3W9T A;  2KLL A;  1CE7 B;  3R4U A;  1JT4 A;  3O4O A;  1YF8 B;  1TWM A;  3H6Q A;  4QBV A;  1PZZ A;  1VCL A;  4QO3 A;  5FZZ A;  3FJB A;  2DS0 A;  1TTU A;  1PUU B;  2GO2 A;  3AKI A;  1ISZ A;  3BA4 A;  3T8S A;  1ISY A;  2HWM A;  1IIL A;  4TLP A;  2X2S A;  4X37 A;  2K4A B;  3BAD A;  2D1Z A;  2GZB A;  3QR5 A;  1FGA A;  4X39 A;  3FJC A;  1I1B A;  4J2K A;  4X3A A;  3HAL A;  4HA2 A;  3WA1 A;  1HWN B;  2P23 A;  4J2S A;  1TWE A;  4I4O A;  3WO3 A;  1V6V A;  3O44 A;  3JUT A;  31BI A;  4OEE A;  4LO2 A;  3VT1 A;  4H75 A;  4Z8S B;  4G1R A;  3BAO A;  1WD3 A;  3CAH A;  3CRH A;  4USO A;  4J23 B;  2VSA A;  41BI A;  2NZ9 A;  1YTO A;  3BTA A;  3VT0 A;  1S0G A;  4A7Z A;  4D8H A;  3F1R A;  5G00 A;  1RZO B;  4ION A;  3QYD A;  1EPW A;  5BOW A;  1Q03 A;  1HWM B;  2Y9G A;  4LO7 C;  4XFU A;  5BQU C;  1ISX A;  3N0K A;  4Z9W B;  3P53 A;  4QBC A;  3F62 B;  4OEF A;  2NVH A;  1BFC A;  1W3F A;  4IHZ A;  1YBI A;  3BB2 A;  2HZ9 A;  4G6M A;  1AVW B;  1DIW A;  4I8M A;  5JLV A;  3VSF A;  1TP0 A;  3P6I A;  4I4V A;  4QC4 A;  3UD9 A;  1GGP B;  3N7L A;  1JLX A;  1WBA A;  3OJV A;  3SNV A;  1K5U A;  1RY7 A;  4I4X A;  1JQZ A;  3BAQ A;  4AN6 A;  5DUY A;  8I1B A;  2RG9 B;  5F8S A;  2AAI B;  5BP5 A;  3VWC A;  3BAU A;  2VU9 A;  4FGF A;  3V79 C;  2VXT I;  1BAS A;  4QD2 C;  1BFF A;  3ZC9 A;  1QQK A;  2KI6 B;  4KC3 A;  3VT2 A;  2K43 A;  4PC4 A;  1G9B A;  1EV2 A;  3OJM A;  4EFR A;  3MAL A;  1HIB A;  1XYF A;  5BP5 C;  3AKG A;  2KI4 A;  3BA5 A;  2P39 A;  5F90 A;  5BXR A;  4I0Y A;  4AN7 B;  2BFH A;  1BFG A;  2BEB A;  5D62 A;  1ITB A;  3NJ5 A;  5EC5 A;  3AJ5 A;  3O4D A;  1IT0 A;  1R8O A; 
#chains in the Genus database with same CATH homology
 4MZF B;  2LIQ A;  3A23 A;  4IZX A;  1AXM A;  3NBC A;  4LO3 C;  3TC2 A;  2VSE A;  1OQL B;  1IHK A;  1IJT A;  2Y9X E;  1NUN A;  1Z4S A;  1L2H A;  3NBE A;  2MIB A;  2QN4 A;  2NTD A;  1BAR A;  1JY0 A;  1AVU A;  5DSS B;  1WBC A;  3BAV A;  3NBN A;  3BX1 C;  1K5V A;  3R4S A;  3FJA A;  1BLA A;  4ZA3 B;  3PHZ A;  3V0B B;  1Q04 A;  1JT7 A;  2ZQN A;  1R8N A;  3AH4 A;  3FJK A;  4ZFY B;  1HWO B;  1W3A A;  4I4Q A;  5F8Y A;  5GAQ A;  1JT5 A;  3FJE A;  1D0H A;  2DRZ A;  2Q9X A;  4IY9 A;  3O3Q A;  3O4B A;  1ISW A;  4QAL A;  1V6X A;  3Q7W A;  3HN1 A;  3FJ8 A;  5DZU A;  2DRY A;  1IRP A;  1II4 A;  3V0B A;  3AJ6 A;  2IHO A;  3FFZ A;  1TIE A;  4EFP A;  1PWA A;  2NYY A;  1FMM S;  4OWL A;  5B2H A;  3AZV A;  4ZBV B;  1BFB A;  4HR6 C;  2FO1 A;  2Q3N B;  4I7I A;  2WRY A;  3N7J A;  2F2F A;  2NS2 A;  4I4R A;  4HJJ A;  4OW4 A;  3FJI A;  9ILB A;  3BRD A;  2D20 A;  1YYN A;  3WO2 A;  4KEJ A;  3AH2 A;  3RSJ A;  1ABR B;  5FNX A;  4ZOT A;  5JMC A;  2L5X A;  3RTI B;  3AKF A;  4LO2 C;  3PG0 A;  3S8J A;  4KEK A;  2F2F C;  1A8D A;  2VLC A;  5FNW A;  3E8L C;  1XZZ A;  3A07 A;  3BRG C;  1FN0 A;  3UJ0 A;  1DFQ A;  1AVA C;  4MZH A;  1HCE A;  4A7Y A;  4OWK A;  1S0D A;  2D22 A;  2FFU A;  3FGM A;  3WMV A;  2K8R A;  2RQ9 A;  3FUO A;  1FV2 A;  3UJ4 A;  1PC8 B;  1JT3 A;  3UD7 A;  4F34 A;  1HKN A;  1G9C A;  4DCK C;  5EHA A;  3KMV A;  4G9M A;  3I2A A;  1P63 A;  1DQO A;  2M49 A;  4I96 A;  3ZX7 A;  2E4M A;  4UY4 A;  2AXM A;  2MC2 A;  2RST A;  2QYI B;  4QKS A;  4ISR A;  7I1B A;  3BA7 A;  4IZE A;  4QKR A;  1E0O A;  3O5W B;  1T9F A;  4IY8 A;  5BXT A;  3EF2 A;  4P0J A;  4GAF A;  1FV3 A;  1AVX B;  4I4P A;  3HOM A;  3WIN A;  1IOB A;  4ZGR B;  21BI A;  3CRG A;  3OGF A;  3LLP A;  3CA6 A;  3FJF A;  2E4M C;  3BAH A;  2D7I A;  4ZFW B;  3ILA A;  4A7K A;  3FJ9 A;  4L4I A;  3CA3 A;  2BEA A;  1G9D A;  4I6I A;  4P0L A;  2J3P A;  3N7K A;  4EEE B;  3AKH A;  4END A;  3WIN C;  1RML A;  1IRA X;  4I4Y A;  4GAI A;  3H6S E;  2IWT B;  2D24 A;  4LO1 A;  1ISV A;  1UPS A;  2VUA A;  3ZXG A;  5D61 A;  3FJJ A;  3BAG A;  3WMU A;  3A21 A;  1T4Q A;  4EFQ A;  2KKI A;  3CA0 A;  3IM6 A;  2NP0 A;  2HWA A;  5I1B A;  1Z2V A;  4OEG A;  3I2X A;  5BXP A;  3OGG A;  4JP0 A;  3AZW A;  1DLL A;  1RG8 A;  4CJM A;  1TFM B;  4J2Y A;  4YOL A;  4R6U B;  3OJ2 A;  4G6J A;  1KNM A;  5F8W A;  3VEQ A;  2ESU A;  3OBT A;  2R9K B;  5HPZ A;  4D0Z A;  3FJH A;  2D43 A;  4XFS A;  3WO4 A;  5BVP I;  5FZU A;  2ZR1 B;  3PME A;  1FWV A;  2X2T A;  4P0K A;  4P6A A;  4I3N A;  3S8K A;  4F83 A;  3RMY A;  1FMZ A;  3CQA A;  2FGF A;  4LO7 B;  3HMY A;  3OBR A;  1QQL A;  3IAG C;  5EG6 C;  3ZC8 A;  4JAW A;  3IIR A;  4XFT A;  3V0A B;  2AQZ A;  2XOA A;  4Q9G A;  3UD8 A;  3MPP G;  3JRR A;  4FVV A;  2UUS A;  3POK A;  3LTQ A;  4ISQ A;  2Z49 A;  2MLL B;  3P6J A;  4Q91 A;  1DFC A;  4I2S A;  2AFG A;  1CVS A;  1XG6 A;  1JLY A;  3O4C A;  3AH1 A;  2F8X C;  4OWJ A;  4X38 A;  3IM7 A;  4EB2 B;  4H9W A;  1DJS B;  4KEI A;  1EVT A;  5BQU A;  6I1B A;  3HSM A;  1S0B A;  1PUM B;  1S0E A;  1Q1U A;  1YXW A;  3V0A A;  4GOV A;  1G82 A;  4LO0 A;  4J2X A;  1DZD A;  3D7W B;  3PUB A;  1SR4 A;  3O4A A;  3CA5 A;  4GOY A;  4LO8 B;  4QD2 B;  1M2T B;  2D7R A;  5BXS A;  4D0T A;  2DRE A;  1ILR 1;  1WD4 A;  3H6R B;  1FQ9 A;  1S0C A;  4JPZ A;  5FZY A;  1G9A A;  4DEN A;  3CA1 A;  2LIE A;  1Z0H A;  2Y9W C;  3Q7Y A;  2I1B A;  4LO0 C;  4KBB A;  3CU1 B;  2Z48 A;  4ZFU B;  5DVH A;  1SR4 C;  5D63 A;  4OUJ A;  3A22 A;  3N7M A;  1AFC A;  1XHB A;  2NM1 A;  3C9Z A;  1N4K A;  3ZXD A;  3B9U A;  1J0S A;  1V6W A;  3CA4 A;  4JRA A;  3FUQ A;  1NZK A;  1DQG A;  2D44 A;  3CRI A;  4I1E A;  4XKI A;  1AF9 A;  4IYB A;  1M16 A;  3H6R A;  1S0L A;  3UDA A;  4EKX B;  1FWU A;  4II0 A;  1DZC A;  3VSZ A;  3K1X A;  3IM5 A;  1HWP B;  3HBW A;  1I1E A;  2ET2 A;  2YUG A;  2WBC A;  3NBD A;  4I37 A;  4DEP A;  1JTC A;  3Q7X A;  4G9N A;  4WBC A;  5E24 E;  4GP0 A;  2FFV A;  3RTJ B;  4Q9P A;  2D23 A;  1F31 A;  3O49 A;  4LO3 A;  4MZG B;  3VUO A;  3I29 B;  2HW9 A;  4I1B A;  4LO1 C;  4ZLB B;  1TOO A;  1ONK B;  4I4U A;  4JKQ A;  4GP3 A;  1MD6 A;  2KH2 A;  2VXR A;  2ZQO A;  4H04 A;  1QXM A;  1SZ6 B;  4IQP A;  2Y9F A;  4L4H A;  4JQ0 A;  3BRF A;  4I4S A;  4USP A;  4ZKT B;  2ERM A;  1EYL A;  3RMX A;  1HCD A;  1S0F A;  1V6U A;  3FJD A;  1BLD A;  2FDB M;  4JKX B;  1W3G A;  1BA7 A;  1MC9 A;  3W9T A;  2KLL A;  1CE7 B;  3R4U A;  1JT4 A;  3O4O A;  1YF8 B;  1TWM A;  3H6Q A;  4QBV A;  1PZZ A;  1VCL A;  4QO3 A;  5FZZ A;  3FJB A;  2DS0 A;  1TTU A;  1PUU B;  2GO2 A;  3AKI A;  1ISZ A;  3BA4 A;  3T8S A;  1ISY A;  2HWM A;  1IIL A;  4TLP A;  2X2S A;  4X37 A;  2K4A B;  3BAD A;  2D1Z A;  2GZB A;  3QR5 A;  1FGA A;  4X39 A;  3FJC A;  1I1B A;  4J2K A;  4X3A A;  3HAL A;  4HA2 A;  3WA1 A;  1HWN B;  2P23 A;  4J2S A;  1TWE A;  4I4O A;  3WO3 A;  1V6V A;  3O44 A;  3JUT A;  31BI A;  4OEE A;  4LO2 A;  3VT1 A;  4H75 A;  4Z8S B;  4G1R A;  3BAO A;  1WD3 A;  3CAH A;  3CRH A;  4USO A;  4J23 B;  2VSA A;  41BI A;  2NZ9 A;  1YTO A;  3BTA A;  3VT0 A;  1S0G A;  4A7Z A;  4D8H A;  3F1R A;  5G00 A;  1RZO B;  4ION A;  3QYD A;  1EPW A;  5BOW A;  1Q03 A;  1HWM B;  2Y9G A;  4LO7 C;  4XFU A;  5BQU C;  1ISX A;  3N0K A;  4Z9W B;  3P53 A;  4QBC A;  3F62 B;  4OEF A;  2NVH A;  1BFC A;  1W3F A;  4IHZ A;  1YBI A;  3BB2 A;  2HZ9 A;  4G6M A;  1AVW B;  1DIW A;  4I8M A;  5JLV A;  3VSF A;  1TP0 A;  3P6I A;  4I4V A;  4QC4 A;  3UD9 A;  1GGP B;  3N7L A;  1JLX A;  1WBA A;  3OJV A;  3SNV A;  1K5U A;  1RY7 A;  4I4X A;  1JQZ A;  3BAQ A;  4AN6 A;  5DUY A;  8I1B A;  2RG9 B;  5F8S A;  2AAI B;  5BP5 A;  3VWC A;  3BAU A;  2VU9 A;  4FGF A;  3V79 C;  2VXT I;  1BAS A;  4QD2 C;  1BFF A;  3ZC9 A;  1QQK A;  2KI6 B;  4KC3 A;  3VT2 A;  2K43 A;  4PC4 A;  1G9B A;  1EV2 A;  3OJM A;  4EFR A;  3MAL A;  1HIB A;  1XYF A;  5BP5 C;  3AKG A;  2KI4 A;  3BA5 A;  2P39 A;  5F90 A;  5BXR A;  4I0Y A;  4AN7 B;  2BFH A;  1BFG A;  2BEB A;  5D62 A;  1ITB A;  3NJ5 A;  5EC5 A;  3AJ5 A;  3O4D A;  1IT0 A;  1R8O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...