1E2BA

Nmr structure of the c10s mutant of enzyme iib cellobiose of the phosphoenol-pyruvate dependent phosphotransferase system of escherichia coli, 17 structures
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
106
structure length
106
Chain Sequence
MEKKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The NMR side-chain assignments and solution structure of enzyme IIBcellobiose of the phosphoenolpyruvate-dependent phosphotransferase system of Escherichia coli.
pubmed rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords ENZYME IIB-CELLOBIOSE
total genus 23
structure length 106
sequence length 106
ec nomenclature ec 2.7.1.196: Protein-N(pi)-phosphohistidine--N,N'-diacetylchitobiose
pdb deposition date 1996-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02302 PTS_IIB PTS system, Lactose/Cellobiose specific IIB subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1e2bA00
3W9SA 4IMIB 2FTKE 1BA2A 1SXGA 2VUHB 3A10A 2JBAA 1ABEA 1KGSA 2A9RA 2MYNA 1U2QA 3HK2A 1JDPA 2FQYA 3OLYA 5EWLB 4IILA 3URMA 4YCSA 1F51E 2HSGA 3EULA 4OATA 3OLXA 4G97A 5BRJA 3KHTA 3OQOA 1CHNA 3KG2A 4RXMA 2XDYA 1YK0A 4D74A 3D8UA 4E7PA 1DC7A 2M98A 1ZGGA 4GPAA 3GBPA 3IP7A 1TVMA 2WRZA 3N53A 2PAFA 3OO1A 2CHFA 4ZMSA 4IGAA 1EWKA 2PL9A 2H3HA 1ISSA 3H5VA 2GX6A 1NXWA 3GRCA 3T8YA 1GUDA 4ETNA 4RK6A 3MQ4A 4XFKA 4Z9BA 1M2EA 4Z99A 4G0PA 1RXEA 5GOTA 3LUGA 2QVGA 3O2SB 3RVKA 3EDCA 3O2QB 3OQNA 6ABPA 1ZDMA 3CZ5A 3OLVA 4RY8A 5JNSA 3NHMA 3ROFA 3RVJA 3FGZA 3RVRA 1LBIA 4YV7A 1EWTA 4W5OA 2IPLA 2FEWB 3N75A 4YP9A 5BR1A 1FFSA 3KYJB 3CLKA 2E4YA 1OXKB 4YR7A 3H1EA 4W5TA 2HPHA 2JCGA 4KK4A 4F11A 1YTUA 2KYRA 2MYTA 3M9XA 5TPZD 2NT3A 4EY3A 3F6CA 4MR9A 5IULC 1A2OA 3OM1A 3NNNA 1ZGZA 1Z26A 4Q7EA 3D02A 3C3WA 4PEVA 4Z4FA 2ID7A 3N0WA 4OTZA 3I45A 3JPYA 3FFWA 2MSKA 3T38A 4MR9B 4MR7B 1CYEA 1YIOA 4RV5A 3SNKA 5B3JC 4NCBA 3LKVA 1U8TA 4JOQA 4Y9TA 5DKFA 3N6VA 5CNMA 1Z2DA 3MMNA 4CBVA 4RXTA 4MPTA 1NXSA 2IOYA 1YK1A 3BILA 3QELB 1AB5A 1FQWA 1T34A 5I4CA 4H3KB 1ZHHA 3H5TA 2QV0A 3JY6A 4NQRA 3HS3A 2E4UA 3FDFA 1C4WA 2NUBA 1J56A 1DG9A 2FLKA 3QX9A 2FN9A 3F73A 4KPYA 2Q5CA 3MIZA 4Z4EA 2FQWA 1TLFA 1Z18A 3FMVA 3F6PA 5IEJA 3RVQA 1E6LA 3BBLA 4F8JA 4WUTA 1JL3A 5B3JA 1QO0D 2I6FA 4QYMA 3L49A 3QLUA 1DP4A 2MYPA 4EVQA 3RVOA 4D6XA 2FW0A 3HDVA 1APBA 2QR3A 3NBMA 1JBEA 4F06A 3HVRA 4UHJA 5TQ2A 3OLWA 4RKQA 4ZJPA 3CTPA 1PUXA 1YVUA 3TX6A 1RZRA 1QQBA 4JA2A 3LUAA 1A04A 5TQ2B 4LRQA 2TMYA 3O75A 4TMYA 1IIBA 2E4ZA 4RZSA 4TLLB 5JS2A 2IPNA 1TMYA 2QVCA 4Q6WA 1M5TA 4XXHA 4MYRA 2CHEA 2E4VA 3CG0A 3KLOA 4XAQA 3CG4A 5CHYA 2FMHA 3EAFA 4O1HA 3IP6A 1EFAA 2PUGA 2WJWA 1MB0A 1P6UA 6CHYA 4RK7A 3N8IA 4LDAA 4G0ZA 3HZHA 1CEYA 1P6QA 3O2JA 1GCGA 1Z2EA 3HEBA 2MYUA 3HUUA 4HNQA 1OXBB 5FWYB 5JNVA 4MR7A 5KQPA 2L2QA 1QP4A 1FSPA 2WMYA 4N47A 5ED4A 2ZAYA 3JPWA 2PMCA 4DADA 1DBQA 2O20A 4G0YA 4RS3A 3UK0A 4HNSA 5CNIA 2RDMA 2V0NA 5FWYA 3HM9A 1E6KA 3GT7A 3MYYA 3Q7SA 4PZ0A 4WT7A 4Z4HA 3RH0A 3I09A 1K68A 1PNTA 1E6MA 1B00A 3T95A 3IP9A 3Q7RA 4WWHA 4PE5B 3C3MA 4LE1A 5KC9A 4ZMRA 1DCMA 4JB2A 2PUDA 1PNRA 3A0UA 8ABPA 1W9HA 2DRIA 1SRRA 1ZITA 1JDNA 3MF4A 1JF8A 4RK1A 4YS6A 1D5WA 5KQLA 1YMVA 2M1ZA 1ZESA 2JB9A 3ILYA 3E3MA 2PUEA 4B09A 3DGFC 5HQJA 2N9UA 4FB4A 2GWRA 1QP7A 4N03A 3ROTA 7ABPA 3S99A 1ZH4A 2H0AA 3DGEC 4KVFA 1DRKA 3ILHA 5GQSA 3KS9A 3LFTA 3TB6A 3CRNA 2YHAA 1QQAA 2F8TA 4OLAA 5KC8A 1JFVA 3GWGA 2R47A 5HSGA 3GBVA 3JS5A 3H6HA 4RK5A 2JVIA 4O1IA 2WY2D 4KNYA 3C6QA 2RJNA 3LUFA 1VPWA 3K4HA 2PKXA 1S8NA 1BDHA 1LJUA 4H60A 4JP1A 4FE7A 1XHFA 2RGYA 1MIHA 2QW1A 1USIA 1ZVVA 3IDOA 3DLHA 4RXUA 4YGXB 3RQIA 5D2CA 1RXIA 5F64A 4ETIA 4ETMA 4F3TA 5C5CA 1ZAYA 2PLNA 3HXMA 2PUAA 5EWJA 2PJUA 1TM2A 5BRAA 2HJ9A 3A3KA 3BREA 3EQZA 2RJOA 3C3KA 3Q15C 1H9CA 3P9YA 3H1GA 4MLDA 3H5OA 4MS1A 1NATA 1URPA 4MR8B 3RVMA 4N76A 4EYOA 5JS1A 1DJMA 4JAVC 1GLGA 4MS3A 1ZN2A 5IEBA 4NV3A 2A9PA 5PNTA 5TPWB 4MS1B 4FE4A 4WXEA 5TE9A 1I3CA 4N0QA 2JRLA 1FFGA 1VRVA 4TN5A 4ZYLA 4H3HB 2VYCA 5KQGA 2QU7A 1BDJA 2CWDA 1R8JA 3H5WA 3IP5A 4MS3B 2B4AA 3SG0A 3VNAA 2PUBA 2IPMA 3H6GA 1C0EA 3GYBA 3KJXA 1NXTA 2IPAB 2R48A 2MSWA 3O21A 3OMWA 3KCNA 3HSYA 4LX8A 1MB3A 1NXVA 3JTEA 5FWXA 3QEMB 5IC5A 4EGSA 4W5NA 3FFTA 1L5YA 4KMRA 1VKRA 4YWHA 3K9CA 3QLUC 1EWVA 3H5IA 1Z12A 4KQCA 3QLVA 2IDMA 4UHKA 3QEMA 3O1HB 5E3JA 4JB0A 1DBWA 4MGEA 3MA0A 3EQ2A 2FQXA 2X7XA 3SQNA 4YRZA 5JNTA 1NTRA 3C97A 4KV7A 1W25A 5C5EA 4RY9A 1F4VA 1DC8A 4S05A 4N41A 1DRJA 4W5QA 2FXIA 1QKKA 2L17A 3E61A 4HNRA 5IX8A 4QPJC 1JWLA 3IPAA 4KREA 1LBHA 3QLTA 2JVJA 3O74A 2GKGA 2QXYA 5CNJA 5KI6A 2MSLA 4D6YA 1JH9A 3I42A 2YHBA 1Y1LA 1DCKA 4WZZA 4RK0A 3UKJA 1MVOA 2QSJA 4LDZA 3N0RA 3OLZA 1YMUA 4N0PA 4IMJB 1WETA 4GNRA 4M88A 4LE0A 3BRQA 4P1ZA 4RDCA 2ZWMA 5IUJC 2PE5A 1KRXA 4RWEA 4EYGA 5EWJB 3CFYA 4Z4GA 3N0XA 2FLWA 4YLEA 3DZDA 2LBPA 2FKAA 3HJFA 1JX6A 4YO7A 2PUCA 4MR8A 3QX8A 1RNLA 5DCLA 4LE2A 4EUKA 3MM4A 3RVNA 2WJAA 5IBQA 5TPWA 3G1WA 4OLBA 3Q9SA 4NICA 1D1PA 1KRWA 2WB4A 4KRFA 3LUHA 4L4UA 4XARA 1E2BA 2JVKA 1QO0A 4DQDA 4Z4IA 3VNBA 2F8SA 1TJYA 3HV2A 2FEPA 4KQ9A 3LOPA 4Q6BA 1ISRA 3GA5A 5FWXB 2GBPA 4PICA 5FBHA 3RVLA 3TMYA 2P4UA 4RKRA 5DTEA 1RZRD 1PEYA 3LUKA 2FN8A 2WWVD 1FFWA 2FEKA 5IUNC 2LIVA 2NT4A 4G86A 5KQMA 3Q7TA 1NXOA 1U04A 2AYXA 4KK3A 1UDRA 1XHEA 2E4XA 3LKBA 3O1JC 4Z4CA 1BAPA 4OBBA 5EWMB 3KYIB 5HM6A 4JASB 4P98A 1SXIA 5T7BA 2PL1A 1ABFA 4E7OA 1USGA 3M6MD 1ZH2A 4RY0A 1D1QA 3CS3A 2HQRA 3KLNA 4IRXA 3NNSA 1JFSA 3CZCA 2FMFA 4RK4A 1M2FA 3DBIA 4LZLA 1NY5A 1QMPA 2LPMA 1LJLA 3RVPA 4MS4B 2VUIB 1KMIY 2L19A 3OMXA 4OG2A 1U2PA 3BRSA 3JVDA 4EVSA 2W42A 1JFTA 1BDIA 2P9HA 1MAVA 3LMKA 4WXMA 3QLVC 4MS4A 2GI4A 3UUGA 2A9QA 1SXHA 4RU1A 3OQMA 3EGCA 2R25B 3LUDA 4KZKA 4EVRA 3H75A 1RPJA 4F12A 2JK1A 1EHCA 1HEYA 2J48A 3SY8A 1GUBA 3CNBA 4NCAA 3LUJA 4MAAA 1Z15A 1QPZA 5TQJA 3A0RB 2CD7A 3NHZA 1PEAA 1JHZA 4EYKA 3SM9A 4MQFB 4HYEA 3DLBA 1NXPA 4QICA 4L85A 2B1JA 3OM0A 4G0XA 4DN6A 3NNDA 1EAYA 3IPCA 4EYQA 4W5RA 2VK2A 4TLMB 4RSMA 1JYFA 2FVYA 2NZVG 4MQFA 5TPZA 5ABPA 1L5ZA 4G0QA 1DCFA 3HCWA 3OO0A 1DZ3A 1M5UA 3B2NA 5JNRA 2BGGA 5TQ0B 1P8AA 1Z17A 3TD9A 5EWLA 3HO1A 3L6UA 1XWWA 3CU5A 5TQ0A 1AB6A 4IF4A 4Z9AA 1LK0A 1BVHA 4MLCA 3TO5A 5IUKC 1VLZA 3KTOA 4G0OA 4XASA 5CNKA 4Z0NA 2AYZA 3RVSA 4MQEA 2PUFA 2L18A 5FBKA 4PYRA 2FSPA 2LP4Y 4KFCA 1DBPA 5DGCA 5KWSA 2A9OA 2HQBA 3GV0A 3H5LA 3I5AA 2OENG 4MQEB 4QYWA 2LUOA 2IYNA 5BQ3A 5EWMA 1YS7A 4MRMA 2IKSA 2FMIA 5DLEA 3M9WA 1QP0A 2R4QA 3Q41A 1U0SY 5T3YA 1Z13A 3T6KA 4MRMB 4O5AA 3LTEA 4ZPJA 1SD5A 2ID9A 1P2FA 1ZY2A 3LUCA 3GL9A 4ML3A 9ABPA 1USKA 1A0OA 1JYEA 3F7NA 1D2AA 5JNWA 2OQRA 3HUTA 2E4WA 1JLKA 3SAJA 3EJWA 4G0MA 1D4ZA 1Z25A 3G85A 1Z16A 4S04A 1PHRA 3CHYA 3CKMA 3EODA 1GCAA 1K66A 5HKOA 1YS6A 3O1IC 1NXXA 2NZUG 2QZJA 3JVIA 3R0JA 2JBAB 5JNUA 3FFXA 3HDGA 3QK7A 4XLTA 3KKEA 2FMKA 3KSMA 2HQOA 1QNLA 3QEKA 3H1FA 3QELA
chains in the Genus database with same CATH superfamily
3KM0A 3OKPA 3S1SA 3F8WA 1YQEA 2I6UA 5CX1B 2VUHB 4MUGA 2YZKA 5LQAA 1KF0A 1D07A 3JQBC 2EIHA 3OA0A 3VVCA 1NQOA 1J97A 2J5QA 2KQUA 3LDGA 2B0JA 3ABIA 4OXQA 4PQGA 2P35A 4QREA 3FW1A 4BMYA 4F4IA 4Q1EA 5I9SA 2FU5C 2YC2C 4OATA 3WLLA 3HV0A 3JW8A 5F9MA 3QIAA 1PDWA 5BRJA 5ELLA 4RXMA 2F3RA 3HVUA 4HB3A 2O06A 3HCPA 3LX4A 4XWWA 2AR7A 3D8UA 1QO7A 1AK2A 1QONA 5AT1A 2GFQA 3GBPA 4GLBA 5CFRA 1A7AA 3HB7A 3THXA 1ZIXA 2Q5QA 3MOSA 4GL4A 4HBGA 3NM6B 1AURA 5G1PA 5FFFA 5AW0A 2XT0A 3GFBA 4NG4A 4DR7B 2H00A 2P1DA 2YYSA 1P2TA 4NFHA 1EMDA 1KY5A 4D9NA 4O08A 5LA6B 1RWOA 2E2WA 3JQFC 2ODEA 3ECCA 4LXGA 1KDOA 1SHKA 5L4LA 4O2BB 2H2FA 1TK9A 2ST1A 3BMCB 1E1NA 1GZSA 5A3VA 3TLKA 2OBLA 5EJGA 3RHTA 3WKEA 2PX3A 5GV8A 2VAPA 3I01A 1F3LA 1YO6A 4R71A 4FCCA 3KSAC 3H2ZA 3PQFA 4OHVA 3PS9A 5D87A 2B83A 2NUAB 4D7AA 4O4HB 5BN5A 1QIGA 1YQGA 4XOIA 2BF4A 3JWJA 3QA9A 1AKWA 3K16A 4YMTA 1Y8AA 5BR1A 3HVKA 3JAWB 1OXUA 4BWYA 3MINA 3IQGX 5CT8A 3PICA 4TN1A 1LK7A 4BO1A 1ZX1A 4ZJZA 2FYTA 1T1GA 1K7SN 4QOGA 2DLCX 4WY5A 3W5SA 3NNNA 1ZGZA 2Q2NA 2X2OA 4K8OA 2A58A 2Z98A 1TFRA 2O19A 1W35A 1G6OA 2I2FA 4OF4A 3GN2A 4RVHA 4D4HA 3TI9A 3VNSA 3DMDA 1QKJA 2NZ8A 3F7OA 3GO4A 4MR7B 4GL2A 2NTYC 5IH3A 4URZR 5JMPA 4B33A 1ISFA 4Y9UA 3DLIA 2QLMA 5AW3A 3ZD8A 3ACCA 1Z0UA 3GNQA 3HA3A 2CW5A 3PC4A 3AU9A 1ZINA 4O59O 1YK1A 2PKRA 1BX0A 2PGDA 3DKPA 3KLPX 5K7SA 5KSOA 1T34A 2EAUA 3AKCA 4C03A 1FX0A 1ZHHA 4J4HA 1I7LA 4NFSA 4NQRA 3UATA 4HAVA 2QZSA 4OXIA 3PC6A 4GMGA 4UMFA 1YA8A 3DDUA 2W00A 3CZMA 3OHSX 4R2JA 5JRJA 3HCRA 4XTRA 1FX0B 3OCWA 5I5EA 2G4VA 4KGDA 2IODA 2FPLA 1WVGA 2EGHA 2AJTA 5CJJA 5CT4A 1Z18A 2FDXA 3O73A 4GI1A 4L4ZA 4MUBA 4Q9LA 1BQ3A 5DWDA 3CX4A 5M3BA 4HNUA 1GA6A 1CJUC 1LVGA 1E4OA 4IW3B 1HYGA 1LS6A 2GEUA 2YWXA 2Z56A 1IIRA 1N0UA 4JNCA 5KAMA 4Q4CA 5DGTA 4WZAA 1YL6A 3OIYA 4D6XA 3W5HA 5DBOA 4E03A 3U09A 1PT7A 2ADFA 4YAJA 4I9UA 4PZDA 5F5NA 2OFXA 5K2OA 5EL0A 1VDMA 1GZUA 4O4LB 3UMGA 3UW1A 1RZRA 3G9QA 3KYCB 2AUNA 1IBRA 1JPJA 2H1HA 5T5QA 4EFMA 1KZ1A 5KNCA 4ARBA 1RHQA 4HDNA 4NOKA 3BIOA 4ER7A 2P2GA 5F1OA 2UAGA 2VPTA 3RI3A 2TMYA 3O75A 1LNSA 1DQZA 2WVAA 1JIKA 3UH1A 4PPQA 5JXGA 4PLCA 3UMBA 4LWOA 2PGJA 3DZFA 4W5WA 1Y8QB 1JALA 4TKVB 2HA3A 1ZMBA 3K4QA 2IXAA 3VPXA 3PA8A 2GEFA 2BEWB 2EZ9A 4IGFA 1MB0A 1WMFA 3LOQA 2I91A 3RS2A 5HJ5A 3WLRA 3FUVA 2RGXA 3NLLA 2ZBQA 4LI3X 4BU1A 4Q47A 1YRHA 4JITA 3O2JA 4K9KA 1ZLXA 4V0KA 1CZNA 1Z0IA 3W2IA 5K3CA 2CUKA 2NNWB 2QT0A 3K9FC 4C22A 1TZCA 4O4JF 3AW8A 1A9ZA 2IHTA 1EKXA 1LS1A 2PYZA 3KV1A 4PRKA 1PS8A 3W34A 1W7AA 4ZVSA 4Q3CA 1V71A 1R10A 1VPTA 5HG0A 4C0HA 1E3JA 4PTLA 2RDMA 4H1WA 1ISPA 2R8XA 3GLIE 1ZPDA 5JROA 2B2XA 3C6MA 3CLTD 4JSYA 3UV6A 1H2EA 1PX2A 4TOIA 3U4DA 1MTOA 1V41E 5HILA 3R7FA 5HIAA 1UDBA 4CM5A 4B3DA 1R0YA 2ZQZA 3FZYA 1NHGA 4HRVA 2BMAA 5I7WA 1JF8A 1FP7A 2C4KA 3QGMA 2WHXA 4QG7A 2O1WA 1FS4A 3BUSA 3SGLA 5C37A 4CMHA 2JB9A 1U0EA 2RCYA 4AWAA 1PJAA 3LVRE 4CLHA 3IQHX 3DGFC 3EW7A 2G4LA 3KB2A 2QN8A 3BZBA 1EDOA 4D0LB 1YVRA 4N03A 1CEXA 3G23A 2PZMA 3M0EA 4ZKDA 3BFPA 4RPKA 4XWKA 1X1DA 1PU2A 3RIGA 1DRKA 2CNKA 4GXQA 4FDLA 4TMFA 5LXTF 1JYSA 3KZKA 3KCQA 1G7CA 5EQJB 1KH3A 1I4DD 4ND6A 1US8A 3DTVD 5AUPB 1Q17A 3ZCXA 3RG8A 2WSBA 3EIWA 4TLBA 2WY2D 1B8PA 1QYXA 2WF7A 1JDSA 3H2GA 5EJMA 4DWJA 5C1PA 2QL6A 3K4HA 1BDHA 4FYKA 3VBEA 4X1IA 3RFXA 3WK7A 3L8FA 1FTSA 3P0FA 1GPMA 4RPJA 1E99A 1JFFB 2ZBVA 3AFMA 2RGYA 1G5HA 3WL8A 3TLYA 1USIA 2FW6A 1C29B 5EXXA 3NCHA 5IDWA 1IMOA 2EZTA 4IHAA 3HPRA 1NVKA 1Q1GA 2H57A 4IH9A 2R5WA 2RKWA 3OZRA 1J0BA 2BWJA 1HE2A 3G79A 2L82A 2HMUA 2CJXA 2O7QA 2Y67A 3VYSB 5ICEA 2Y6VA 3KWJA 2I0FA 1BS9A 3DHWC 3ZWBA 1PZEA 1WEHA 5EIOA 1NYRA 2JANA 4UU8A 1ZH0A 1RKVA 1A77A 2NSHA 7ADHA 1R18A 1WXEA 4C4AA 3ZV7A 1BE1A 1HRKA 2JRCA 1RPAA 3CO0S 1XZNA 1YZYA 3N8HA 4KHPB 3WK9A 1WIWA 3A6HA 4F85A 3QE2A 3RVMA 4LY6A 4MS3A 4UM8B 3ZN2A 3Q9NA 1NF9A 5PNTA 2A14A 4DXDA 1LNZA 1R0BA 1TM5E 5AJVB 1FLNA 4YAEA 3ZDXB 6REQA 4RM3A 3EG5A 1DIGA 1ADYA 4ZYLA 3GPLA 1PEDA 1Y1PA 3L4JA 1TTHA 1ACLA 1Z75A 1KY3A 4M1QA 3Q8MA 1AQJA 2QN1A 9MHTA 1E8MA 1E7QA 2QWXA 2WJ6A 3JALA 3ZDYB 5BN3A 4X65B 3BXFA 1FNCA 5DNCA 4IG9A 1T0BA 4TQGA 3CLSD 3FPHA 1OW3B 2Q28A 3F46A 2P1ZA 3LRPA 5IMBA 1QANA 1T4CB 1Z12A 2QVXX 1U0LA 1N6OA 2IDMA 4YRQA 5HQ3B 2ZS9A 2I3GA 4E5YA 3EQ2A 3JV7A 4YRCA 5DB4A 3ST7A 4ER0A 5EIWA 1E18A 2FZLA 4NBLA 5LYJA 3SQWA 1V5GA 2CFIA 3DHNA 4KW7A 2J6CA 1FDVA 1I9GA 2NYRA 3ME5A 4MJXA 1VSBA 2F1OA 2JGNA 4Z6KA 5JSUA 1XRNA 5A03A 4S0XA 2XYQA 3JYNA 3EH1A 3W9YA 2XE7A 4JLMA 1JI0A 2UV8A 2N47A 2VPXA 2HPVA 4NHEA 2J3KA 3K2EA 1QC5B 1HA3A 2VG8A 5K1ZA 3UGQA 4TVBA 3HBAA 4TXLA 3KZOA 3P4YA 1X7WB 2NTEA 3IE0A 2O07A 3D7NA 4YCLA 2B1QA 1WMAA 1JGTA 1EM8B 4O2LA 4OVKA 5FJJA 5FBVB 1RIIA 1Y8RA 3L0CA 4BO4A 1YMUA 2PTHA 3R7SA 4GNRA 5F35A 3WRWA 3ZGLA 2NV6A 3GJQA 4I4LA 5F5LA 3OOSA 4ERXA 5KJCA 4EP1A 3WWYA 4EAAA 3QVOA 5K45A 3CFYA 3LK7A 2Q99A 4MA0A 3RRMA 4EW6A 2X15A 6PFKA 1CUIA 4NWIA 2X4LA 1BJRE 1FUIA 3HCBA 4MCHA 1DDIA 2GZ2A 3OY7A 2EBFX 3W8EA 1DKMA 4NZNA 5I7OA 1PJ2A 1DEOA 1GTG1 2JIPA 3MRXA 4WA7A 4B0PA 4DFDA 1VPVA 1B3RA 2CB0A 2OSBA 5JEEA 2I99A 2J3DA 3DB2A 1EVQA 5AI4A 4E30A 2V4ZA 3L7JA 2P9BA 4MZXA 2RG7A 2WJAA 4V1CA 1Q1NA 1DELA 1UXKA 1X7ZB 3O38A 2VUUA 4JC4A 2XUHA 4NNPA 5EGNA 5FUBA 1ISGA 4RD6A 1IZYA 1G5FA 2WLTA 1P17A 3C1OA 3PXGA 1PJQA 5ICMA 2ZZNA 5A0VA 5FO0A 1OAOC 4L4XA 1QB8A 1QO0A 1RRFA 2QRQA 4YPFA 3MGKA 3WIVA 3D1VA 3RSLA 3HWX1 4PWZA 3USES 1SKBA 1C80A 5U4XA 1CHDA 3RBAA 4CV0A 1HMPA 3ANLA 2HV8A 4UATA 5EMKA 1PX0A 2B99A 3C3EA 1QLJA 2BBTA 4M0KA 5DTEA 5G41A 1HQDA 1PEYA 2BCGY 5GOZA 3T3EA 5LP6B 1IULA 3IYLW 2A35A 3LCRA 4F38A 1CJMA 5K20A 1CZOA 3KKQA 4KPUA 1SXJC 3RO7A 1TQ2A 3CWZA 3VC7A 3OQBA 4D02A 2VSYA 3BDAA 3SC3A 3K2QA 1B8UA 1CZKA 4YGYA 3BH0A 5FKJA 4W9NA 1YR2A 2J8ZA 2XB4A 3EZLA 4RX1A 1K4YA 4E5KA 5JV5A 2VHXA 4I5IA 1LB1B 3O8BA 4YMGA 4QKQA 2XWBF 3CRMA 4DCNA 2Q7XA 2OAP1 5P21A 1Q14A 4XUCA 3LHIA 5EJIA 5FLEX 1N9GA 2BV3A 5CFZA 4F5YA 1OFUX 2JH8A 2PN1A 3DNFA 2SKDA 2H4JA 4YIHA 3D4PA 5CB4B 1VL2A 2FUNB 1Q7TA 3MWKA 2DJIA 1Z83A 4IIBA 2FE1A 3VR4D 5ES3A 4BMCA 1S0UA 5FV4A 1TZBA 4PGMA 4WKBA 1NJSA 1M2VA 2PD4A 4XVRA 4L27A 2P67A 5JNRA 3E1GA 1Y3HA 4OX9B 1DV1A 3NHZA 5COAA 4EMUA 1JHZA 1TT5A 3LIPA 5JDIC 2EATA 4AYXA 2QVYX 2GTPA 3FPKA 4WBXC 1X1RA 1Y4UA 4F71A 2QTBA 2IHKA 2R6AA 2QN9A 1WD5A 3QE4A 2B8NA 5ALWA 4YCJA 2VZLA 5ILQA 2VHJA 1ZN9A 3LLUA 1YCHA 2H7VA 4MYTA 4EBFA 1UXIA 1BJKA 2Z2ZA 2NAFA 1DZ3A 1T10A 3ZR4B 2REOA 5JAMA 1L1RA 1C8BA 3A6LA 2HK9A 1J0XO 1UKAA 2C7PA 2PIAA 1H22A 1GZVA 2PZGA 3QX3A 1X6VA 5L4NA 1GGKA 3WE7A 2AZXA 5IWCA 5ENVA 4PO9A 1I30A 1U28C 1QGOA 1YGYA 5I45A 1RR6A 1CCWA 2F3SA 3MZ0A 4PZZA 4Z9AA 5HUQA 1KARA 1YR9A 3AT1A 3TO5A 3HA2A 5K8VA 1DJLA 4BJ1A 5DX8A 1J2UA 1U8FO 1O97C 3VFDA 1FP2A 5KPJA 3ASZA 3GI1A 4Z0NA 4JENA 3H1AA 2OESA 1UPTA 1PD0A 4L3VA 3RUAA 3EX7C 4ARVA 1GKLA 1VL0A 1NVAA 2PR2A 4D97A 4AKHA 3PZRA 5K3DA 2C99A 2OO5C 4CKEA 4MQEB 1KI2A 5EGSA 3AIIA 4K05A 5CYOA 4Y6OA 821PA 2FQQA 5IKPA 5K05A 4HAUA 4DQKA 4MRMA 3RGGA 4HK4A 4M9XA 4R8LA 2GBLC 1HTTA 2PQ0A 3L7AA 3MTIA 2R4QA 1KYIA 5D86A 1RE0A 4AY2A 3GYGA 2ACVA 4U7FA 2BKEA 3UJBA 4ZEVA 1N1DA 2AFRA 4E33A 1QF9A 1EPUA 1VE3A 2J7KA 2OCXA 3BS4A 1EVYA 1HO3A 4LZPA 5TS3A 3TRFA 1I4TD 1YC5A 3ZS9A 5EHZA 4X66B 3P2MA 4DLSA 2JFXA 4FFVA 4PFSA 1RYEA 4MWCA 1Q1BA 5K8TA 4PGGA 2AZ4A 1CRZA 1Z16A 2FX2A 5COBA 3SVTA 2XBMA 4BL5A 2NQTA 4N7RA 1T8YA 3PGA1 4G8JA 4LBWA 3P27A 3T3HA 5FL7A 2WJIA 4R1UA 1M2GA 2P5UA 3QVJA 2PRYA 3I9NA 1C2YA 2G17A 3DE3X 3DVAB 3WRYC 1VMAA 3GIWA 3VGJA 4F9TA 5EMNA 5H81A 1SNYA 3GLGE 3ORHA 2EGGA 4QSMA 5F2EA 3PHLA 4TN5A 4WECA 4MRSA 3VBCA 3N9IA 5HIKA 5CA0A 1W59A 2Y4OA 3F4LA 2HCRA 3L46A 5A06A 4NCJA 1MKYA 1GZ4A 4OHFA 3HYNA 5E2IA 4GZ5A 7MDHA 1UKZA 2Y1EA 4PG8A 1A88A 3BRWA 4HP8A 1B6TA 3G5UA 4R8KA 1H2RS 2FSFA 3CE9A 3UW3A 3ZTTA 4UUMA 3L7DA 5U1PA 1B2RA 1O9BA 2V3WA 3EVDA 1XYYA 3M1LA 4OJMX 4PX2A 4QTUB 4YJ3B 3SDSA 4CCAA 3OQOA 2P0YA 4M53A 4D74A 5BT8A 3GT4A 3LQ2A 1W2WB 3RYTC 4O3MA 3OZSA 3E15A 3K35A 2FK8A 1Q7CA 1Y82A 1ZH8A 2LTAA 3FHOA 3GEPA 1HE3A 4XOUA 3OTGA 4XWAA 2PZFA 2XY4A 1C1YA 2XAAA 1QE3A 1L5KA 5LKAA 3RARA 3P97A 1KMMA 1EFVA 5D51S 3H17A 2ON6A 4IKEA 4LOHA 4NENB 3IUNA 4HD8A 5FI0B 4YAKA 3DQPA 4DILA 3QWBA 1TE2A 1NXWA 1PG2A 2PZEA 3QFCA 2HHAA 1POWA 1WOYA 3T5MA 4E4TA 4GE3A 1K08A 1M2EA 2GK4A 3DTNA 3STXA 3UHAA 4CDRA 2VYND 3EVTA 2BE9A 3NDPA 3QUCA 3Q7PA 5FBLB 4ASUA 4J0GA 4UUPA 1Z39A 2W2PA 5MN4A 1M1YB 3GQBA 3PXUA 2WHQA 2F9MA 5EUBA 2J9FB 2VNKA 1RHMA 3X1WA 4KXQA 1BE6A 5ILOA 1EWTA 1WXDA 2EF0A 1SVLA 1EB9A 2BFFB 2PD3A 2PS9A 1Q6YA 1NASA 4WZBA 3H1EA 2IYVA 3B3QA 2J9FA 4G5OA 4UNSA 3AHHA 5BQXA 2VR1A 5GGXA 1BCSA 2UUOA 4M89A 3RWBA 3TG2A 1NBOA 3FB4A 1T3GA 4UD2A 1FXWA 1BRMA 1BA3A 5ICCA 2OORA 3F6CA 3FG9A 1U7DA 3ILXA 1B6RA 2VDWB 4CMGA 4RWZA 1RACA 3O2NA 1L4UA 1KI7A 1NMZA 4ZZ3A 4LYHA 3U16A 3T3DA 2QHXA 5HX7A 2PPVA 4HEQA 4QO7A 4YCBA 1NFQA 1TYDE 3BHJA 4G84A 4EX7A 2OLKA 5LZ7A 5HUJA 4JJEA 4V03A 1TQ6A 2BP7B 1RJ9B 2R87A 1GSOA 4R9UC 4E46A 2IXGA 3OEHD 4G1MB 1VBKA 2I4MA 1PP4A 3GLUA 2IX3A 3EHDA 2AJLI 4FYPA 4JU8A 2WM2A 5CX1A 4DY4A 3O8QA 2FDCA 3FDZB 5DNDA 1K2WA 5LLTA 2CNLA 2ZT5A 1U2DC 2BSQA 5KYWA 2BFAA 4YAFA 4S3MA 4NOJA 2FLKA 3LHKA 2ZAGA 3AF2A 1RT9A 4KRGA 1DUVG 1X3LA 3KFXA 3T7TA 3WQRA 1YE8A 3PJFA 4XR9A 1RYYA 3ORSA 2XTZA 3RREA 2VT7A 2FZVA 4DARA 5ITSA 3THWB 4I1UA 1XLWA 2CUNA 4WACA 1PWZA 4DABA 2VWGA 3EFHA 3IT1A 1MF7A 2IS1A 3VPCA 3OZVA 3WGHA 2XCQA 4V2UA 2GPJA 3L8YA 4JEMA 4ZCMA 2QP4A 3L49A 3UAXA 4CMEA 5M29A 7YASA 3HU1A 3COJA 1OWPA 3ITEA 2DETA 4F2WA 4LJ5A 1NNUA 3B8EA 4FMDB 1APBA 3Q11A 3U60B 2DWCA 3CKYA 4GO1A 1VJTA 3WLNA 1HFKA 3CUTA 1TU3A 3VHXA 2NU7B 2Z2JA 3IQDB 4TTQA 2C78A 2EL9A 5G02A 1W96A 4TL7A 1M6VA 2FJPA 3T7CA 4DNOA 2R5NA 5AQ1A 2YXPX 1R6TA 3RW9A 5EJ4A 3K0AB 4UEKA 3VPSA 3I23A 2QTAA 4B17A 4ESVA 1VKJA 4BY9E 2VP4A 2BAGA 3ORYA 5BVHB 2V7XA 2FSSA 1CU1A 2XVZA 2GUWA 3H3FA 4WZBB 4AB1A 2QVCA 1Y6GA 1QYRA 3P9ZA 1EFCA 2R79A 2Y8EA 1Z0JA 3E7PA 3EIOA 1TK3A 3CG0A 3K8ZA 1KTVA 3N2EA 4R1OA 4XAQA 3FOCA 1YASA 2HCTA 3PDIB 4XX0B 5IK2A 3VO2A 4EF4A 1EFAA 1KTIA 2WG0A 1O8BA 4RK7A 4TKVA 4ZCTA 5FAKA 2ZJ7A 3HYRA 3P2KA 3E9YA 1G6KA 2G09A 3LCVB 2X40A 3SVLA 5E0OA 4KN5A 1H5QA 2FPPB 1II8B 3BK2A 3PA6A 4LRUA 1P9NA 4B6EA 1Z7WA 3O90A 1YWGO 4AJ2A 2WMYA 4N47A 3MJDA 4CT5A 4Q18A 1DJPA 5NULA 2FK7A 3AZQA 4DADA 3ZZ1A 4RTRA 2O20A 2VPWA 5ER9A 5LIRA 4BX2A 2Z2KA 4P83A 2IH2A 2CYCA 1MGPA 1YRYE 4ENSA 1OH7A 4N5MA 3A4IA 4WN9A 3GT0A 1QSGA 2P2LA 3TF5A 1F2TA 4UARA 1ZZEA 3DOHA 3FCCA 3Q7RA 1JEAA 2D2VA 2W6NA 4P38A 4B71A 2X3UA 3CRW1 3H8WA 4BE9A 5A9TA 4A1FA 2G88A 2YBDA 1NX9A 2P3QA 3ESQA 1KYQA 1LVUA 3QUSA 3ZK8A 4K40A 2DE0X 2DRIA 2C88A 3LLVA 1ZITA 4L6AA 4MRVA 2AHOA 4RK1A 3SS9X 1W30A 1XTPA 5KJEA 2Y1KA 3SK0A 4AZWA 5BSKA 3TNJA 1BOFA 4C87A 1IN8A 1PF7E 3FGPA 2B37A 4CKBA 3U5TA 2WWIA 1KMHA 2BKLA 3MMPA 3OESA 3Q3HA 4D96A 4FB4A 3RC8A 4EG6A 2G04A 1MIOA 1JZSA 3SZMA 1HSOA 1OSNA 5KTPA 5BVGA 2JLWA 1ZH4A 3C98A 4RH0A 1FTQA 2IZZA 4RVSA 1E3WB 4L15A 2JW5A 3AERB 5KOJA 1QGDA 3QP9A 4KN8A 2ZI9A 3TB6A 2Z0MA 4OQLA 4EPWA 5K99A 3DMYA 1BW9B 1C3EA 4NH0A 2Z30A 4NU8X 5A5GA 4TSFA 5DIFA 5KNDD 1GM5A 2VWQA 1SQGA 4DCPA 3K05A 4S0ZA 1JKMA 1P7ZA 1N6IA 4REOA 3LUFA 3O8NA 1RVV1 2O23A 1UH5A 3QNWA 1NJ6A 3UAZA 4OHPA 2XNJA 3L7YA 3QG1A 1RPZA 2JKYA 5LSAA 2QX6A 3OT5A 4AF6A 1H4SA 3PVSA 1X7WA 3L6CA 4Q00A 1OC4A 2PR7A 2QUIA 2SBTA 4L4SA 2GK7A 5ECGC 5C8YA 1QCCA 3Q7QA 4PHFA 4B7XA 5L3RA 2SHKA 5D2CA 5F64A 2JCYA 3P0RA 2DSTA 1TNDA 1ECFA 1TL7C 2PSJA 2D0OB 1AS2A 4P86A 1FRVA 2A4MA 4K6KA 4R31A 5KMGB 4UHEA 5LU8A 1N2BA 2G9RA 1X7GA 2O5RA 3GAMA 3M1YA 5L7TA 2RJOA 2OB1A 2PLFA 1DXYA 2XUJA 4PFKA 4Z2AA 3ZWPA 3UZUA 4D9FA 2RG1A 2PZAA 4DV3B 1C1XB 4MLPA 5IZCC 4CLRB 2O1XA 2WD7B 4F04A 3JZMA 5EA2A 2VF5X 1O5OA 4MS1B 3G2QA 1QTRA 4JP5A 3FA2A 2N1MA 3IEIA 4FR2A 3JSAA 3RODA 2I34A 3KIPA 4EHNA 3BM5A 4NJMA 4MS3B 1R8JA 3FF4A 3TIIA 4D3XA 3DS8A 1WCWA 3KZ1E 4BKQA 3WHIA 3TNFA 2X8JA 3NFYA 3SE0A 5KJ1A 3COSA 3KJXA 4YP7A 1HH4A 3E53A 4YJGA 2UXBB 3OHPA 4EG7A 1RWXA 2C3OA 2R8OA 4IJ5A 3E2PA 2G9ZA 2A5GA 4GP9A 4U1RA 3I4LA 4OQEA 1IUKA 2HU5A 1GL6A 2EZ4A 2YWFA 3ND8A 2GMWA 4Q02A 3VKUA 5E3JA 5KOHB 5JJCA 1RU3A 2GESA 3TLGB 3FTPA 3IMEA 4MXDA 1PYOA 1H2AS 4IVPA 5EZQA 3ENQA 4L07A 2CXTA 4DG9A 2VEDA 5ECYA 2WJZB 3QV2A 4XGQA 2PHZA 1M3SA 4LDQA 3A31A 2GAIA 1E0AA 4PXYA 2CDRA 5CDFE 2LCFA 3DEHA 1YQ9A 4BAGA 1QLWA 3ELYA 4NMLA 2BGNA 1WU8A 3EEIA 1PZGA 2DPGA 2HJGA 1M1YE 5JAIA 4LMBA 4Q39A 5HKAA 3NYIA 2RK3A 1YZUA 2QYHA 1KBZA 5E2AA 3G2NA 2XCSB 2PLAA 2YXBA 2Z1NA 4O2AB 4IJVA 2PU5A 1GNVA 1PR4A 2QZ4A 3FWYA 5C5IA 2WKQA 3RR2A 2ZWMA 4WSOA 2JD1A 1I1HA 1TDJA 2Y05A 1T15A 1W36D 4M8KA 4MWOA 2CV0A 3MMSA 1VLQA 5KKCA 1ADGA 4KN6A 2WHRA 1XA4A 4N49A 5G53C 2CV1A 1EB8A 1KJ8A 1A4RA 1XE3A 3BIFA 3K96A 2Y0PA 3DW1X 4AD8A 4GVXA 2HI0A 2YRWA 4LQLA 3TR6A 1MAUA 1A8HA 1ZI6A 1OZ0A 3WGOA 1FW8A 2OGWA 3NZEA 1SC6A 3RVNA 4A2WA 5IDQA 4XZ3A 1EUDA 2Z8XA 5DLQC 4DA0A 4DR6B 1G8GA 1H6CA 1UWKA 4JWKA 1T2NA 3PIRA 3KEGA 4UBJA 4DOMA 1U11A 2A88A 1Q0PA 4HQNA 4EGQA 4R81A 2FX3A 3OIFA 4DMUB 3VUFA 3TFOA 1N75A 3AETA 3E18A 3IT2A 2J09A 3ILVA 5H3HA 4QVKA 4KOAA 1P0CA 4MITA 4WDRA 1GTSA 2VK4A 5I7SA 2AXQA 2H1LA 5TNXA 3ED1A 1AIPA 1B6SA 3G02A 1UK6A 1N3BA 1QOPB 3LDUA 3TMYA 4MK4A 2DUMA 5L3QB 4EJSC 3DKVA 5CLGA 3H5AA 4JJGA 4K9PA 1FFWA 2UVQA 5GZ3A 1P5FA 2A1UA 2AEMA 2LIVA 3AESB 4FX2A 4I55A 5CXSA 2ZYWX 2BMVA 1KYZA 2C5GA 3GLHA 3K9GA 4L5YA 5EHIA 2V7UA 4K6GA 4CG3A 5EJ9A 5HZKA 1QR2A 1XHEA 2GCEA 3BGOS 4JGGA 2Q45A 3NHFA 3PGJA 4O02B 3V4ZA 4FFOA 4QARA 2OAEA 2HQRA 4GX2A 1UPCA 3DPUA 2CJYA 3DCYA 4HGQA 4FYVA 4S1WA 4WCFA 4PZAA 3B3FA 1VLJA 3KVOA 4XDHA 2IBTA 5LNK1 1M2FA 3R9XB 1IN1A 2XB9A 3AL3A 2C98A 4FZVA 3OEEA 4D4IA 1QU3A 4JGIA 1SEPA 1A8QA 1X80B 2OCGA 1JA1A 4GE0A 1GARA 1UOQA 4A5SA 2C92A 1O97D 1MAVA 3PXAA 3WGMA 4AMVA 4BVGA 3A6ZA 2JG3A 5HBGA 3PUWA 4IWNA 4RU1A 3IJEB 3QX7A 4KZKA 4LJ9A 2DFKB 5ALMA 3ZLJA 2DLNA 4D3FA 5BV2P 1D5CA 2WICA 1L7VC 1MOZA 4Q1BA 1CETA 2Q3CA 3DDOA 4G1UC 1C7JA 4YNBA 5KWIA 2VQEB 5T57A 4BNFA 3DFMA 2YOGA 4M1KA 4UQLA 5CLJA 4C2UA 2VNHA 3HWWA 2W2KA 3WYFA 1BS2A 1IUPA 4MQFB 4IFTA 5FPYA 3HDHA 4TXHA 5AKZA 1DEXA 2FI1A 5BOSB 4PIVA 2ZRNA 3BK1A 4FS3A 5DN9A 1PWXA 3UOAB 1BXKA 2HL6A 2PNFA 4YV1A 1XZMA 5C32A 4J7UA 1EUDB 1O9GA 1IZ9A 2V7EA 4GI5A 1RP7A 5FL7D 1IM5A 3MWEA 4GPTA 4DDWA 2YTZA 4Y6GB 5JYBA 3U31A 4KXFB 3M89A 2AKAB 5GONF 1KY4A 5LZ2A 4EQ6A 3VR5D 4A0SA 4J8PA 3FNIA 1YCGA 2RGWA 1FLDA 2XAUA 2QW0X 3VYRB 1NY6A 1KFEB 1P5ZB 3AHGA 2CMDA 3KHUA 3M6UA 4BP8A 4ENVA 1FE8A 4UREA 3HXOA 1JG2A 1JQLB 5F3DA 1O0SA 2DWOA 3C3YA 3VR3A 4XASA 2CCKA 1KMNA 4M9ZA 1JECA 2L18A 2GK6A 2O8FA 4LSWA 4PYRA 1GG9A 1PBTA 3AUFA 3ZJ4A 5JCOC 4GSYA 2EWMA 3E03A 1V96A 3ESZA 1UZLA 1FX1A 3K73O 1MC4A 3NHPA 1AK1A 3MT9A 4FNGA 4FNMA 1AMUA 4OFZA 4DLUA 5JH7A 1MGOA 3M9LA 3Q4GA 3WGUA 5I6DA 1NPTO 3DYIA 1M1YA 3GQBB 5BSVA 1PV4A 1RXWA 3IXLA 1G41A 4NYMR 3TXYA 3AGPA 4A16A 2QTVA 1XEXA 1LBTA 1FTWA 1R88A 4GXNA 3FLMA 2ZQ5A 1D6JA 3TPCA 2OBYA 4D3SA 5IZ4A 5HKKA 2G63A 2G9QA 3A06A 3SS7X 3E9CA 4KR2A 4ZI7B 3I8SA 4H1HA 4RHFA 1FRZA 4LQ4A 4R8MA 2XW6A 3CPSA 3P71T 2CHQA 2I62A 2BUCA 4MKFA 2G76A 4XTCS 1X87A 5JXJA 1XX6A 2ZANA 4WESB 1RWQA 1P5HA 2Q5JA 3DEKA 4UD6A 4F3NA 2NACA 2VSOA 3EODA 2TMKA 3UOWA 1S01A 3KSZO 5CT5A 1QV9A 1U8YA 4QXPA 2RH5A 5KNBH 3E7XA 2PBZA 1CB7A 5TDHA 1JE0A 1NF8A 3ON5A 4CL3A 4DJEC 5AW6A 1J1UA 2V54A 3HDGA 4LY3A 4LOIA 1E1DA 4L2IA 3H2YA 1XTBA 1JB1A 2C57A 3M33A 4HGRA 4AS2A 2IHUA 3KQTA 2F62A 5E8RA 3FOAA 5BN5B 1CVLA 3CEJA 3D3WB 4LG1A 4PONA 4XWGA 4V3BA 5IYZB 3G5MA 3PLNA 3EPHA 2J7PA 1ZMXA 3BGIA 4MYHA 3MT7A 3OQVA 1RRVA 1GPWB 4AG5A 2FQYA 1B7GO 3TSAA 1F7UA 5K5EA 1BGXT 1G20B 3FDXA 5L7YA 1X19A 3IBFA 3EULA 1ZEMA 4ZCRA 2Z6UA 3UC5A 1SA0B 2I3DA 4C0AC 2JK0A 2HT6A 1J22A 4HQLA 3DVRX 3EXG2 2AOTA 1TVMA 4LOAA 3WJAA 3SR4A 3VNUA 1PJCA 4RE6A 4V0OA 4TS3A 4XDGA 2ZR0A 5B3LA 1A2KC 3JQ9A 4PZPA 4IGAA 3NS7A 2ZW9A 4F9GA 4OXXA 1QR6A 4ABYA 1IN5A 3QYPA 2OL4A 4QOFA 4IJQA 3RRBA 5HMMA 1P45A 2HWKA 3OZGA 1P19A 2HDHA 2RGEA 3UG6A 3CNOA 5EKSA 1SO8A 4UHBA 4B47A 5TMBA 1VLHA 4RY8A 4ESEA 3ROFA 1ODLA 1Q44A 1H2HA 2ZR7A 3N8KA 1WPXA 1W5EA 1Y3CE 5IDXA 3ROKA 2XYVA 4Y0NA 4O4HA 2YBEA 3WLKX 2BH9A 1R9NA 1RXUA 3SYNA 3D7LA 2MYTA 1A7JA 1ZGJA 1FEZA 5KX5A 1AKYA 3VKFA 4RTMA 3AR3A 1WW8A 1LFDB 5J23A 2Z5VA 3O8LA 3WK4A 4EECA 4LMRA 2QRPA 2A94A 1N8TA 3PB3A 1XXHE 1OKKA 5THKA 2DQZA 3MOGA 5CVJA 4ZAZA 3LW7A 2NX2A 1BWSA 1U8TA 2EJTA 4UQOA 1W75A 2GFHA 1W52X 4TUYA 4JOQA 1LCIA 2DCMA 3K0FB 4MPJA 2C42A 1UBLS 1PDOA 3AF5A 3ZUPA 3OZUA 1NF2A 4F60A 5JATA 1E2EA 1UPBA 2YICA 3ZWKA 3FIJA 1P72A 2B8WA 4KWTA 4YWJA 4XEUA 5E1OA 2C94A 1CT9A 3FDZA 1AXGA 1D0IA 2XUPA 4N7MA 3TKYA 1E69A 3JRNA 4EB8A 1GFWA 4QDKA 5ED0A 3R7DA 1QDEA 4BXOA 3BCUA 3H4IA 1X9GA 3INTA 1V26A 3G49A 1Q0SA 5KYUB 4F4HA 3IIIA 2J5BA 5GPBA 8GPBA 5EPOA 1VMEA 1RI3A 3P94A 4AY4A 4EITA 3WL3A 4RPGA 1BROA 3JQCA 3K6KA 5EE9A 4GRDA 1HKHA 4BN5A 5F7OA 5HKKD 3UJCA 4BP9A 1XZFA 4B1FA 2ACKA 2H2HA 1Y4AE 3RU9A 4TTAA 1QGYA 2WI8A 1XFDA 3JSXA 3SI7A 1C9JA 2QL7A 3CNEA 1UMBA 3IAHA 3KVNA 1S2LA 3PGVA 2DAPA 3WNBA 1CUCA 3WL6A 3DEZA 1L0BA 3DA8A 1R4MA 2H7YA 4N6NA 4B75A 4MV1A 4YRGA 2WYIA 3BWYA 1X9HA 2HADA 1M5RA 1P2UA 3GOQA 4FFNA 3GR6A 1Z07A 4WY8A 4OI2A 1W36C 5I51A 1QJCA 2J6HA 2Z6QA 3A04A 1ADFA 1L4NA 1OU4A 3A37A 5JS2A 3U3DA 7GPBA 10MHA 4CF4A 4PZ9A 3SXUA 1VKHA 2D5BA 4XXHA 1ATZA 1FDTA 1GGNA 1FSSA 5AM3A 5EP4A 2ZK7A 5I9MA 5AKEA 4EJ0A 1XROA 1U3FA 2YRXA 4QRDA 5HRCA 2CLSA 4L9SA 2A4KA 4X1KB 3QYFA 2Q2OA 2BGRA 4RMNA 2B6HA 2VT2A 3KYDB 5LOVB 5K0EA 3KTAA 2OP1A 4HWGA 5ES4B 1VHDA 2JZCA 2JIQA 2WSIA 4LF8B 1CWUA 1QFMA 3L6DA 4DJAA 2VJQA 3UV3A 4ZYVA 5ED4A 3F90A 4LTDA 3UA4A 2GZRA 1J7KA 4INZA 3PL1A 3NM5A 1COWA 4ZAVA 1RABA 4HPWA 1Y9JA 3GT7A 3JZIA 4DEXA 4YT8A 1U7XA 4YP5A 4ER6A 1EVKA 2AGVA 5LB4A 3D2LA 3QPUA 5L51A 1T5IA 1FS5A 2YZMA 4BGIA 3PHGA 1RXYA 3VO8A 3QE0A 3ABRB 2JGIA 3EIXA 3GUHA 4FK8A 1DU4A 3FRHA 3RBVA 2RIRA 2R2GA 1AHPA 4QDZA 3BZUA 1VBMA 1YR7A 4HADA 1G66A 4F9FA 1UBNA 4LJLA 4FDTA 4QUHA 3AUKA 4C4ZA 2QQFA 1YMVA 3ZIDA 2G28A 3DC2A 3K92A 1PT6A 1FB5A 3CURA 3UMCA 4DJFC 4G5SA 4DMGA 1I6WA 1MQ9A 2FUKA 3NTLA 5EESA 1QP7A 2FJUA 1YKFA 1FVFA 2G1JA 5D3ZA 3S99A 3OCZA 4HFRA 1JHMA 4D79A 1FBNA 1Y6FA 3BA1A 4KXLA 2CJPA 4R9RA 4CM1A 4HFMA 2P65A 1HLGA 2BPOA 2ANBA 3PFNA 4KDEA 2FMUA 4PHCA 1R4AA 1U9CA 3AR2A 3D3KA 1JFFA 3NBXX 4NY1A 2JIZA 2JVIA 4O1IA 4JUAA 5EHGA 4DQ0A 4EA6A 5HGXA 3LA6A 1ADJA 2C2MA 2XE4A 1Z37A 5IBPA 4EHLA 5AW4A 1CQZA 4K9OA 1QHNA 3AVQA 1GIAA 2JIRA 4MKGA 3U0VA 3U4CA 3VC1A 1OH6A 4F3CA 3GXBA 1QVAA 1ECLA 3KOXA 1FQKA 2ZSDA 1N8NA 1NW3A 2XHZA 2W11A 2VSQA 5B53A 3O3MB 5CT6A 2O8BA 1U4NA 2BDTA 4X84A 4I9NA 4IICA 1GG8A 4PLVA 1UWLA 3QW2A 5KVSA 4H7KA 4JVOA 4WK0B 4EX6A 3VPBA 3D3JA 1E79A 1COZA 2FMTA 3QSYA 2VDOB 4MLZA 5AR1A 3S70A 4IBOA 3ZCPA 2BFBB 4BEWA 2H4YA 2A92A 3D64A 4P82A 1U6KA 1X7YB 4J7XA 1GNTA 1T3ZA 4WQMA 1EFRD 4MPDA 5EUCA 1B42A 3D7KA 3GHHA 4DDHA 4MS1A 3GJRA 4AY5A 4BRSA 1SIOA 2OZLB 1SUFA 2ZSKA 3N86A 3WFZA 1T36A 1JAIA 1QS0B 2BSXA 4C3OB 3WI7A 3QU7A 1HYQA 1TX4B 1JMVA 4BE4A 3LPDA 3R9KA 5IU6A 3J80A 2R7MA 1EUCB 4OA5A 2WZDA 1YZGA 2EBWA 2CWDA 1S1MA 3EZ6A 2KX7A 5EZYF 3SZGA 1D2EA 4RADA 4YMHA 4IIHA 1L4LA 2D2XA 4NCIA 3T3NA 2XITA 8ATCA 1H3FA 2IPAB 1EVJA 2ZREA 4K26A 1B8VA 2O8DB 4Q4AB 2XUKA 5BSEA 2H51A 1AXEA 2ZCUA 3W0LB 4ARUA 1NW5A 2XODA 4FZ3A 2P7IA 3USZA 3CX8A 3B7WA 1OWNA 1H4TA 1W85B 2H5JA 1YRQA 2FN4A 2I2WA 2NU6A 2FQXA 1KYWA 3JYQA 4MV4A 1KEVA 4AZTA 3C97A 3ZYZA 4TT8A 3BCHA 5KOHA 1WVIA 3QI7A 4GUDA 4Q4DA 1MEJA 3HFGA 5KAPA 2IOFK 4DCSA 4QTZA 5I01A 4A2PA 4H16A 3ESXA 3REOA 1UFKA 1TTQB 1DKNA 4OHOA 1IQRA 3ZQ6A 3WWCA 4GW3A 1LBHA 3O47A 2CXOA 3NDRA 1MJHA 1TADA 2IDJA 3CVJA 4NI5A 4OCZA 4Q4LA 2FMXA 2V3VA 3F78A 1Q77A 1XWFA 1J06A 2XMZA 1I24A 2YHBA 2Z58A 4QXMA 2I2XB 3ADBA 4ILKA 5CB4A 1JR2A 4RESA 5IT9A 4LBZA 1OR8A 4A8HA 2MINA 4KITB 5LZ4A 4O4IB 3IODA 4TT3D 1P91A 1RCFA 4A0GA 3DSRA 4DYDA 2VJDA 3W5UA 2WWGA 2Z5LA 1WXWA 3OF2A 6GPBA 4RWEA 4JMLA 3AG5A 4EYGA 4BP3A 4ZVUA 1IAVA 4TL8A 4FFWA 4OQ4A 1BCRB 5EIAA 5JT1A 3C3AA 3NX4A 4PM4A 2EW8A 1C0LA 4ENPA 5BWCA 2A5DA 5ITZA 3HXKA 5ALDA 2O3SA 3Q6NA 3CGWA 5LBTA 1TPYA 2A0WA 1JHDA 2O7NA 2BY4A 1S89A 2WSLA 3I2IA 3LYUA 3OIDA 4FUTA 4WXHA 1BYUA 2REQA 3K71B 1PR3A 1B2LA 2GN8A 1TUBB 1PR6A 3R76A 2HK8A 5AJUA 4PYLA 5JFTA 1QM5A 1U98A 3LUHA 4M9UA 2ZYIA 1V1MA 4OQNA 1TAGA 4W9NC 4ZT7A 3WLHA 4EQ6B 5A7FA 2NSDA 2Q3BA 3VNBA 2JCBA 2F8SA 4H7DA 1V9SA 2FPUA 4LTMA 1G5TA 4DIBA 1Q5PA 2IBMA 2PYDA 2FR8C 1ZBQA 1SXJA 1V4VA 3B51X 1A2BA 2AF4C 2DBYA 3ZEIA 1MEOA 2ZBRA 3ND6A 2FN8A 1XPRA 1JR6A 4JJ7A 1PR9A 3JQ9C 1A96A 1DC5A 2GFIA 2YOFA 4PYIA 1L8LA 1ZD8A 1L7QA 1PUIA 2PMFA 1JZQA 3C85A 3OIVA 1M2HA 3ADPA 4NONA 4KYVA 1CY7A 1YOVB 2GAAA 4X1OA 5JD4A 2DOKA 2EJUA 1XQXA 4CIBA 2GHRA 4GPBA 1I2DA 4ND2A 1N0IA 2WWXA 3HP1A 1ABFA 2CHUA 1YL7A 4JQZA 5J40A 5DCUA 4YBRA 4DIEA 1E79D 4PX9A 1BD3A 5EQTA 1J0AA 3QNMA 1C7EA 1T2CA 5JS8A 5CU7A 3FYTA 5IS2A 4QFMA 4EG5A 1V8OA 1OVMA 3RHZA 4ODIA 2VSXA 1EP1B 2PSHA 4FIZA 4Q3OA 4C0QC 1RPTA 1QC5A 3SOPA 3T4EA 2CFTA 4C0JA 2XGJA 1ZHOA 1KAOA 3QLVC 2OGTA 2I4IA 1V1RB 1IVSA 3UM9A 1KSJA 4ZVMA 1M67A 4II7A 4Q3BA 3TCKA 2H5IA 4XGIA 2WJ3A 1EHCA 2Q0HA 3K9WA 1NOIA 1GPBA 2QOEA 3Q10A 4LXYA 5BYJA 3SY8A 4A3SA 4CM4B 3CVUA 1GUBA 1FF9A 2BEKA 2V5VA 4DLBA 2PANA 1C3OB 1XJCA 2E6UX 3ZHQA 4DJJA 1B43A 2C4HA 4FFBA 1Z4JA 4H6VA 2L0XA 1SB9A 4L0CA 2WKSA 1DIAA 4R9NA 3T0IA 2R66A 4OP1A 3BYZA 3DMGA 2BMDA 4ZT3A 4YRFA 3WY9A 2EZ8A 3DDZX 3OEWA 1WULS 1Y42X 1LLFA 2HBRA 2WE7A 1OA1A 4UBNA 2IP1A 3SR0A 5AKLA 2VXBA 3G6WA 4F5ZA 1X7ZA 1MMFB 1UBFA 2FR1A 3GFTA 2FPMA 1WUJS 3HB0A 5TR9A 1G8PA 1Z17A 5E3HA 3RC7A 1FXSA 4TKUA 5DI3A 3KKZA 2ATCA 5K0GA 4DCMA 1NM5A 2I54A 4D25A 1U3VA 4FMPA 1CQIA 1K97A 1N5JA 1BYIA 2ZIGA 3KAQA 1A9PA 5EXSA 4B2YA 4BFLA 4CL0A 4D9GA 4FP9A 5DM60 3FDIA 1W2GA 2BGMA 5FCDA 5JBQA 4NP6A 1OX4B 2CLFB 3QRWA 3E58A 5FO1A 1PJ8A 2ZYAA 1EH5A 4HGZA 3TTYA 2GZ1A 2Q6KA 4UVHA 5CFMA 3ZPXA 1FZTA 3FCUB 1AUOA 4CFYA 1YI0A 3K1YA 3EUFA 1OGYA 4D9HA 4KN9S 5JH7B 1MCZA 2LIPA 2V65A 3IR7A 3P32A 3QH4A 4HNAB 4I1VA 4QEZA 4TGLA 2HQBA 3OOYA 5KWEA 1WDWB 3JQDA 3KD3A 4F2GA 1TVKB 1YB7A 2GERA 4QLOA 3OPXA 4BNUA 2HLNA 3DW3X 3E3AA 4XD7A 3DLPX 1QQ6A 2GXQA 1JG1A 3MCZA 4CMKA 1NYTA 5AVSA 5I7HA 3TTTA 2J0SA 5JCJA 1TVKA 2QL9A 4HQFA 3RYIB 5BYAA 4Q66C 1QIEA 1XAIA 4P34A 1G19A 4BRUA 1I3MA 2QUKA 4MNTA 3ORRA 3NOQA 3VZSA 5EJ7A 4KKVA 2P9TA 4INJA 3RYIA 3GL9A 3ZU3A 3NQ41 1FP1D 1LPPA 2IF0A 4G67A 9ABPA 3KOOA 2HRZA 2M6SA 3TNDA 2HSDA 3EY4A 2OFOA 3MIIA 3OWOA 4O1MA 1G291 4G5GA 3VR6A 1DKQA 1E7SA 2JJ8A 3MTJA 4JXJA 5L40A 1PHRA 1JRLA 3FFBA 1SCIA 2II6A 1CS4C 3WWPA 4ENUA 2CFSA 4PYNA 4Q9AA 1ENPA 1T1JA 5HK9A 2OB2A 4GOJA 3WQSB 3W1EA 1PG0A 1H3NA 1XWIA 1Z36A 2WT4A 4KGZA 1U2SA 4AN0A 4BECA 1NXXA 4MVJF 3LPCA 5C80A 3K4PA 1H8EA 2JASA 3U5ZB 4D0RA 2QYSA 3C6BA 2JFWA 2FW8A 2Q29A 1ID8A 4JNKA 1SCAA 3E3OA 3R5XA 4RVNA 3IL2A 3ZXXA 2VHCA 4U5QA 1IXRC 1H6AA 2Q9AA 1T9GS 1CVIA 3HRKA 1MB4A 2OLEA 1TF7A 3H65A 4TV8F 3T52A 3RV3A 1JJ7A 4EZBA 3EOBI 1UBTS 2Z1DA 5DTJA 3VR5H 3KJHA 2QAGA 4Q7QA 3HKBB 4DWVA 1XUOA 2E0IA 3A1NA 3GPBA 4AMZA 4ZOAA 2X4DA 1TYBE 2GZAA 4XUEA 1Q3TA 3N28A 3OFVA 4O4JB 2I3AA 1DC7A 2RGCA 2YMLA 3KQNA 1IM8A 1VHJA 2IYLD 2D5CA 3C7AA 4MOWA 1J39A 5C31A 5CLLA 3TD2A 2F67A 721PA 5JDCC 4OFWA 4ECEA 1CUZA 1GLNA 4MB6A 5CAEA 2VDVE 2CUTA 5I9IA 2CKDA 2GZHA 5E7QA 5ALNA 4FFMA 1WB6A 3UMVA 3VI3B 3KB8A 4DEVA 1CV2A 3EZFA 1K3UB 1ESNA 3KL4A 3O2SB 2QG9A 1MA0A 4GMXA 3NEJA 5J9FA 3ZHSA 2Q2VA 2XOEA 3EH2A 3JAWA 1B1CA 2QE7A 4B4OA 5GJWC 5A5FA 5LMUB 3QTLA 4WBSA 1QIMA 3CRZA 3NWJA 4PX5A 1DGQA 1UANA 3CNHA 4JUDX 1R0WA 3E5NA 3UJ6A 1OBHA 1EBBA 1VPDA 2R7AA 4HFJA 2XR1A 1AX9A 3I30X 3LKZA 1BN6A 3REQB 4BP1A 3NM4A 1J25A 1OI2A 2UZ3A 5AJTA 5IAOA 3JARB 1IPFA 1TJ4A 2NT3A 1NHWA 5L3SB 1LQTA 3ESCA 1Z26A 2C4NA 2HU2A 3DCNA 3ETHA 3LP6A 4H35A 1ECGA 5TV2A 4MEJA 4F92B 3EA4A 2A5LA 3ZWAA 2QPLA 3I45A 2I55A 3DOCA 4QRIA 1TFUA 4LXIA 4IXMA 1CYEA 4GXTA 5KB3A 1P61B 1E92A 4B3XA 1Z35A 3GEIA 1SPXA 5BUQA 1UKBA 3EUEA 3FOEC 2C4TA 3MWGA 2QRUA 3N6VA 5CNMA 1ZUNB 3JX9A 3VTFA 4C78A 4EZEA 4POOA 4A8JB 2PVPA 1Z0FA 4BB6A 4QM7A 2QZZA 1CF2O 2ZSIA 1Z2OX 4EY6A 2RAFA 1USVA 3D3NA 2V7VA 3CBQA 3K0FA 1AD2A 1RLTA 3FDFA 1C4WA 1ZGCA 3HMQA 4JS0A 3THWA 5CVDA 1FDSA 4U0KA 5BN4A 2C1XA 3Q12A 3DZKA 2W2LD 1N3IA 4IH1A 1D9XA 4TSRA 1OE0A 2PJZA 1TMGE 1NJFA 2XKJE 4X3CA 1BMQA 4ROTA 4URYR 2FF5A 3WHPA 5A4AA 1JN0A 1KOFA 4EFNA 1LDYA 3R4CA 4C7JA 3VHLB 2WWRA 3H0EA 4RHCA 4Z7OB 4CKCA 1EGVB 3EWAA 4JCOA 1SK8A 4LZWA 1DG1G 4P4SB 1GT6A 1E9VA 4DQUA 3NUGA 1C4OA 1Z5PA 4P3XA 4QTXA 4BAZA 2ZYDA 4TLEA 1BW9A 1ZM3A 2J33A 3FUWA 1N0WA 3L41A 4L5AA 3C70A 5NLLA 5BURA 3IEKA 1I01A 4W8GA 2W6CX 4IX1A 4YRKA 1QQBA 4UMVA 2I4LA 3WZMA 3DOUA 2ZYSA 3E82A 1XRSB 1DJOA 1UEIA 3UHOA 3L0SA 4NBUA 1JNYA 2QTLA 4AJ9A 1XMXA 3EZGA 2NU7A 2O0KA 1SBZA 3P2YA 4X20B 1X1SA 3ZGXA 1GR1A 4HVCA 3V80A 4IQGA 4Q9NA 1PWYE 5EZYB 1OASA 1H8ED 1VMIA 2VHUA 3F1KA 4ARSA 2PXAA 1B73A 2FLVA 5AI0A 2C8KA 3AFIA 1OI4A 4NE9A 5DK4A 2YUTA 1IXZA 1ZH6A 1O6ZA 1YJXA 1XQ6A 1HDYA 1JXMA 1U90A 3DJYA 1NKVA 4I7EA 4MHSA 3HUDA 2QXUA 5E6RB 3T5GA 5KQRA 3N8IA 1C3XA 3FCAA 1WKBA 1N5LA 2VRCD 1PQPA 4G0ZA 1IHXA 4NJEB 2YIDA 4DC1A 1CEYA 5TGTA 1LY1A 2W4QA 4HNGA 2C7RA 2C54A 2I76A 4HB0A 4WFIA 1VHQA 5HF5A 4HUQA 1W5FA 1HDOA 2VS1A 3JPWA 5ALOA 4UPDA 1NM5C 1TJPB 5FI1B 5E8JA 1EGMB 1ZJWA 1HF3A 4OYYA 5E6SB 2FSGA 2C07A 4EENA 1GGFA 2JGDA 4IFIA 5AVVA 1LA2A 4AWXA 5EE3A 4F5DA 5DO9A 5JC1A 2ZB7A 2EP5A 4J4TA 3E1KA 3T95A 1R9MA 3C3MA 1T0PA 2YVQA 1OYYA 3F4KA 3JALB 3KQQA 2B4QA 5KYKA 2P6UA 5KYWB 1XN1A 3MFYA 2PXCA 3EWNA 3OF3A 3GZ4A 4IVQA 4CIVA 1VB5A 3CLSC 1NDQA 1WPRA 3MF4A 4ZOBA 5EXEA 2QE7D 3N8NA 5I7UA 1ZESA 3KPVA 2ODBA 2QP9X 2VHQA 4UAGA 3PF8A 3V9AA 1YMQA 2N9UA 1GL7A 1UBMS 1YRWA 5EIFA 3RTCA 1OHHD 3U56A 4RCYA 3U3KA 3ROTA 3BCRA 3ZHRA 5BYKA 1KDTA 1WMBA 1UBJS 5B4TA 5FI3A 2CF5A 1SHZA 2REBA 3AF3A 2CV2A 1LXCA 3LFTA 1UBCA 1CE8B 3TJZA 2ZJYA 4BO6A 1AKMA 3AL0C 1SELA 2PTGA 1PW7A 2WHPA 3A4MA 3KL2A 3M70A 3SF8B 5K3EA 2DLDA 1AQNA 3VH3A 3C6QA 4G0UA 1BOOA 3FDJA 4V0RA 4Z8XA 4XB1A 2ZRJA 1PN3A 2ZATA 2XMCA 2HEGA 1U0FA 3QSGA 1AGNA 4GKVA 1VSQA 3UHPA 3STWA 1E63A 3CMCO 5ARCA 5FTJA 1ZVVA 1AOXA 4L95C 1QVZA 1SUIA 3BAFA 4I4TB 1BN7A 2BFDA 2YHIB 4RXUA 2HCJB 3K1AA 5CD9A 1QUFA 4CQMB 5DM70 1SOUA 4MROA 4NH4A 3ELBA 1HT3A 1YACA 1LW6E 2PUAA 4P08A 3B9BA 4X6LA 1ZAKA 1LF5A 4JQSA 3DXYA 4NARA 4QL3A 1SH7A 3T61A 3BREA 5IM4A 1WY5A 1P62B 2QRHA 3P9YA 1EX7A 5GWXA 4CFZA 1JS1X 3VR6H 1GN8A 2Y27A 4CV3A 1T0JB 4DIFA 3HWSA 4MR8B 1VLVA 4BQIA 1EUCA 5JS1A 1ZI9A 1OC2A 2C2KA 2DHCA 1GLGA 1U99A 2I2CA 4O63O 4URWR 5DW3A 4E6EA 4N7JA 3V1YA 4EB0A 1N32B 1TUBA 1CR0A 1VRVA 1W8IA 2VP3A 3JQBA 1TXGA 4GICA 2B4YA 1Z88A 4L50A 2XXJA 3H5WA 3S5JA 3AIMA 3GD7A 2D62A 5SZKB 3W05A 3AG6A 1CUJA 3C8MA 3RSQA 2WV9A 2BELA 5AVYA 2BHLA 2AFIE 4QJIA 2RHRA 2DZDA 4IIDA 3ZC3A 4WA8A 1YZFA 3KYBA 1M6NA 5FWXA 5J5AA 2Z3WA 4BN4A 2DXIA 2IUEA 4GQBA 4WVLA 5ERYA 4EHDA 3M5WA 2P3OA 4F4JA 3PRJA 3TDKA 3U49A 3QLUC 2YVLA 4DNPA 4DR4B 5F77A 4TYYA 3KR2A 2FOIA 1NNI1 3CSUA 1Q84A 3O1HB 1Y1SA 3W7BA 3O9MA 1EWYA 5EMHA 4CHGA 1NF3A 2FQ1A 2FWMX 2X8BA 3VZQA 2CDAA 4G26A 3EWSA 1F4VA 5B3AA 4Y2TA 1KEEA 4J9VA 1II9A 3BFVA 3LAWA 1IOLA 2QD4A 3T34A 2Z4RA 4BFTA 1OH8A 5K0FA 3PD7A 2Y1DA 4QWWA 4BUCA 4BX0A 5C7LO 3WGJA 3WMGA 3S8EA 2Y1FA 1VG0B 3OC0A 4LCJA 3VTZA 4BVJA 5CUQA 3BSWA 5ELXA 4LSZA 4KXWA 5AD1A 1LQUA 1U9IC 3O74A 2CNNA 3EF1A 5CNJA 2JLYA 4GZMA 3UQYS 4CCWA 2ZRIA 4IXDA 1RBQA 3VA7A 5J2TF 2GXAA 3W6UA 2Q3FA 4O8CA 1AZWA 3L2OB 1VPLA 4MUNA 4PRZA 4DB2A 4B3RB 4LHEA 5EIHA 2QMZA 4Y2JA 3INRA 1NA5A 2BRUC 3DLAA 3L7OA 3HKCA 4P54A 4MW0A 4LA4A 3WTCA 4FEEA 1JHXA 3AF4A 1KWKA 1C1DB 1QWOA 1HBJA 2WF6A 4CGZA 4YB8A 4RTKA 4DQVA 1HV8A 4W9MC 3K30A 2O2EA 1C3LA 4YV0A 5BR8B 4DHEA 1RQ7A 4DLWA 5J47A 1FP4B 4RMJA 3N0VA 1RAHA 3O3OB 3A1FA 5JZBA 5HMLA 2A0YA 4PIMA 4JJIA 1GA4A 1T2UA 4OLBA 3AF0A 4KX5A 1TJ3A 5GMOA 4C6RA 4EGFA 1B0PA 4Q0MA 2HHHB 1WZUA 2WIFA 4I4IA 4NJMB 2IXEA 2VP6A 5EOVA 3RADC 2JVKA 4DQDA 2WF5A 3ESYA 1RC0A 1MQAA 4NKRA 2HXSA 1QRAA 3IHLA 4ROSA 1V5EA 3A3NA 1P3JA 2AK2A 4H3SA 1KZYC 1ISRA 3GA5A 2P4EA 1EQUA 4ZZ0A 4QRHA 4L57A 1GT91 2HZ7A 3NCTA 4YP6A 4EG0A 2ZJ3A 1NVVR 4JBLA 2WWVD 2F6RA 2FEKA 1E5DA 4GSLA 2ZUTA 2NT4A 2QGNA 4TXJA 3ISTA 1ZVKA 4FOOA 4WK2B 1H4VB 3S4YA 1GXSB 2OUIA 1PKEA 3CIFA 3QM1A 3MSXA 1U7ZA 3E9EA 1T4MA 1RWPA 4OBBA 1BSVA 1KO7A 1JPUA 1T9AA 3R5TA 4WLNA 4F5EA 3K70D 1E32A 4Q24A 2BKAA 2C2OA 4Y6SA 4FFDA 2GEBA 4B48A 2WIDA 3HJHA 2P9FA 1YOVA 4IQFA 5CGZA 4PLHA 4RK4A 3C15C 4GKKB 4DZRA 4R7TA 3RGWS 1A1VA 1BGWA 2AZTA 4ZREA 5K0ZA 1P1IA 1L4MA 1QMPA 3WADA 5BNFA 2JI7A 3F7MA 5JDIA 1DOZA 2CDNA 1YFZA 5DFAA 4JKYA 4BZXA 4ZI7A 3MCWA 4J91A 3NBKA 4KIGA 4QQNA 5K3FA 4EJ6A 3SX2A 1HTBA 1M8JA 2BTQA 5CEEA 2CUZA 2Z4SA 5B7NA 5KWJA 2OPHA 1Q83A 1I4WA 3B1YA 4JT8A 4RA9B 3F6YA 3HCNA 1S8OA 5LYYA 2PX6A 1ZRNA 2QRGA 2WHEA 3AR6A 5B1DA 1VCNA 1Z56C 3VRHA 1PFVA 2X5OA 3S3TA 3U44A 1LU9A 1VL6A 2ZIAA 4U0JA 3SHFA 4P5EA 1T4DA 1L6RA 1V8BA 4IJWA 4I5DA 3HR4A 3DUFB 1PEAA 4V0NA 4AO8A 3B53X 4XA8A 1O57A 2WQZA 3ENNA 5LN1A 1XQYA 1VP3A 2JLBA 4W5RA 2PFGA 2VYNA 1YCDA 1MH1A 1DO8A 2ZRGA 3BSSA 5TPZA 5ABPA 3QG5A 4MI3A 1OFUA 5KVQA 3ZGYA 1R6AA 4ZXFA 2REQB 1EWQA 4FWIB 4TYMA 3CF4G 2CCJA 3H87A 5CLFA 2UVPA 1MV8A 1Y9ZA 2QBYA 5CM2Z 1MX1A 2IHJA 1TEZA 2C96A 5AUQA 2Q9UA 2O3JA 2VTDA 4F5WA 3HR8A 4CLDA 2IVZA 3FTDA 4W63A 4MEAA 1YUBA 2JFBA 2KI5A 1W4BA 3G0DA 4E1VA 2I03A 5CA1A 3M3HA 4DF3A 4BJHB 2IXTA 1XZHA 4ZCPA 2DT5A 1GSIA 4Z9XA 4I9HA 2VYVA 4UEQA 4UU1A 4W7IA 3GJYA 5C7IO 5DNYB 1QXSA 2QZ9A 3EOZA 4DSZA 4R2LA 2QLTA 4HLNA 2OZPA 3HVHA 1SK9A 4GM0A 4XEHA 3RCBA 3X0DA 3FI0A 4PNPA 4IG4A 5DLYA 1IK6A 4Q3DA 3CJRA 1IDN1 2PKWA 1GUFA 4DIKA 5T4FA 2D1QA 2FMIA 3HJTA 4FEGA 2G5CA 4K87A 4R1NA 1H85A 2V7QD 3NHLA 1UJ5A 2QTFA 3T6KA 4BKPA 1G9SA 4L8FA 1Z5GA 4MRMB 4Y18A 2IYQA 4ZOLB 4PHTA 4HDMB 3WIUA 4C0XA 3LTEA 2ANCA 2G83A 2QJRA 4B8WA 1E3QA 4D98A 1JLLA 2WOOA 3AWDA 4NMXB 1W88A 1A0OA 3FYUA 4GHWA 5JPCA 5DOVA 1K89A 1ZUD1 4FINA 5EAIA 4MV0A 2ZPAA 2IIQA 2EKZA 4FZJA 3TSOA 3UJAA 3OOEA 4HKTA 2AG5A 2QTGA 3E22B 1U2EA 2ISQA 2XGSA 1H2XA 4CIDA 2GJ4A 1M34E 3RS0A 4CODB 1KEKA 3WNVA 1VIAA 4HH4A 1QF6A 4HF7A 2QVZX 3UWOA 2QJOA 3VR2D 1LX7A 2YFKA 3W5IA 2CXHA 3BERA 3L04A 1T8SA 2H3EA 2NZUG 1WP9A 2VPIA 4V0SA 1PWHA 1TCCA 1NBME 2FG7C 4TMVA 2D4HA 2VBCA 3DOJA 3GK3A 3O8DA 4PS0A 5LQSA 1JBQA 1USWA 3TBKA 4I1SA 1Q20A 1K7EB 2L42A 1I80A 1D8AA 4QU8A 4UHDA 1ZJ4A 1EFDN 2X4GA 2XXBA 5DCWA 2B1GA 5DMXA 2R8YA 3D4IA 1XL0A 2GOYA 13PKA 1AV7A 4BMPB 5DYWA 1U4SA 2FGKA 3C45A 1GGEA 3FCYA 3ZIAA 3KTDA 2GD2A 4V24A 3VVBA 2Q3MA 1U65A 4DHWA 2QD5A 2AG1A 1ZJ6A 1QWSA 1HQCA 2WINI 2YYAA 3IPXA 4J0KA 4GLOA 2PX5A 4PCLA 5JUWA 2IU6A 4W1SA 1LQ2A 5H8WA 4E22A 4E7PA 4C7BA 2E5LB 3OE1A 4CI0B 1EK2A 2BCEA 3TXAA 3B2QA 3PXXA 4EFKA 3H2HA 3GAAA 4LYJA 5DM1A 1IPHA 3D6NB 3GCDA 1IEXA 4IGKA 4NZMA 1XDDA 1TCAA 1KJQA 1GPNA 5JBIA 4OU5A 1OWLA 5JOQA 4ZXPA 2XLBA 3E1SA 1T6NA 3DULA 4DMFA 1XL1A 3GEMA 2W2LA 3AR4A 4JLPA 1DDGA 1G4AE 1M72A 2YVKA 4JA0A 4G0PA 4KJXA 5BNIA 3DAFA 3NANA 3LIIA 3RT9A 3F3YA 3O2QB 1N2SA 1Q6ZA 3C3PA 2BVNA 1CY1A 1NUUA 3TMAA 3UK6A 1JIXA 3K0AA 3U0BA 2Y2UA 4BYGA 4JBXA 2E3JA 1MO2A 2P90A 1SVMA 5F21A 3ZCVA 2QIOA 4YP9A 3OT1B 1FNDA 3A4TA 3EIUA 3Q9UA 4JOSA 5DGHA 1A9OA 3ERCA 1Q0HA 5KX5B 3VOBA 2OD7A 5CEJA 2AN5A 3QJYA 2OLJA 2AA3A 3HCOA 3P0HA 1HTWA 5FXMA 1IEWA 4TROA 2W9XA 1UINA 4J3NA 4EW2A 3K0SA 3BL5A 4X91A 4DEYA 4E3WA 2XVAA 4QO8A 5TPZD 3ZCTA 3TM5A 1MABA 3EEFA 3WLAA 4G24A 3VU8A 2YV4A 3I9FA 4F46A 4CR7A 4NATA 3DBLB 2Q6TA 4MHTA 3MW8A 1T9ZA 2LNDA 2WOJA 3AM3A 3SE7A 3PQ3A 2IE0A 2WFMA 4QGFA 1L5HA 5CDYA 1Q92A 1CRWG 3K1JA 4DUPA 1KI6A 4DM7A 1F12A 3RASA 1V3QE 2WMOB 4LGYA 3KKPA 2JLXA 5BW8A 1KFJB 3WYDA 2ZTSA 2H8GA 3LKVA 4NCBA 4B2IA 1K75A 5JADA 1B23P 1A9YA 1ULSA 2EZUA 5K4GA 4RAQA 3KUDA 2LW7A 5I4IA 1Z2DA 2IA5A 4RXTA 4E11A 4MUMA 1LJ8A 5IAGA 2JGDB 3J7TA 1IHDA 1SKMA 5KHLB 5I4CA 4FUQA 4RQTA 4CHTA 121PA 4TUYB 1H1DA 3DZGA 1C9DB 2CE7A 2VIIA 3HS3A 3PXDA 4OIFA 4I66A 3SD7A 3WDMA 3EXHC 3TLXA 1UK8A 4DJ5X 4V1CI 3AVWA 4AYWA 1QVVA 5DPMA 2VYFA 4JEIA 3WWOA 4HT3B 4Z4EA 1EGAA 2PX0A 3NASA 4OHKA 2XB2A 3U17A 4HWKA 2J5KA 4I5EA 5C51B 4B6GA 3KEFA 3C6ZA 3W90A 4CMBA 3GLFE 2G4CA 2QXTA 5CVUA 1TKAA 1WQ1R 3GP8A 4L73A 5FWNA 4J0CA 4JUIA 4W82A 4G4GA 3QENA 4WUTA 2FWNA 1Z4MA 2XTAA 1X42A 3RU7A 5JD3A 3CF6R 3DBRA 4ARZA 2DTXA 1GFSA 3EVNA 1DMSA 1TYCA 1OT5A 4BN0A 2V97A 1KP3A 2TRSB 1N5IA 2ZWAA 3PE3A 4TWJA 4ESHA 1K1EA 3Q85A 4JROA 3NTRA 3REFA 1R4MB 4CXMA 1I14A 3RK1A 1GU1A 1FNMA 1NSYA 4P5DA 1I1OA 1SZCA 4ARZB 1NGSA 3RIYA 4KQIA 2IOQA 3CTPA 4ZJPA 3A28A 4XVHA 4YCNA 1QHHB 2RB4A 3EAQA 3GUCA 3FF1A 3VDQA 2QKYA 1XK6A 3TZQA 1E5QA 3IOBA 4A9AA 3ZS8A 3F97A 2UXCB 2JARA 4J2OA 3NC1C 4ZDJA 3UY4A 3BD9A 1N25A 4RZSA 3CCCA 4ZU1X 2VDNB 4C06A 5IJ0A 3RS9A 4LXXA 4FN4A 1VG8A 3PNSA 2FOXA 1ZRHA 1C0PA 2I6XA 3EXIB 3KXLA 4JIMA 5LL6P 3AEQB 3GJZA 3SX0A 5A2QA 5CTAA 3KELA 4NRDA 3ZGOA 1J07A 1J20A 4QFDA 3N7AA 4PAGA 3GUUA 4OBWA 4AO7A 2O7VA 2YR0A 3GWZA 5JWHA 4YUZA 1W2HA 2O6LA 4FTWA 2ONZA 3HUUA 4URHA 3W5VA 4EJFA 5B30A 1BO6A 1OXBB 1FXUA 3PFIA 1JV2B 4YDQA 3DE2X 3GF4A 1JQEA 2OZLA 4YI3A 1B15A 1O95C 1S2IA 2XUZA 4G0YA 1OB5A 4OK6A 2WTMA 5CNIA 2XDQB 4QFCA 2VTVA 1E6KA 2A9VA 1GY8A 1J5XA 3OOWA 3ONDA 1GAQA 1UPUA 4A8JA 3I09A 1Q7GA 3WLEA 2DPXA 3O4IA 2QPAA 2XDQA 1TC1A 1XZLA 2ZJFA 3IP9A 2YMQA 4PE5B 2IHYA 2ZJ5A 4ZMRA 5LLDA 4EAQA 3CWQA 4WOJA 5GY7A 2AW5A 4A15A 4BVBA 3PJEA 3ORFA 4QOSA 3NTXA 4A23A 4OXRA 3WGIA 3I2JA 3IHWA 3OURA 2GPYA 2M1ZA 3L4KA 4Y98A 5GM2A 2XZOA 3H2BA 1NG1A 4KFTA 4XGKA 4YFYA 3JQ7A 3SJ7A 1YU9A 5KKAA 2LCIA 4JLOA 2LDBA 3SMQA 5CIYA 4GAEA 1XD2B 2VBGA 2XOXA 3GRRA 4B5LA 3JQ6A 4KFUA 5TEVA 2CLCX 3LBNA 4M83A 1SU4A 1T2VA 1W581 3FWKA 1NDUA 5G3ZA 3AUSA 4ZGGA 2QI9C 1O2DA 2DFVA 5KOJB 1QB7A 4EO9A 1YB4A 1S96A 4A5OA 1R64A 2WHPB 4YFVA 3MQFA 2PKXA 1GPLA 1NT2A 1GOTA 4L0DA 2J9XB 2JHFA 1AU9A 4UMEA 1VGVA 4G85A 4J16A 3J81k 1NRXA 5BVHA 1OROA 3QFRA 1EYZA 5EXPA 2D0DA 3OU7A 1IBMB 1BMFA 2C8JA 2OCKA 4JQOA 5FUYA 4BV9A 1CQJB 4F7DA 2AH5A 2PMKA 1D0SA 2FZGA 4UM7A 4YUWA 3LM8A 5HQTA 2IH4A 3PLAE 4YMUA 3AC0A 5TJ9A 3TTVA 3VGPA 9GPBA 3Q3JB 2VSFA 1E96A 1RBYA 4DT1A 4F3RA 2WKPA 3GD5A 3W7VA 3COWA 3T7IA 1A8IA 2CB9A 3AM1A 3HDTA 1G3UA 2F1KA 2NUTB 5DULA 3GCXA 1RVDA 3KXIA 3CM0A 3RQSA 5ITZB 1FJHA 1SEVA 2CXPA 4JSTA 1XAGA 5GZ1A 1INLA 2JAHA 3V48A 1E1MA 3IEUA 4JJZA 2CSUA 1UKYA 1VZ3A 4RACA 2OV1A 4NV3A 1QHYA 2V03A 4KIJA 4KWIA 2GBCA 2GSDA 5TSDA 3TCXB 3WSWA 1A97A 4DDMA 1E77A 1H93A 1FFGA 2YS7A 5KQGA 1TQHA 3I6BA 4ND1A 2GM9A 4HZUB 2QU7A 3AEYA 4AIRA 3IP5A 1WO8A 2FWIA 4LK2A 1E6EA 4ZRNA 3UO8B 5KYYB 2V0GA 4X8OA 5KTRA 5JH7F 1N6HA 3D4BA 3HDYA 3QKIA 4HLCA 3TN7A 3CLRD 1NNSA 4EPRA 4ZAWA 4I50A 1TM1E 3GDOA 3LL4A 3O21A 1P7YA 2DY0A 2RGNA 5K8UA 3KAPA 3DPSA 4COOA 3TZCA 3P0IA 4LX8A 1MB3A 4EGSA 1J8VA 5EE0A 4L51A 2V9ZA 2XBUA 2GYYA 5B6JA 3H7AA 5H5JA 3T1VA 4UBOA 3QEMA