1E37B

Porcine pancreatic elastase complexed with (3s, 4s)n-para-nitrobenzenesulphonyl -3-ethyl-4-(carboxylic acid)pyrrolidin-2-one soaked in ph 9 buffer for 1 minute
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
b'VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE
publication title 'Ph-Jump' Crystallographic Analyses of Gamma-Lactam-Porcine Pancreatic Elastase Complexes
pubmed doi rcsb
molecule tags Hydrolase(serine protease)
total genus 62
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2000-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1e37B02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1e37B01
1P04A 1C2IA 1O3MA 3ZZ8A 2R9PA 1IQJA 2AMPA 4DIIH 3RXEA 1L0ZA 1ZSJA 1C5LH 2AGGX 4RKJB 1FY1A 4QT8C 1YM0A 2ODYB 4LK4A 1HLTH 1ZYOA 4HI3A 3GISB 2EA3A 3SI4H 4MVNA 3OSYA 4I8HA 1J17T 2PFEA 3ATLA 4X2WA 4ZROA 1P06A 1SG8B 1Y5BT 3KQCA 3TGIE 2A32A 1LMWB 1NFXA 1ARBA 4MNXA 2GD4B 1O37A 2XC5A 3SQHE 2F91A 1JXPA 1XUIA 7GCHF 1KY9A 2G4TA 1UTMA 2TPIZ 1AZZA 3PLPA 3Q00A 1QRWA 9LPRA 1TGCA 3QUMP 4X1RU 1BTPA 1O3KA 1T8NA 1O3DA 1EUFA 5EOKA 4GCHG 4OS7A 1OYQA 4Z6AH 3LGVA 5HM9A 2GDEH 1K1NA 2IPHA 1P9UA 1HAXB 1SFQB 1SR5C 1TWXB 5DKMA 2ZDKA 3VB3A 1QGFA 4E7RG 3NXPA 2OTVA 1N8OB 2BDHA 3ENSB 2FXRA 4ISHH 1SQTA 1HJAB 3T29A 1G9IE 1CO7E 3UNRA 5F8ZA 2VIWA 4DURA 1DE7H 5BPEA 1ELVA 1WU1A 2PGQB 2FOAA 2OC7A 3GOVB 1QB6A 1RTLA 1EQ9A 2R3YA 5C3NA 2SGQE 1A1RA 3GDUA 1P2QA 3M3TA 2AERH 4U2WA 1P03A 4XSKU 3E0PB 1A5GH 3O8BA 1P3CA 3FAOA 4BTUB 2Z6BD 3LGUA 1QJ6B 3Q3YA 1S82A 5C1XA 3RMNH 2G51A 2IOTA 1UK3A 2OQUA 4UFEH 1ZHRA 1YKTA 2QA9E 1XMNB 3AAUA 5LGOA 3M3SA 1SVPA 2BOKA 2J92A 5A0CA 1FY5A 1LKBA 2PSYA 2ANKH 3SZNA 1HXEH 5A2MH 6GCHG 3OYPA 1K1LA 2UUFB 1W7GH 2BM2A 4Q7ZA 2W5EA 4UFDH 4ZXXH 3BTFE 1D6WA 2ZU3A 2CXVA 2HGTH 2IN2A 2OXSA 1O32A 1FY4A 2FOCA 1TPOA 3F9HA 3ZVBA 2ZGBH 3KHVA 1HRTH 1V2WT 1NU7B 1Z1JA 3E1XB 2A45B 3UWJH 1GDUA 3MYWA 1C5RA 3KIDU 4VGCB 5L30H 3DFJA 4X8TH 1A0HB 1LVBA 1S84A 1O3BA 1OOKB 3PWBA 1HPGA 1C2MA 2TGTA 1N6YA 1EB2A 2HPQH 4YO9A 2NU3E 2D8WA 2JETB 2UUKB 3SU5A 1K1JA 4Q80A 5GXPA 1GMDF 1C1MA 3S69A 1KXDA 3BTEE 4DY7B 1GHWH 4DOQA 2ZQ2A 5JBCS 4MNVA 2XRCA 4TPIZ 5T6FA 1K22H 2VB0A 2H9TH 1UK2A 3QN7A 2BD3A 4AOQA 3RM0H 3E3TA 4GLYA 1UTQA 2JH6D 3A83A 4BAQB 4UD9H 1A61H 4WXVA 3GY8A 1EZSC 1IQKA 1TFXA 1G3EA 5FPYA 3KQBA 2GVFA 1C5YB 1FIWA 5C5OA 1J16A 1TX8A 2J34A 4NIYA 4OS4A 1NRSH 1BITA 3GY3A 1KTTB 2GZ7A 4OGYA 3HK6B 1BZXE 4CR5A 1FV9A 1HIAB 3RC6A 3GCNA 3M5OA 2STBE 2HLCA 2BD7A 4UFGH 1YYY1 2UWOA 3F6UH 2PLXA 3ATKA 1DVAH 2UWLA 1YPHC 3D23A 4JYVH 4KKDA 5C20A 1UVTH 4NIVA 1G30B 3HK3B 2BMGB 1SSXA 2Z9LA 2VVVA 2FESH 3RLWH 1QB9A 3ZZ7A 3M7QA 2FOFA 2VH0A 3FANA 1UVUH 3KL6A 3A80A 1HAYB 1LCYA 1PJPA 3AW0A 2VJ1A 3U98H 1XM1A 1O3AA 2SGAA 1D3PB 3LT3A 1O2RA 1ZZZA 1UTPA 1HDTH 3RLYH 1BTHH 1YPKH 3GCHC 1VZQH 4I33A 4IS5A 1BB0B 1SGIB 1O36A 1O2OA 2PKSC 4CRDA 1AKSB 4GHTA 5LPFA 1V2NT 1KIGH 2A2QH 1ZMNA 4MNWA 4B2CA 5JBTA 1OWKA 4ZMAH 4ZHMU 2ZP0H 3SO3A 1SGNE 1ZPZA 3UR6A 1HAZB 1WYKA 1O31A 3E0NB 1GHZA 2F3CE 2J2UA 3QGJA 4O3UA 2FI5E 4X2VA 4A7IB 2BQ7B 2OBQA 3BG8A 1E38B 1C5NH 1TMUH 5L2YH 3RU4E 3URDA 4HTCH 4BAMB 3GDSA 1C1QA 4NWLA 1FJSA 1LPGB 1CHOG 2ZDAH 3RXQA 1L4ZA 3SV6A 1ETRH 2F9OA 1EAWA 1G3CA 2O8TA 2Z94A 4NA7A 1J14A 4J1YA 4AX9H 2OP9A 1BJUA 1O35A 1BMLA 4YT6H 1SLVB 1A4WH 1GI7B 1EPTC 3VB5A 1EB1H 4O03A 2ZF0H 1AO5A 1D6RA 1O3JA 1Q31A 4NCYA 2QXIA 4YOGA 2ZDMA 3L3TA 2A7CA 3SJKA 3ELAH 3VGCC 5GWZA 1P2NA 2TRMA 5A09A 1GBDA 4CRFA 1Y3VA 4NG9H 4D9QA 2NU1E 2F9UA 5H4IB 4IW4E 4E06H 1OWHA 4JZIA 3UOUA 5EU8A 2BD4A 2PSXA 3ODDA 4JK5A 4K8BA 4KGAA 5DG6A 5EPYA 3RXBA 3RXSA 2PKAA 1A46H 1GJ6A 3SV9A 2ZCKP 1ZPCA 1PQAA 3TIUA 1ELDE 3CENA 4Y0YE 1YPEH 2FOGA 3KCGH 2VGCC 4AB8A 3E16B 2XWAA 1W3CA 1W13U 3RXIA 2FP7B 4CRGA 5JYIA 3U69H 4Y71A 5HXFA 1TABE 1O2YA 1NZQH 1EKBB 1CBWC 1S83A 1RRKA 3S7HB 1YLDA 1J15A 1B0EA 2GZ9A 1GMHG 4NSYA 3SJ8A 1LQEA 1G2LA 4AGKA 3E90B 2QIQA 1SGRE 1CGIE 3PMJA 2KAIA 4BANB 1B7XB 2FZZA 2Y7XA 2C8WB 3K65B 1ELBA 4CR9A 4RKOB 2FM2A 1MBQA 3RP2A 1GCDA 5DP5A 3V13A 2V35A 5EXNA 1XX9A 3CS7A 2Z9GA 4Y11E 1BTWA 5E0GA 3DD2H 3LGYA 4FVDA 3UNSA 3V3MA 4BAKB 2BD9A 2WV4A 2ANYA 3SV7A 1INCA 1P11E 1AFQC 5GCHF 4U32A 4BXWA 1SOZA 1IQMA 1BHXB 4E7NA 1O3PB 5JBAS 1BA8B 1O2TA 2ZCLP 3AW1A 4K60A 8LPRA 3RC5A 1ZMLA 5DP4A 1GPZA 3IWMA 3QZRA 4BAOB 1HJ8A 1Q3XA 1GCTB 1TNGA 1G32B 3MMGA 2Y80A 4X1NU 1E36B 4IGDA 3RXPA 1H8IH 1SGYE 1AB9B 1QRZA 1QURH 3LONA 4WH8A 1JBUH 1P09A 1DX5M 1GI1A 2CN0H 4X6PA 3RXAA 1OKXA 1J9CH 1SGDE 2OQ5A 3A82A 1TALA 2PTNA 1SGQE 2YNAA 1Y3XA 2YOLA 1ZTKA 3BIUH 4K2YA 5EQRA 2FIRH 1FPHH 1ACBE 3T26A 1UHBB 2BHGA 5DJ7A 1TMBH 1WQSA 1GBIA 1DSUA 1ZGVA 2XNIA 1W0YH 3TVJB 1QRXA 2C90B 1L4DA 1OX1A 2EI7A 3A86A 3NKKA 1SFIA 4D7GA 3RXLA 1V2ST 1EPTA 2R0LA 2P3TB 1HV7A 3LOXA 3A7TA 1MCTA 2ZNKH 1OP2A 2TBSA 1DDJA 2BQ6B 3HGPA 4A6LA 4B2AA 1EOLA 4KP0A 1BRAA 4R8TB 5EW2H 5EXLA 1AY6H 3ZZ5A 4Y7BA 3L33A 1O33A 3AAVA 5ESTE 1V2TT 1PYTD 1HNEE 1PPGE 4TY7A 2SGEE 5AFZH 4O9VA 1MMJN 1GVKB 4ISNA 3RXTA 2OC8A 1GBEA 3AASA 3UREA 1MTNB 2BVXH 3KQDA 1AWFH 1LPKB 4ZHLU 2ZTYA 3BSQA 5C5NA 1TRYA 1O2GH 4YTAA 3QX5H 2UUYA 3BTWE 1CA8B 4FXGH 1IQEA 4KTUA 1SQOA 3URCA 3P8NA 5GIBA 1GWAA 3MHWU 1EJMA 1S85A 5B6OA 1NU9A 1NFUA 1Z8IB 1SGCA 1KXAA 2ASUB 1DOJA 1TQ7B 3A7WA 2Y5HA 3UWIA 1GI5A 2AFQB 1IHTH 1SLXB 1PPFE 4ISIH 2H5DA 3KF2A 1K9OE 1V3XA 3BG4B 1GHVH 3RXKA 4NIWA 3VFEA 2Q1JA 1BTUA 2QY0B 1GVZA 4AGJA 2Z9JA 1ANDA 1OYTH 4ABDA 2YNBA 1W11U 1FIZA 1KXCA 3GICB 3JZ2B 2ZPQA 2WPMS 1HJ9A 4Y79A 2Q6DA 2WYJA 2VIDA 2CV3A 1BTZA 1SL3A 3ZYEA 3P6ZB 1FY8E 5I25A 1LTOA 3M37A 3MH4A 2ZKSA 1FAKH 1VCQA 2XC0A 1MH0A 5EGMA 4XOJA 1T4VH 1TBQH 3Q77A 4NFFA 1Z71A 1ELEE 4ZUHA 3PTNA 3Q76A 4J2YB 5A8ZA 1YPMH 2ALPA 5JPMH 4ZKSU 2BDCA 1VGCC 2H9HA 3SQEE 2ZHDA 1ELTA 2G5VA 3T25A 1Z8GA 8KME2 5ABWA 1PYTC 3UTUH 1XUFA 3EA7A 4XE4A 3A87A 1BT7A 4GAWA 4ISLA 1MBMA 2EC9H 2J94A 1O2JA 2BDGA 2VWNA 4JZEH 4K1TA 1DWBH 1C5SA 2Q6GA 1GJ5H 1NRRH 1SGFA 5JB8S 2QYIA 2M5TA 3PV4A 1HFDA 5TCAA 1GGDB 2OC0A 1DPOA 4H42U 1RXPA 1HAPH 1F0SA 4WH6A 2AEIH 3RXRA 2ZTXA 2ZIQH 1QHRB 1TIOA 2Y5FA 1FY3A 1SB1H 2I6SA 1BRCE 4HFPB 1GMCG 1IQNA 3HKJB 4AG2A 4Y76A 2EEKA 2GCTB 2VVCA 3SHAH 1GJ4H 4ABIA 1GBTA 1HUTH 1TQ0B 4IC6A 4ASHA 1AVGH 5PTPA 4A5TS 5CHAC 3ITIA 4RN6A 5HM2A 3UY9A 2BOHB 4IN1A 2P16A 1QL7A 2WPLS 2NU0E 2FYRA 8GCHG 5TCCA 3S7KB 2JH0D 3BTTE 4KTSA 4NIXA 3ZVGA 1TX6A 4Y8YA 2GT8A 1OWJA 3SJIA 2BVSH 4XBBA 2J38A 3LU9B 3TJOA 3Q3KA 3W94A 3U1JB 4ABJA 1NM6A 3MO3A 3QDZB 3VB7A 1QNJA 2J95A 2BLWA 1NRQH 2AIQA 1FN8A 1HBTH 5K0HA 3TJUA 1Z7KA 3SGQE 1JRTA 1YC0A 2WPKS 4NZLA 4YLQH 4AFSA 2C8ZB 1ZTLA 2H1UA 1ELCA 5L6NH 3NUMA 1ESAA 3BEIB 1C5OH 2FMJA 1GG6C 1K28D 1UVPA 1UTKA 3S9BA 1O3LA 1TPAE 2DUCA 2V6NA 3W95A 2BD5A 3SU2A 1LO6A 4JYUH 3QTOH 3TNSA 3GY7A 5GCHG 3BEFB 2ZU1A 2VIVA 1ETSH 1GBHA 4X8SH 1AWHB 1P2MA 1JMOH 6CHAC 3SUGA 4FUDA 1DY9A 1O2SA 3KN2A 4X8VH 1DUAA 3MNSA 3PTBA 4ABBA 1O2LA 1P10A 3I29A 1DANH 1EXFA 1K1OA 4O3TA 3ZV9A 1GHBF 2OBOA 1MKXK 2ZTZA 1DWEH 3M3VA 3QTVH 2P94A 5LPRA 3QWCH 1AU8A 3PLBA 1GJ9B 3IG6B 2FTLE 2C8XB 3OY5U 4Q7YA 5I46H 1C1SA 4FUBA 3GCTG 3RM2H 1CA0B 4UEHH 4D8NA 1O5EH 1O5AB 1GI0A 1TMTH 1BBRK 1Y3WA 1RJXB 1HAGE 1A2CH 4WXIA 1C1VH 4X6NA 3SNDA 1PPCE 4U01A 2A7HA 5FBIA 1FLEE 1KSNA 1VJAU 2C8YB 1LHDH 3RU4D 3QLPH 1CT2E 2PUQH 3UIRA 1C2JA 1GHXH 1Y5UT 2QAAA 3I77A 3H7OA 1C5MD 2VIQA 1YCPK 3STJA 4X1QU 4CHAC 4GSOA 1P2OA 3GCOA 5EODA 1C5UA 2QGRA 2P8OC 3KEEA 3PMBB 1DLKB 2PW8H 1DITH 5FPSA 1BMMH 3E91A 2GCHF 1ZMJA 4GVUA 2GMTC 3ATMA 3GY6A 1MTWA 1NRNH 2QF0A 1AMHA 2ZO3H 2VNTA 2ZU4A 1AI8H 1RIWC 2Z3CA 7LPRA 1AVXA 1UTNA 1W12U 5J4QA 1GHAF 2CHAC 2ZDLA 1XUHA 1T32A 3MH6A 1V2PT 5FCKA 1K1MA 1BRBE 4MNYA 1MZDA 1BBRE 1UK4A 4JYTA 1NS3A 1D3TB 4NA9H 2BX4A 2ZGCA 1XUJA 4ABFA 1MTVA 3MO6A 1D9IA 3FP7E 1ELGA 4IMQA 1FDPA 1FONA 3TH2H 2BY8X 4MPVA 1MTSA 3LJJA 4H4FA 1E35B 3LH1A 2B5TB 2H2ZA 1AUTC 4SGAE 4FUJA 2Y5GA 3QK1A 1DXWA 5JBBS 1DXPA 4WVPE 1QCPA 4MPWA 1PPHE 4UE7H 4B73A 1RD3B 1JOUB 1FNIA 1FN6A 4K3JA 4X2XA 4TY6A 1HAOH 2FYQA 3K9XB 1RFNA 4FU7A 4D7FA 3TLOA 2XC4A 2ALVA 1MD8A 1ZOMA 4X1PU 1GDNA 2K1QA 1TNIA 3U9AH 1CU1A 1V2JT 4X6OA 1QBNA 1XKBC 3SV2H 4I8GA 1HXFH 1TNKA 4Z0KA 5DP3A 4CRCA 3BTDE 2Z3EA 2PTCE 3GY2A 3P8GA 4CH2B 2Y82A 2FOBA 1C1WH 1C1TA 3M5LA 1A3BH 3NZIA 3L6PA 2HNTE 2GZ8A 1AZ8A 1TPPA 1XXDA 1W14U 3SHCH 4ABAA 3LC5A 3U8RH 2BTCE 2A2XH 2G4UA 2VWOA 1NC6A 4OGXA 3TK5A 1NTPA 5F6MA 4NWKA 3K6ZA 2JKHA 1GJAB 4NFEA 1A0JA 1CVWH 4PROA 2QV1A 2TGPZ 1SBWA 4ZKNU 5A0BA 1JWTA 1QJ7B 3HATH 2WPIS 4M7GA 1VR1H 1MZAA 2ANWA 2XYAA 4FUIA 2OLGA 1O2XA 2AGIX 4YM9A 1C5VA 1QTFA 1BDAA 1KXFA 4XDEA 2SGPE 1BTYA 3OY6U 4MPUA 1GJ7B 1GBLA 2FS9A 1GI3A 3PO1C 7GCHG 1O2IA 1BCUH 4RSPA 1F5KU 1QQUA 1C4V2 3MO9A 5HYOA 4JCNA 1BMAA 5FPTA 3T28A 4FU8A 3CP7A 4DGJA 4ZH8A 2RA3A 2QXHA 3S9AA 5C1UA 2VH6A 1QFKH 4I32A 1ESBA 2SFAA 4IBLH 1C2HA 1VITF 1O2WA 2EI6A 3LIWA 3SW2B 4YOIA 3SNEA 1GG6B 4A1XA 3A85A 3V0XA 1GBBA 2FOMB 2XBXA 1ESTA 2PHBA 3RMMH 1HAIH 1P2KA 2TGAA 1EP6A 1FAXA 1SLWB 2OUAA 3NPSA 3M7TA 3TPIZ 1KLJH 2H6MA 1DWCH 3FZDA 2HRVA 1UTJA 3A84A 3T5FH 5G4BA 2G00A 4K1SA 3MWIU 1CT4E 1KXBA 1Z1IA 2AYWA 2PV9B 1IQGA 2XBVA 5DK1A 3MH5A 1RTKA 3MOCA 4FUHA 4BNRA 1C4Y2 2ILNA 2AMQA 2BXTH 5DP7A 1DM4B 4INHA 1YPGH 1YBWA 1BIOA 3DUXH 1Y5AT 4WF8A 1YPJH 1ZGIA 5EQQA 4JK6A 5FCRA 1FUJA 2B7DH 2O8WA 1HB0B 4F49A 1ZJKA 2SGDE 1IQLA 2LNCA 2WUCA 4DIHH 1EATA 1LKAA 2G81E 4Y10E 1BUIA 2WYGA 1T7CA 4B74A 3C27B 3N7OA 4K8YA 1BBRH 1Y59T 1F92A 2BD2A 3UQVA 3SNCA 2FLBH 1QA0A 1TRMA 4F4OC 5A0AE 2BZAA 4AB9A 3E6PH 4DT7B 1SQAA 4ZAEA 3M35A 1N8OC 1C5XB 4Y6DA 4WJG2 1GHBG 2BDBA 1KTSB 1AHTH 3ZZDA 4YZUA 1HJAC 2Y6TA 3TJVA 1O2QA 3LH3A 3E8LA 1V2KT 3A8DA 1BTXA 1YCPH 1T8MA 1C9PA 1FMGA 3SUFA 2ZI2H 1GMDG 1QBVH 2PR3A 2W3IA 2ZHQH 1K1PA 1G3DA 4INKA 1LQDB 1AE8H 2A5AA 2A5KA 2SNVA 1KDQA 1SGPE 1YGCH 2BX3A 1Z8JB 1LHEH 1O3OA 2W7SA 1P12E 4XFQA 2CF8H 1H9IE 5F8XA 1OWIA 4FVBA 2HWLB 1W10U 1S81A 2KAIB 4BTTB 5J4SA 1O2ZA 5C1YA 1GJDB 4X8UH 3RXJA 1RGQA 3DFLA 1SLUB 3F1SB 1EJAA 1P0SH 2C3SA 1MAYA 1GBFA 3H7TA 2VVUA 2HVXA 1WQVH 3PYHA 3V12A 1WAYB 1U6QA 1ZLRA 3GCHB 1L1NA 4FUCA 2ZHEH 2HALA 4WMEA 3TK6A 3SOSA 2PKSB 1E0FD 1VCPA 1THPB 4VGCC 2FOEA 4JZDH 3M36A 3K6YA 1IAUA 3CS0A 1EZUC 1GHAG 1WCZA 5ETXA 1J8AA 4DG4A 3P17H 2A4OA 1GVLA 2D1JA 2JETC 4Y7AA 3TNTA 3F9FA 5E0JA 1M9UA 2F9BH 2ZFFH 3QGNB 1MQ5A 3S0NA 1O3GA 1QB1A 3SU4A 4AZ2B 1HGTH 2F9VA 3S9CA 2W26A 3SNBA 3RMOH 3VPKA 1ORFA 3MTYA 3MU8A 1Z8RA 3ZZ6A 4LOYH 5AVDA 2D2DA 1F2SE 3EQ0H 2VIPA 2XBYA 5IYTA 4B2BA 2OD3B 1OPHB 1V2MT 1D3QB 2XCFA 5T6GA 2A31A 2BDAA 3A7ZA 4NA8A 4OS6A 4DVAU 3R0FA 3RUOA 2VWMA 1EPTB 3UR9A 5L2ZH 3BV9B 4IC5A 4Y8XA 1FPCH 2XBWA 3SNAA 2ZFTA 5BRRE 1GBMA 2WPJS 4ZHAA 2BY9X 3RXUA 3DA9B 3VGCB 1W8BH 4OS1A 3GY5A 3VEQB 2SGFE 1F5RA 1O3HA 1IQHA 1LPZB 3BF6H 2BLQA 2UWPA 2HOBA 2GV7A 3A7XA 1PQ7A 4OS5A 2BD8A 4Q2KA 1TOMH 3RMLH 1L1GA 2O9QA 2CJIA 3V7TA 4ZXYH 2R2MB 2G52A 1ZRBA 2BDIA 3PM3A 4HZHA 4CH8B 2GTBA 2ZDVH 4YLUA 1TNJA 3OTJE 2CGAA 1JRSA 4GUXA 3T62A 2GX4A 4ABHA 3A8CA 5GDSH 1L1JA 1TNLA 4A1VA 2VGCB 1O38A 1C5PA 1GI2A 1H1BA 1LVOA 3ODFA 1CHOF 2Y81A 2ZC9H 1NFWA 1A0LA 2J4IA 3SI3H 3ZYDA 1Z6JH 1TX7A 3M61U 3RDZA 1CBWB 5IDKA 4UFFH 1ANCA 2P95A 1HYLA 1O2PA 1H9HE 1WV7H 1O2KA 2VWLA 1DWDH 4FUFA 5T6DA 1YLCA 4JZ1A 1G3BA 3TH4H 3A7VA 4MTBA 1HAVB 2XCNA 3RXFA 1NFYA 2AMDA 3SU0A 2BDYA 4YT7H 3MFJA 1S0RA 1ZJDA 4UDWH 4DJZB 3SJOA 1O3IA 1V2RT 3LJOA 4MG3A 1VITG 3FP6E 4FUGA 5AF9H 1P02A 3ZVDA 1JIMA 4WMFA 7KMEH 3Q3XA 1O5BB 4LZ4B 2OCVB 1IQFA 2ULLA 4LXBH 4AYYB 1AFQB 1WUNH 3ATIA 2A4GA 1TGBA 4BTIB 1O34A 4MQAA 3P8OA 1FXYA 6ESTA 4B76A 2H5CA 1V2QT 4IMZA 3A8BA 3TH3H 1GBJA 1B5GH 1NN6A 3EAJA 1O2HA 2PUXB 3SGBE 1AFEH 1O39A 1DFPA 5HMAA 1QY6A 3SU1A 1SGTA 1GBKA 1XUKA 3KGPA 4OS2A 1GMHF 5HGGA 1SI5H 1G2MA 5E2OA 1Y3UA 3T2NA 2FI3E 2ZECA 4X6MA 2D26C 5EXMA 4ABEA 3O8RA 1P2JA 3B8JA 3MU4A 2P3UB 1QL8A 4D9RA 4B71A 1EOJA 2BYAX 1XUGA 4NZQA 1BRUP 5DP8A 1ZRKA 3STIA 3EA9A 3JZ1B 3VXFH 2STAE 1C2LA 1GJCB 1TGTA 1VCWA 4A92A 4A1TA 5SGAE 3MI4A 1HIAA 2FX6A 3D49H 1MKWK 3RXCA 1OP0A 1O2MA 1GJ8B 1TNHA 1PQ8A 3RC4A 2P3FH 3BTGE 1P8VC 4D76A 2ZCHP 4INLA 3EA8A 4NGAH 2FWWA 1TB6H 2VIOA 4IN2A 3GYLB 3FFGA 2O8MA 1GDQA 3F9GA 1T8OA 2W3KA 4BAHB 2ZDNA 5C67A 4ABGA 1UCYK 2BY5X 3RXDA 1SOTA 1W2KH 2Q6FA 1S0QA 1X7AC 3EE0B 1O3EA 1MD7A 3TGKE 2BZ6H 2R2WU 2ZG0H 2PGBB 2AS9A 3P70B 5E0HA 3SGAE 2BB4A 4H6SB 2O8LA 3MNXA 1H8DH 2A1DB 2Y7ZA 3TGJE 1C2FA 2ZZUH 3VB6A 1O5DH 3ZZ4A 1K2I1 1AKSA 1TLDA 1XKAC 1BOQA 3UQOA 3MH7A 1O3FA 3LGTA 1ELFA 3SJ9A 1AGJA 5DO4H 1EZQA 1MCVA 3EDXB 3LDXH 1SGFG 2Z9IA 4SGBE 4TWWA 1QL9A 4K5ZA 2ODPA 4FUEA 4R0IA 2WV5A 1DT2A 1GCTC 1YF4A 3B23B 1CSOE 1TYNA 3BN9A 1T31A 2WINI 1AB9C 5DP6A 2F9NA 1QBOA 2VU8E 2GT7A 3PMAB 1EP5A 2A0QB 3I78A 1TBZH 1O3CA 1GI4A 1D4PB 1C4U2 1UVOA 4CBNA 1S6HA 2CMYA 3VB4A 1SPJA 1TONA 3D65E 4WMDA 1O5FH 5AFYH 1A5IA 2DE8A 1HCGA 1XVMA 2QN5T 3DT0H 1P3EA 1UCYE 1NPMA 3A8AA 4ESTE 3LKWA 5FXLA 1WBGB 3SUDA 2BXUH 1GL0E 5GJ4B 5A8YA 3VXEH 1MQ6A 5T3HA 1VGCB 5JB9S 1BHXF 1YPHE 4DW2U 3K2UA 1NRPH 3TU7H 3MU0A 3TK9A 3EYDA 1FZZA 1GBCA 2BLOA 2A5IA 3MU1A 4MDSA 2GKVE 1LVYA 3GYMA 3KNXA 3PLKA 3OX7U 2BY6X 1AN1E 1DS2E 2AGEX 2P59A 8ESTE 1QQ4A 1C9TA 1C1RA 1B0FA 2G5NA 3PROA 1P9SA 1IOEA 3ZZ3A 4JMYA 2ZFQH 4FU9A 1UVSH 2V3OH 1TRNA 4TPYA 5EQSA 1JIRA 1NY22 4XBDA 4Y0ZE 2QC2A 1E34B 2GDDA 3ESTA 4AFQA 4CBOA 1MTNC 2VINA 1TPSA 1ZHMA 1O2VA 1C5WB 3HKIB 5F03A 4CRBA 1WOFA 3RXHA 4THNH 4UONA 1OS8A 1V2UT 1C5ZB 1THSH 2IJOB 2HNTC 1UTLM 1DSTA 3QZQA 3G01A 4X0WU 2ZWLH 3T27A 2RA0A 2R0KA 1AUJA 3U8OH 1AD8H 1T8LA 3FP8E 5CHAB 1G36A 1Y3YA 2THFB 4AFUA 1UTOA 3ZVEA 1ANEA 3RU4T 1Q2WA 1RS0A 3M5MA 2V3HH 2B0FA 1E37B 3TJNA 5E2PA 1OWEA 5FX5A 1CQQA 4Q7XA 1MUEB 2ZGXH 4U30A 4NSVA 5TJXA 3GDVA 3BG4C 3MNBA 3ZZCA 1ABIH 2OC1A 1W0ZU 3R3GB 1ABJH 4AYVB 1N6XA 1DUEA 2QCYA 2XW9A 1O5CB 1O3NA 2G55A 2OINA 1MU8B 6LPRA 2XTTB 5AHGH 3UPEA 3SORA 1TE0A 1C5QA 4I8LA 3U8TH 5FHTA 3O8CA 1WTHD 1V2VT 1C2EA 3BTKE 3P92A 5CMXH 5EW1H 5LH8A 3MNCA 2JH5D 4ZKRU 1TOCB 2HNTF 2EI8A 3IITA 1TAWA 2B8OH 4AN7A 3ZVCA 3UFAA 1PPBH 2CF9H 2H9EH 4MLFB 2AIPA 1MU6B 3ZZ9A 2RDLA 1V6DA 1GMCF 1CE5A 1EAIA 1MTUA 2XXLA 4CREA 1NROH 2ESTE 4AORA 1QR3E 2ANMH 5DGJA 1CT0E 3UNQA 1SHYA 1C5TA 1K21H 4GCHF 1TA6A 1YCPM 1O0DH 1G37A 1RTFB 6CHAB 2TGDA 3PMHB 2GV6A 2ZFPH 1KLIH 2C93B 2RCEA 1QIXB 3ZV8A 1F0RA 3EGKH 1GGDC 5F8TA 4TWYA 3M7UA 2ZFRH 4X1SU 1XVOA 2XWBI 1F0TA 3SU3A 1C1PA 2ZQ1A 1GJBB 8GCHF 1VJ9U 1UHBA 1EAXA 1TBRH 4O97A 1MKWH 3KQEA 1MKXH 1KYNA 1ZPBA 3O8DA 4K1EA 2FDAA 3FZZA 3NCLA 1ZHPA 2NWNA 2QXGA 4ISOA 1ETTH 3SU6A 2FX4A 1ID5H 1KXEA 1PPEE 2GCTC 1A3EH 2BQWB 1GI6A 3LGWA 3NWUA 2PWXA 2TIOA 4H6TA 2F83A 3HPTB 2ZU2A 1YP9A 4GPGA 2C4FH 3A89A 1GHYH 1AVWA 4AG1A 3P95A 5CE1A 3PB1E 1Z6EA 3ZVFA 1UCYH 2ZU5A 1TGNA 1P2IA 2PKAB 1AQ7A 5FBEA 4I8KA 2W7UA 1ZR0A 6GCHF 1FI8A 1NT1A 1O2UA 2ZGHA 3RXOA 1OWDA 4HGCA 2ZHWH 4CHAB 3TITA 1LDTT 3RXGA 3RXVA 1ZSKA 1F5LA 1WSSH 2HPPH 2P8OB 1Y8TA 1UJ1A 4LZ1H 1V2LT 2I6QA 3LGIA 5EPNA 3UUZA 3UOPA 1SGEE 2GMTB 4I7YH 3OU0A 2QF3A 5DPAA 1EZXC 4KTCA 1LHFH 1PFXC 1SC8U 1ZSLA 1CHGA 2Z9KA 4XBCA 2R3UA 1RIWB 1BJVA 2FI4E 2ZHFH 3C1KA 1F0UA 3H5CB 1CGHA 1LHGH 2ZPSA 1C2GA 2CHAB 2RG3A 1THRH 2GP9B 2A7JA 4GHQA 1EASA 2BVRH 2O8UA 1DY8A 3P8FA 3U1IB 3RXMA 3GCTF 3PWCA 1KLTA 1SHHB 3ATWA 4CRAA 2FOHA 1T4UH 4KELA 1PQ5A 3QO6A 3BTQE 3NK8A 3WY8A 1F7ZA 4BXSA 2FEQH 1DLEA 4X2YA 1DICA 4WY3A 1ZTJA 1TA2A 4BOHA 1CGJE 2A4RA 3D62A 1AIXH 5GPIB 2GCHG 1S6FA 1K1IA 5FAHA 3BTME 2SNWA 1QJ1B 3FVFB 1W7XH 2ZPRA 1OXGA 3LPRA 1NO9H 4WWYA 3BTHE 4Y8ZA 1O30A 2NU4E 4DCDA 1A5HA 1EAUA 3F68H 1C1NA 4AFZA 1C2DA 1FQ3A 1P57B 3SUEA 5C2ZA 1XXFA 5DP9A 1UO6A 4JZFH 1BMNH 2V0BA 2P93A 2ZGJA 4MPXA 1CA0C 9ESTA 1VITH 3LC3A 2FPZA 1PPZA 2J9NA 2Z3DA 5E8EH 2FO9A 1GL1A 2BLVA 1P05A 2FTMA 1H4WA 1GI8B 2FODA 2ZEBA 1O2NA 7ESTE 1IQIA 3A88A 1TGSZ 1C1UH 1SMFE 5ESBA 3ZZBA 4E05H 1O5GH 1KDQB 1S5SA 2GGVB 1H9LB 2BY7X 3SN8A 1MAXA 3DHKH 2A4QA 4B1TA 1GI9B 3BIVH 1ANBA 3BEUA 2DE9A 1EJNA 5LPEA 1QA7A 1EX3A 3A81A 2FLRH 1D3DB 1ARCA 5A8XA 1L2EA 1OP8A 1YPLH 1LHCH 2F9PA 1HAHH 1HAVA 3F9EA 4YESB 3ZVAA 1AE5A 1C2KA 1UMAH 2B9LA 2Z7FE 1N1LA 3PO1B 1V2OT 5EG4A 2G8TA 1LVMA 3ZZAA 1NESE 2WUBA 4I8JA 3MU5A 2AH4X 3M5NA 4K69A 3GY4A 2ZA5A 1IHSH 3SBKA 2NU2E 4B75A 3B9FH 1OSSA 1GBAA 1A7SA 5K7RA 4I31A 1P01A 4YOJA 2ODQA 2UUJB 5FX6A 3A7YA 2ZFSA 1WTGH 1C1OA 3SV8A 2QXJA 4TYDA 2FS8A 1BQYA 2WPHS 5JDUB 1ELAA 4ZKOU 2LPRA 3AVZA 3HGNA
chains in the Genus database with same CATH superfamily
1P04A 1C2IA 1NBMD 1O3MA 3ZZ8A 2R9PA 1IQJA 2AMPA 4DIIH 3RXEA 1L0ZA 1ZSJA 1C5LH 2AGGX 4RKJB 1FY1A 4QT8C 2JDID 1YM0A 2ODYB 4LK4A 1HLTH 1ZYOA 4HI3A 3GISB 2EA3A 3SI4H 4MVNA 2QE7D 3OSYA 4I8HA 1J17T 2PFEA 3ATLA 4X2WA 3DSPA 4ZROA 1P06A 1SG8B 1Y5BT 3KQCA 3TGIE 2A32A 1LMWB 1NFXA 1ARBA 4MNXA 2GD4B 1O37A 2XC5A 3SQHE 2F91A 1JXPA 1XUIA 7GCHF 1KY9A 2G4TA 1UTMA 2TPIZ 1AZZA 3PLPA 3Q00A 1QRWA 9LPRA 1TGCA 3QUMP 4X1RU 1BTPA 1O3KA 1T8NA 1O3DA 1EUFA 5EOKA 4GCHG 4OS7A 1OYQA 4Z6AH 3LGVA 5HM9A 2GDEH 2AHME 1K1NA 2IPHA 1P9UA 1HAXB 1SFQB 1SR5C 1TWXB 5DKMA 2ZDKA 3VB3A 1QGFA 4E7RG 3NXPA 2OTVA 1N8OB 2BDHA 3ENSB 3OTPA 2FXRA 4ISHH 1SQTA 1HJAB 3T29A 1G9IE 3CNRA 1CO7E 3UNRA 5F8ZA 2VIWA 4DURA 1DE7H 5BPEA 1ELVA 1WU1A 2PGQB 5HIZA 2FOAA 2OC7A 3GOVB 1QB6A 1RTLA 1EQ9A 2R3YA 1YLNA 5C3NA 2SGQE 1A1RA 3GDUA 1P2QA 3M3TA 2AERH 1K0HA 4U2WA 1P03A 4XSKU 3E0PB 1A5GH 3O8BA 1P3CA 3FAOA 4BTUB 2Z6BD 3LGUA 1QJ6B 3F0OA 3Q3YA 1S82A 2W6ID 5C1XA 3RMNH 2G51A 2IOTA 4FOUC 1UK3A 2OQUA 4UFEH 1ZHRA 1YKTA 2QA9E 1XMNB 3AAUA 5LGOA 3M3SA 1SVPA 2BOKA 2J92A 5A0CA 1FY5A 1LKBA 2PSYA 2ANKH 3SZNA 1HXEH 5A2MH 6GCHG 3OYPA 1K1LA 2UUFB 1W7GH 2BM2A 4Q7ZA 2W5EA 4UFDH 4ZXXH 3OEED 3BTFE 1D6WA 2ZU3A 2CXVA 2HGTH 2IN2A 2OXSA 1E1QD 1O32A 1FY4A 2FOCA 1TPOA 3F9HA 3ZVBA 2ZGBH 3KHVA 4Q63A 1HRTH 1V2WT 1NU7B 1Z1JA 3E1XB 2A45B 3UWJH 1GDUA 3MYWA 1C5RA 3KIDU 4RT1A 4VGCB 5L30H 3DFJA 4X8TH 1A0HB 1LVBA 1S84A 1O3BA 1OOKB 3PWBA 1HPGA 1C2MA 2TGTA 1N6YA 1EB2A 2HPQH 4YO9A 2NU3E 2D8WA 2JETB 2UUKB 3SU5A 1K1JA 4Q80A 4OM9A 5GXPA 1GMDF 1C1MA 3S69A 1KXDA 3BTEE 4DY7B 1GHWH 4DOQA 1KMHB 2ZQ2A 5JBCS 4MNVA 2XRCA 4TPIZ 5T6FA 1K22H 2VB0A 2H9TH 1UK2A 3QN7A 2BD3A 4AOQA 3RM0H 3E3TA 4GLYA 1UTQA 2JH6D 3A83A 4BAQB 4UD9H 1A61H 4WXVA 3GY8A 1EZSC 1IQKA 1TFXA 1G3EA 5FPYA 3KQBA 2GVFA 1C5YB 1FIWA 5C5OA 1J16A 1TX8A 2J34A 4NIYA 3VG8A 4OS4A 1NRSH 1BITA 3GY3A 1KTTB 2GZ7A 2KM0A 4OGYA 3HK6B 1BZXE 4CR5A 1FV9A 1HIAB 3RC6A 3GCNA 3M5OA 2STBE 2HLCA 2BD7A 4UFGH 1YYY1 2UWOA 3F6UH 2PLXA 3ATKA 1DVAH 2UWLA 1YPHC 3D23A 4F55A 4JYVH 4KKDA 5C20A 1UVTH 4NIVA 1G30B 2RFKC 3HK3B 2BMGB 1SSXA 2Z9LA 2VVVA 2KFWA 2FESH 3RLWH 1QB9A 3GS9A 3WW7A 3ZZ7A 3M7QA 2FOFA 2VH0A 3FANA 1UVUH 3KL6A 3A80A 1HAYB 1LCYA 1PJPA 3AW0A 2VJ1A 1E79D 3U98H 1XM1A 5HIYA 1O3AA 2SGAA 1D3PB 3LT3A 2HLDD 1O2RA 1ZZZA 1UTPA 1HDTH 3RLYH 1BTHH 1YPKH 3GCHC 1VZQH 4I33A 4IS5A 1BB0B 1SGIB 1O36A 1O2OA 2PKSC 4CRDA 1AKSB 4GHTA 2J97A 5LPFA 1V2NT 1KIGH 2A2QH 1ZMNA 3F2HA 4MNWA 4B2CA 5JBTA 1OWKA 4ZMAH 4ZHMU 5B6LA 2ZP0H 3SO3A 5C0UA 1SGNE 5GNDA 1ZPZA 3UR6A 1HAZB 1WYKA 1O31A 3E0NB 1GHZA 2F3CE 2J2UA 3QGJA 4O3UA 2FI5E 4X2VA 4A7IB 2BQ7B 2OBQA 3BG8A 1E38B 1C5NH 1TMUH 5L2YH 3RU4E 3URDA 4HTCH 4B6EA 4BAMB 3N7DA 3GDSA 1C1QA 4NWLA 1FJSA 2V3MA 1LPGB 1CHOG 2ZDAH 3RXQA 1L4ZA 3SV6A 1ETRH 2F9OA 1EAWA 1G3CA 2O8TA 2Z94A 4NA7A 1J14A 4J1YA 3F3BA 4AX9H 2KCOA 2OP9A 1BJUA 1O35A 1BMLA 4YT6H 1SLVB 4DT4A 1A4WH 1GI7B 1EPTC 3VB5A 2M2AA 1EB1H 4O03A 2ZF0H 1AO5A 1D6RA 1O3JA 1Q31A 4NCYA 2QXIA 4YOGA 2ZDMA 3L3TA 2A7CA 3SJKA 3ELAH 3VGCC 5GWZA 1P2NA 2TRMA 3PRBA 5A09A 2VBCA 1GBDA 4CRFA 1Y3VA 4NG9H 4D9QA 2NU1E 2F9UA 2LP6A 5H4IB 4IW4E 4E06H 1OWHA 4JZIA 3UOUA 5EU8A 2BD4A 2PSXA 3ODDA 4JK5A 4K8BA 4KGAA 5DG6A 5EPYA 3RXBA 3RXSA 2PKAA 1A46H 1GJ6A 3SV9A 2L6OA 2ZCKP 1ZPCA 1PQAA 3TIUA 1ELDE 3CENA 4Y0YE 1YPEH 2FOGA 3KCGH 2VGCC 4AB8A 3E16B 2XWAA 1W3CA 1W13U 3RXIA 2FP7B 4CRGA 5JYIA 5DN6D 3U69H 4Y71A 5HXFA 1TABE 1O2YA 1NZQH 1EKBB 1CBWC 1S83A 1RRKA 3S7HB 1YLDA 1J15A 1B0EA 2GZ9A 1GMHG 4NSYA 3SJ8A 1LQEA 1G2LA 4AGKA 3E90B 2QIQA 1SGRE 1CGIE 4I86A 3PMJA 2KAIA 4BANB 1B7XB 2FZZA 2Y7XA 2C8WB 3K65B 1ELBA 4CR9A 4RKOB 3DSGA 2FM2A 1MBQA 3RP2A 1GCDA 4AC9A 5DP5A 3V13A 2V35A 5EXNA 1XX9A 3CS7A 2Z9GA 4Y11E 1BTWA 5E0GA 3DD2H 3LGYA 4FVDA 3UNSA 3V3MA 4BAKB 2BD9A 2WV4A 2F4LA 2ANYA 3MQKC 2K8IA 3SV7A 1INCA 1P11E 1AFQC 5GCHF 4U32A 4BXWA 1SOZA 1IQMA 3W1EA 1BHXB 4E7NA 1O3PB 5JBAS 1BA8B 1O2TA 2ZCLP 3AW1A 4K60A 8LPRA 3RC5A 1ZMLA 5DP4A 1GPZA 3IWMA 3QZRA 4BAOB 1HJ8A 1Q3XA 1GCTB 1TNGA 1G32B 3MMGA 2Y80A 4X1NU 1E36B 4IGDA 3RXPA 1H8IH 1SGYE 1AB9B 1QRZA 1QURH 3LONA 4WH8A 1JBUH 1P09A 1DX5M 1GI1A 2CN0H 3PRDA 4X6PA 3RXAA 1OKXA 1J9CH 1SGDE 2OQ5A 3A82A 1TALA 2PTNA 1SGQE 2YNAA 1Y3XA 4TT3D 2YOLA 1ZTKA 3BIUH 4K2YA 5EQRA 5DSFA 2FIRH 1FPHH 1ACBE 3T26A 1UHBB 2BHGA 5DJ7A 1TMBH 1WQSA 1GBIA 1DSUA 1ZGVA 2XNIA 1W0YH 3TVJB 1QRXA 4Q4LA 2C90B 1L4DA 1OX1A 2EI7A 3A86A 3NKKA 1SFIA 3WWFA 3RXLA 4D7GA 1V2ST 1EPTA 2R0LA 3OAAD 2P3TB 1HV7A 3LOXA 2J98B 3A7TA 1MCTA 2ZNKH 1OP2A 2TBSA 1DDJA 2BQ6B 3HGPA 4A6LA 4B2AA 1EOLA 4KP0A 1BRAA 4R8TB 5EW2H 5EXLA 1AY6H 3ZZ5A 4Y7BA 3L33A 1O33A 3AAVA 5ESTE 1V2TT 1PYTD 1HNEE 1PPGE 4TY7A 2SGEE 5AFZH 4O9VA 1MMJN 1GVKB 4ISNA 3RXTA 1GBEA 2OC8A 3AASA 3UREA 1MTNB 2BVXH 3KQDA 1AWFH 1LPKB 4ZHLU 2ZTYA 3BSQA 5C5NA 1TRYA 1O2GH 4YTAA 3QX5H 3AK5A 4P02A 2UUYA 3BTWE 1CA8B 4FXGH 1IQEA 3KYFA 4KTUA 1SQOA 3URCA 3P8NA 5GIBA 1GWAA 3MHWU 1EJMA 1S85A 5B6OA 1NU9A 1NFUA 1Z8IB 1SGCA 1KXAA 2ASUB 1DOJA 1TQ7B 3A7WA 2Y5HA 3UWIA 1GI5A 2AFQB 1IHTH 1SLXB 1PPFE 4ISIH 4XD7D 2H5DA 3KF2A 1K9OE 1V3XA 3BG4B 1GHVH 3RXKA 4NIWA 3VFEA 2Q1JA 1BTUA 2QY0B 1GVZA 4AGJA 2Z9JA 1COWD 1ANDA 1OYTH 4ABDA 2YNBA 1W11U 1FIZA 1KXCA 3GICB 3JZ2B 2ZPQA 2WPMS 1HJ9A 2WZQA 2Q6DA 4Y79A 2QF4A 2WYJA 2VIDA 2CV3A 1BTZA 1SL3A 3ZYEA 2KX4A 1FY8E 3P6ZB 5I25A 1LTOA 3M37A 2KCPA 3MH4A 2ZKSA 1FAKH 1VCQA 2XC0A 1MH0A 5EGMA 4XOJA 1T4VH 1TBQH 3Q77A 4NFFA 1Z71A 1ELEE 4ZUHA 3PTNA 3Q76A 4J2YB 5A8ZA 1YPMH 2ALPA 5JPMH 4ZKSU 2BDCA 1VGCC 2H9HA 3SQEE 2ZHDA 1ELTA 2G5VA 3WWBA 3T25A 1Z8GA 2IJD1 8KME2 5ABWA 1PYTC 3UTUH 1XUFA 3EA7A 4XE4A 3A87A 1BT7A 4GAWA 4ISLA 1MBMA 2EC9H 2J94A 1O2JA 2BDGA 2VWNA 4JZEH 4K1TA 1DWBH 1C5SA 2Q6GA 1GJ5H 1NRRH 1SGFA 5JB8S 2QF5A 2QYIA 2M5TA 5FL7D 3PV4A 1HFDA 5TCAA 1GGDB 2OC0A 5KECA 1DPOA 4H42U 1RXPA 1HAPH 1F0SA 4WH6A 2AEIH 3RXRA 2L74A 2ZTXA 2ZIQH 1QHRB 1TIOA 2Y5FA 1FY3A 1SB1H 2I6SA 1BRCE 4HFPB 1GMCG 1IQNA 3HKJB 4AG2A 4Y76A 2JJ1D 2EEKA 2GCTB 2VVCA 3SHAH 1GJ4H 4ABIA 1GBTA 2YMSB 1HUTH 1TQ0B 4IC6A 4ASHA 1AVGH 5PTPA 2RDEA 2JJ2D 4A5TS 5CHAC 3ITIA 4RN6A 5HM2A 3UY9A 2BOHB 4IN1A 2P16A 1QL7A 2WPLS 2NU0E 2FYRA 8GCHG 5TCCA 3S7KB 2JH0D 3BTTE 4KTSA 4NIXA 3ZVGA 1TX6A 4Y8YA 2GT8A 1OWJA 4XRNA 3SJIA 2BVSH 4XBBA 2J38A 3LU9B 3TJOA 3Q3KA 3W94A 3U1JB 4ABJA 1NM6A 3MO3A 3QDZB 3VB7A 1QNJA 2J95A 2BLWA 1NRQH 2AIQA 1FN8A 1HBTH 5K0HA 3TJUA 1Z7KA 3SGQE 1JRTA 1YC0A 2WPKS 4NZLA 4YLQH 4AFSA 2C8ZB 1ZTLA 2H1UA 1ELCA 5L6NH 3NUMA 1ESAA 3BEIB 1C5OH 2FMJA 1GG6C 1K28D 1UVPA 1UTKA 3S9BA 1O3LA 1TPAE 2DUCA 2V6NA 3W95A 2BD5A 3SU2A 1LO6A 4JYUH 3QTOH 3TNSA 3GY7A 5GCHG 3BEFB 2ZU1A 2VIVA 1ETSH 1GBHA 4X8SH 1AWHB 1P2MA 1JMOH 6CHAC 3SUGA 4FUDA 1DY9A 1O2SA 3KN2A 4X8VH 1DUAA 3MNSA 3PTBA 4ABBA 3UB0A 1O2LA 1P10A 3I29A 1DANH 1EXFA 1K1OA 4O3TA 3ZV9A 1GHBF 2OBOA 1MKXK 2ZTZA 1DWEH 3M3VA 3QTVH 2P94A 5LPRA 3QWCH 1AU8A 2XOKD 3PLBA 1GJ9B 3IG6B 2FTLE 2C8XB 3OY5U 4Q7YA 5I46H 1C1SA 4FUBA 3GCTG 3RM2H 1CA0B 4UEHH 4D8NA 1O5EH 1O5AB 1GI0A 1TMTH 1BBRK 1Y3WA 1RJXB 1HAGE 1A2CH 4WXIA 1C1VH 4X6NA 3SNDA 1PPCE 4U01A 2A7HA 5FBIA 1FLEE 1KSNA 1VJAU 2C8YB 1LHDH 3RU4D 3QLPH 1CT2E 2PUQH 3UIRA 5EJLA 1C2JA 1GHXH 1Y5UT 2QAAA 3I77A 3H7OA 1C5MD 2VIQA 1YCPK 1BMFD 4X1QU 3STJA 4CHAC 4GSOA 1P2OA 3GCOA 5EODA 1C5UA 2QGRA 2P8OC 3KEEA 2WV9A 3PMBB 1DLKB 2PW8H 1DITH 5FPSA 1BMMH 3E91A 2GCHF 1ZMJA 4GVUA 2GMTC 3ATMA 3GY6A 1MTWA 1NRNH 3PV5A 2QF0A 1AMHA 2ZO3H 2VNTA 2ZU4A 1AI8H 1RIWC 4TSFD 2Z3CA 7LPRA 1AVXA 1UTNA 1W12U 5J4QA 1GHAF 2CHAC 2ZDLA 1XUHA 1T32A 3MH6A 1V2PT 5FCKA 1K1MA 3N99A 3DCLA 1BRBE 4MNYA 1MZDA 1BBRE 1UK4A 4JYTA 1NS3A 4B6FA 1D3TB 4NA9H 2BX4A 2ZGCA 1XUJA 4ABFA 1MTVA 3MO6A 1D9IA 3FP7E 1ELGA 4IMQA 1FDPA 1FONA 3TH2H 2BY8X 4MPVA 1MTSA 3LJJA 1YY3A 4H4FA 1E35B 3LH1A 2B5TB 2H2ZA 1AUTC 4SGAE 4FUJA 2Y5GA 3QK1A 1DXWA 5JBBS 1DXPA 4WVPE 1QCPA 4MPWA 1PPHE 4UE7H 4B73A 1RD3B 1JOUB 1FNIA 1FN6A 4K3JA 4X2XA 4TY6A 1HAOH 2FYQA 3K9XB 1RFNA 4FU7A 4D7FA 3TLOA 2XC4A 2ALVA 1MD8A 1ZOMA 4X1PU 1GDNA 2K1QA 1TNIA 3U9AH 1CU1A 1V2JT 4X6OA 1QBNA 1XKBC 3SV2H 4I8GA 1HXFH 1TNKA 4Z0KA 5DP3A 5KEDA 4CRCA 3BTDE 2Z3EA 2PTCE 3GY2A 3P8GA 4CH2B 2Y82A 2FOBA 1C1WH 1C1TA 3M5LA 1A3BH 3NZIA 3L6PA 2HNTE 2GZ8A 1AZ8A 1TPPA 1XXDA 4RI0A 1W14U 3SHCH 4ABAA 3LC5A 2IPQX 2BTCE 3U8RH 2A2XH 2G4UA 2VWOA 1NC6A 4OGXA 3TK5A 1NTPA 5F6MA 4NWKA 3K6ZA 2JKHA 5HKKD 1GJAB 4NFEA 1A0JA 1CVWH 4PROA 2QV1A 2TGPZ 1SBWA 3F0PA 4ZKNU 5A0BA 2LELA 1JWTA 2HVYB 1QJ7B 3HATH 2WPIS 4M7GA 1VR1H 1MZAA 2ANWA 2XYAA 4FUIA 2OLGA 1O2XA 2AGIX 4YM9A 1C5VA 1QTFA 1BDAA 1KXFA 4XDEA 2SGPE 1BTYA 3OY6U 4MPUA 1GJ7B 1GBLA 2FS9A 1GI3A 3PO1C 7GCHG 1O2IA 1BCUH 4RSPA 1F5KU 1QQUA 1C4V2 3MO9A 5HYOA 4JCNA 1BMAA 5FPTA 3T28A 4FU8A 3CP7A 4DGJA 4ZH8A 2RA3A 2QXHA 3S9AA 5C1UA 2VH6A 1QFKH 4I32A 1ESBA 2SFAA 4IBLH 1C2HA 1VITF 1O2WA 2EI6A 3LIWA 3SW2B 4YOIA 3SNEA 1GG6B 4A1XA 3A85A 3V0XA 1GBBA 2FOMB 2XBXA 5C17A 2OK5A 1ESTA 2PHBA 5EJ1A 3RMMH 5T1VA 1HAIH 1P2KA 2TGAA 1EP6A 1FAXA 1SLWB 2OUAA 3NPSA 3M7TA 3TPIZ 1KLJH 2H6MA 1DWCH 3FZDA 2HRVA 1UTJA 3A84A 2J5UA 5G4BA 2G00A 3T5FH 4K1SA 3MWIU 1CT4E 1KXBA 1Z1IA 2AYWA 1OHHD 2PV9B 1IQGA 2XBVA 5DK1A 3MH5A 1RTKA 3MOCA 4FUHA 4BNRA 1C4Y2 2ILNA 2AMQA 2BXTH 5DP7A 1DM4B 4INHA 1YPGH 1YBWA 1BIOA 3ZIAD 3DUXH 1Y5AT 4WF8A 1YPJH 1ZGIA 5EQQA 4JK6A 5FCRA 1FUJA 2B7DH 2O8WA 1HB0B 4F49A 1ZJKA 2SGDE 1IQLA 2LNCA 2WUCA 4ZCNA 4DIHH 1EATA 2J98A 1LKAA 2G81E 4Y10E 1BUIA 2WYGA 1T7CA 4B74A 3C27B 3N7OA 4K8YA 1BBRH 1Y59T 1F92A 2BD2A 3UQVA 3SNCA 2FLBH 1QA0A 1TRMA 4F4OC 5A0AE 2BZAA 4AB9A 3E6PH 4DT7B 1SQAA 4ZAEA 5EJZA 3M35A 1N8OC 1C5XB 4Y6DA 4WJG2 1GHBG 2BDBA 1KTSB 1AHTH 3ZZDA 4YZUA 1HJAC 2Y6TA 3TJVA 1O2QA 3LH3A 3E8LA 1V2KT 3A8DA 1BTXA 1YCPH 1T8MA 1C9PA 1FMGA 3SUFA 2ZI2H 1GMDG 1QBVH 1W0JD 2PR3A 2W3IA 2ZHQH 1K1PA 1G3DA 4INKA 1LQDB 1AE8H 2A5AA 2A5KA 2SNVA 1KDQA 1SGPE 1YGCH 2BX3A 2PP6A 1Z8JB 1LHEH 1O3OA 2W7SA 3U28C 1P12E 4XFQA 2CF8H 1H9IE 5F8XA 1OWIA 4FVBA 2HWLB 1W10U 1S81A 2KAIB 4BTTB 4Z1MD 5J4SA 1O2ZA 5C1YA 1GJDB 4X8UH 3RXJA 1RGQA 3DFLA 1SLUB 3F1SB 1EJAA 1P0SH 2C3SA 1MAYA 1GBFA 3H7TA 2VVUA 2HVXA 1WQVH 3PYHA 3V12A 1WAYB 1U6QA 1ZLRA 3GCHB 1L1NA 4FUCA 2ZHEH 2HALA 4WMEA 3TK6A 3SOSA 2PKSB 1E0FD 1VCPA 1THPB 4VGCC 2FOEA 4JZDH 3M36A 4ACBA 3K6YA 1IAUA 3CS0A 1EZUC 1GHAG 1WCZA 5ETXA 1J8AA 4DG4A 3P17H 2A4OA 1GVLA 2D1JA 2JETC 4Y7AA 3TNTA 3F9FA 5E0JA 1M9UA 2F9BH 2ZFFH 3QGNB 1MQ5A 3S0NA 1O3GA 1QB1A 3SU4A 4AZ2B 1HGTH 2F9VA 3S9CA 2KZ4A 2W26A 3SNBA 3RMOH 3VPKA 1ORFA 3OEHD 3H09A 3MTYA 3MU8A 1Z8RA 3ZZ6A 4LOYH 5AVDA 4F48B 2D2DA 1F2SE 3EQ0H 2VIPA 2XBYA 5IYTA 4B2BA 2OD3B 1OPHB 1V2MT 1D3QB 2XCFA 5T6GA 2A31A 2BDAA 3A7ZA 4NA8A 4OS6A 4DVAU 3R0FA 3RUOA 2VWMA 1EPTB 3UR9A 4RT0A 5L2ZH 3BV9B 4IC5A 4Y8XA 1FPCH 2XBWA 3SNAA 2ZFTA 5BRRE 1GBMA 1EFRD 2WPJS 2BY9X 4ZHAA 3DA9B 3RXUA 3VGCB 1W8BH 4OS1A 3GY5A 3VEQB 2SGFE 1F5RA 1O3HA 1IQHA 1LPZB 2WSSD 3BF6H 2BLQA 2UWPA 2HOBA 4YXWD 2GV7A 3A7XA 1PQ7A 4OS5A 2BD8A 4Q2KA 1TOMH 3RMLH 1L1GA 2O9QA 2CJIA 3V7TA 4ZXYH 2R2MB 2G52A 1ZRBA 2BDIA 3PM3A 4HZHA 4CH8B 2GTBA 2ZDVH 4YLUA 1TNJA 3OTJE 2CGAA 1JRSA 4GUXA 3T62A 2GX4A 4ABHA 3A8CA 5GDSH 1L1JA 1TNLA 4A1VA 3EE7A 2VGCB 1O38A 1C5PA 1GI2A 1H1BA 1LVOA 3ODFA 1CHOF 2Y81A 2ZC9H 1NFWA 1A0LA 2J4IA 3SI3H 3ZYDA 1Z6JH 1TX7A 3M61U 3RDZA 1CBWB 5IDKA 4UFFH 1ANCA 2P95A 1HYLA 1O2PA 1H9HE 1WV7H 1O2KA 2VWLA 1DWDH 3NRLA 4FUFA 5T6DA 1YLCA 4JZ1A 1G3BA 3TH4H 5CDFE 3A7VA 4MTBA 1HAVB 2XCNA 3RXFA 5C94A 1NFYA 2AMDA 3SU0A 2BDYA 4YT7H 3MFJA 1S0RA 1ZJDA 4UDWH 4DJZB 3SJOA 1O3IA 1V2RT 3LJOA 4MG3A 1VITG 3FP6E 4FUGA 5AF9H 1P02A 3ZVDA 1JIMA 4WMFA 7KMEH 3Q3XA 1O5BB 4LZ4B 2OCVB 1IQFA 2ULLA 4LXBH 4AYYB 3FOAA 1H8ED 1AFQB 1WUNH 3ATIA 2A4GA 1TGBA 4BTIB 1O34A 4MQAA 3PV2A 1QZ8A 3P8OA 1FXYA 6ESTA 2EY4C 4B76A 2H5CA 1V2QT 4IMZA 3A8BA 3SYJA 3TH3H 1GBJA 1B5GH 1NN6A 3EAJA 1O2HA 2PUXB 3SGBE 1AFEH 1O39A 1DFPA 5HMAA 1QY6A 3SU1A 1SGTA 1GBKA 3FO8D 1XUKA 3KGPA 4OS2A 1GMHF 5HGGA 2KCYA 1SI5H 1G2MA 5E2OA 1Y3UA 3T2NA 2FI3E 2ZECA 4X6MA 2D26C 5EXMA 4ABEA 3O8RA 2V7QD 1P2JA 3B8JA 3MU4A 2P3UB 1QL8A 4D9RA 4B71A 1EOJA 2BYAX 1XUGA 4NZQA 1NBME 1WDIA 1BRUP 5DP8A 1ZRKA 3STIA 3EA9A 3JZ1B 3VXFH 1SQRA 2STAE 1C2LA 1GJCB 3SZEA 1TGTA 1VCWA 4A92A 4A1TA 5SGAE 3MI4A 4FETA 1HIAA 2FX6A 3D49H 1MKWK 3RXCA 1OP0A 1O2MA 2WPDD 2GJGA 1GJ8B 1TNHA 1PQ8A 3RC4A 2P3FH 3BTGE 1P8VC 4D76A 2ZCHP 4INLA 3EA8A 4NGAH 2FWWA 1TB6H 2VIOA 4IN2A 2W6JD 3GYLB 3FFGA 2O8MA 1GDQA 3F9GA 1T8OA 2W3KA 4BAHB 2ZDNA 5C67A 4ABGA 1UCYK 2BY5X 3RXDA 1SOTA 1W2KH 2Q6FA 1S0QA 1X7AC 3EE0B 1O3EA 1MD7A 3TGKE 2BZ6H 2R2WU 2ZG0H 2PGBB 2AS9A 3P70B 5E0HA 3SGAE 2BB4A 4H6SB 2O8LA 3MNXA 1H8DH 2A1DB 2Y7ZA 3TGJE 1C2FA 2ZZUH 3VB6A 1O5DH 3ZZ4A 1K2I1 1AKSA 1TLDA 1XKAC 1BOQA 3FKSD 3UQOA 3MH7A 1O3FA 3LGTA 1ELFA 3SJ9A 1AGJA 5DO4H 1EZQA 1MCVA 3EDXB 3LDXH 1SGFG 2Z9IA 4SGBE 4TWWA 1QL9A 4K5ZA 2ODPA 4FUEA 4R0IA 2WV5A 1DT2A 1GCTC 1YF4A 3B23B 1CSOE 1TYNA 3BN9A 1T31A 2WINI 1AB9C 5DP6A 2F9NA 1QBOA 2VU8E 2GT7A 3KYGA 3PMAB 1EP5A 2A0QB 3I78A 1TBZH 1O3CA 1GI4A 1D4PB 1C4U2 1UVOA 4CBNA 1S6HA 2WHXA 2CMYA 2JIZD 3VB4A 1SPJA 1TONA 3D65E 4WMDA 1O5FH 5AFYH 1A5IA 2DE8A 1HCGA 1XVMA 2QN5T 3DT0H 1P3EA 1UCYE 1NPMA 3A8AA 4ESTE 3LKWA 5FXLA 2KCAA 1WBGB 3SUDA 2BXUH 1GL0E 3DSOA 2CK3D 5GJ4B 5A8YA 3VXEH 1MQ6A 5T3HA 1VGCB 5JB9S 1BHXF 1YPHE 4DW2U 1FX0B 3K2UA 1NRPH 3TU7H 3MU0A 3TK9A 1W0KD 3EYDA 1FZZA 1GBCA 2BLOA 2A5IA 3MU1A 4MDSA 2GKVE 1LVYA 3GYMA 3KNXA 3PLKA 3OX7U 1YWUA 2BY6X 1AN1E 1DS2E 2AGEX 2P59A 8ESTE 1QQ4A 1C9TA 1C1RA 1B0FA 5KGOA 2G5NA 3PROA 1P9SA 1IOEA 3ZZ3A 4JMYA 2ZFQH 4FU9A 5CHBA 1UVSH 5F53A 2V3OH 1TRNA 4P00A 4TPYA 5EQSA 1JIRA 1NY22 4XBDA 4Y0ZE 2QC2A 1E34B 2GDDA 3ESTA 4AFQA 4CBOA 1MTNC 2VINA 1TPSA 4HG6A 1ZHMA 1O2VA 1C5WB 3HKIB 5F03A 5EIYA 4CRBA 1WOFA 3RXHA 4THNH 4UONA 1OS8A 1V2UT 1C5ZB 1THSH 2IJOB 2HNTC 1MABB 1UTLM 1DSTA 3N7EA 3QZQA 3G01A 4X0WU 2ZWLH 3T27A 2RA0A 2R0KA 1AUJA 3U8OH 1AD8H 2XNDD 1T8LA 3FP8E 5CHAB 1G36A 1Y3YA 2THFB 4AFUA 1UTOA 3ZVEA 1ANEA 3RU4T 1Q2WA 1RS0A 3M5MA 2V3HH 2B0FA 1E37B 3TJNA 5E2PA 1OWEA 5FX5A 1CQQA 4Q7XA 1MUEB 2ZGXH 4U30A 4NSVA 5TJXA 3GDVA 2YMSD 3BG4C 3MNBA 3ZZCA 1ABIH 2OC1A 1W0ZU 3R3GB 1ABJH 4AYVB 1N6XA 1DUEA 2QCYA 2XW9A 1O5CB 1O3NA 2G55A 2OINA 1MU8B 6LPRA 2XTTB 5AHGH 3UPEA 4M9FA 3SORA 1TE0A 1C5QA 2F43B 4I8LA 3U8TH 5FHTA 3O8CA 1WTHD 1V2VT 1C2EA 3BTKE 3P92A 5CMXH 5EW1H 5LH8A 3MNCA 2JH5D 4ZKRU 1TOCB 2HNTF 2EI8A 3IITA 1TAWA 2B8OH 4AN7A 3ZVCA 4ACAA 3UFAA 1PPBH 2CF9H 2H9EH 4MLFB 2AIPA 1MU6B 3ZZ9A 3OE7D 2RDLA 1V6DA 1SKYE 1GMCF 2EQNA 1CE5A 1EAIA 1MTUA 2XXLA 4CREA 1NROH 2ESTE 4AORA 1QR3E 2ANMH 3F2GA 5DGJA 1CT0E 3UNQA 1SHYA 1C5TA 1K21H 4GCHF 1TA6A 1YCPM 1O0DH 1G37A 1RTFB 6CHAB 2TGDA 3PMHB 2GV6A 2ZFPH 1KLIH 2C93B 2RCEA 1QIXB 3ZV8A 1F0RA 3EGKH 1GGDC 5F8TA 4TWYA 3M7UA 2ZFRH 4X1SU 1XVOA 2XWBI 1F0TA 3SU3A 1C1PA 2ZQ1A 1GJBB 8GCHF 1VJ9U 1UHBA 1EAXA 1TBRH 4O97A 1MKWH 3KQEA 1MKXH 1KYNA 1ZPBA 3O8DA 4K1EA 2FDAA 3FZZA 3NCLA 1ZHPA 2NWNA 2QXGA 4ISOA 1ETTH 3SU6A 1UW7A 2FX4A 1ID5H 1KXEA 1PPEE 2GCTC 1A3EH 2BQWB 1GI6A 3LGWA 3NWUA 2PWXA 2TIOA 4H6TA 2F83A 3HPTB 1E1RD 2ZU2A 1YP9A 4GPGA 2C4FH 3A89A 1GHYH 2YMSC 1AVWA 4AG1A 3P95A 5CE1A 3PB1E 1Z6EA 3ZVFA 1UCYH 2ZU5A 1TGNA 1P2IA 2PKAB 1AQ7A 5FBEA 3F2FA 4I8KA 2W7UA 1ZR0A 6GCHF 1FI8A 1NT1A 1O2UA 2ZGHA 3RXOA 1OWDA 4HGCA 2ZHWH 4CHAB 3TITA 1LDTT 3RXGA 3RXVA 1ZSKA 1F5LA 1WSSH 2HPPH 2P8OB 1Y8TA 1UJ1A 4LZ1H 1V2LT 2I6QA 3LGIA 5EPNA 3UUZA 3UOPA 1SGEE 2GMTB 4I7YH 3OU0A 2QF3A 5DPAA 1EZXC 4KTCA 1LHFH 1PFXC 1SC8U 1ZSLA 1CHGA 3FN8A 2Z9KA 4XBCA 2R3UA 1RIWB 1BJVA 2FI4E 2ZHFH 2K0QA 1F0UA 3C1KA 3H5CB 1CGHA 1LHGH 2ZPSA 1C2GA 2CHAB 2RG3A 1THRH 2GP9B 2A7JA 4GHQA 1EASA 2BVRH 2O8UA 1DY8A 3P8FA 3U1IB 3RXMA 3GCTF 3PWCA 1KLTA 1H8HD 5C0TA 1SHHB 3ATWA 4CRAA 2FOHA 1T4UH 4KELA 1PQ5A 3QO6A 3BTQE 3NK8A 3WY8A 1F7ZA 4BXSA 2FEQH 1DLEA 4X2YA 1DICA 4WY3A 1VKYA 1ZTJA 1TA2A 4BOHA 1CGJE 2KR7A 2A4RA 3D62A 1AIXH 5GPIB 2GCHG 1S6FA 1K1IA 5FAHA 1WXRA 3BTME 2SNWA 1QJ1B 3FVFB 4ASUD 1W7XH 2ZPRA 1OXGA 3LPRA 1NO9H 4WWYA 3BTHE 4Y8ZA 1O30A 2NU4E 4DCDA 1A5HA 1EAUA 3F68H 1C1NA 4AFZA 1C2DA 1FQ3A 1P57B 3SUEA 5C2ZA 1XXFA 5DP9A 1S6LA 1UO6A 4JZFH 1BMNH 2V0BA 2P93A 2ZGJA 4MPXA 1CA0C 9ESTA 1VITH 3OFND 3LC3A 2FPZA 1PPZA 2J9NA 2Z3DA 5E8EH 2FO9A 1GL1A 2BLVA 1P05A 2FTMA 1H4WA 1GI8B 2FODA 2ZEBA 1O2NA 7ESTE 1IQIA 3A88A 1TGSZ 1C1UH 1SMFE 5ESBA 3ZZBA 4E05H 1O5GH 1KDQB 5IK2D 1S5SA 2GGVB 1H9LB 2BY7X 3SN8A 1MAXA 3DHKH 2A4QA 4B1TA 1GI9B 3BIVH 1ANBA 3BEUA 2DE9A 1EJNA 5LPEA 1QA7A 1EX3A 3A81A 2FLRH 1D3DB 1ARCA 5A8XA 1L2EA 1OP8A 1YPLH 1LHCH 2F9PA 1HAHH 1HAVA 3F9EA 4YESB 3ZVAA 1AE5A 1C2KA 1UMAH 2B9LA 2Z7FE 1N1LA 3PO1B 1V2OT 5EG4A 3KQ5A 2G8TA 1LVMA 3ZZAA 1NESE 2WUBA 4I8JA 3MU5A 2AH4X 3M5NA 4K69A 3GY4A 2ZA5A 1IHSH 3SBKA 2NU2E 4B75A 3B9FH 1OSSA 1GBAA 1A7SA 5K7RA 4I31A 1P01A 4YOJA 2ODQA 2UUJB 5FX6A 3A7YA 2ZFSA 1WTGH 1C1OA 3SV8A 2QXJA 4TYDA 2FS8A 1BQYA 2WPHS 3UAIC 5JDUB 1ELAA 4ZKOU 2LPRA 3AVZA 3HGNA
chains in the Genus database with same CATH topology
1P04A 1C2IA 1O3MA 3ZZ8A 2R9PA 1IQJA 2AMPA 4DIIH 3RXEA 1L0ZA 1ZSJA 1C5LH 2AGGX 4RKJB 1FY1A 4QT8C 1YM0A 2ODYB 4LK4A 1HLTH 1ZYOA 4HI3A 3GISB 2EA3A 3SI4H 4MVNA 3OSYA 4I8HA 1J17T 2PFEA 3ATLA 4X2WA 4ZROA 1P06A 1SG8B 1Y5BT 3KQCA 3TGIE 2A32A 1LMWB 1NFXA 1ARBA 4MNXA 2GD4B 1O37A 2XC5A 3SQHE 2F91A 1JXPA 1XUIA 7GCHF 1KY9A 2G4TA 1UTMA 2TPIZ 1AZZA 3PLPA 3Q00A 1QRWA 9LPRA 1TGCA 3QUMP 4X1RU 1BTPA 1O3KA 1T8NA 1O3DA 1EUFA 5EOKA 4GCHG 4OS7A 1OYQA 4Z6AH 3LGVA 5HM9A 2GDEH 1K1NA 2IPHA 1P9UA 1HAXB 1SFQB 1SR5C 1TWXB 5DKMA 2ZDKA 3VB3A 1QGFA 4E7RG 3NXPA 2OTVA 1N8OB 2BDHA 3ENSB 2FXRA 4ISHH 1SQTA 1HJAB 3T29A 1G9IE 1CO7E 3UNRA 5F8ZA 2VIWA 4DURA 1DE7H 5BPEA 1ELVA 1WU1A 2PGQB 2FOAA 2OC7A 3GOVB 1QB6A 1RTLA 1EQ9A 2R3YA 5C3NA 2SGQE 1A1RA 3GDUA 1P2QA 3M3TA 2AERH 4U2WA 1P03A 4XSKU 3E0PB 1A5GH 3O8BA 1P3CA 3FAOA 4BTUB 2Z6BD 3LGUA 1QJ6B 3Q3YA 1S82A 5C1XA 3RMNH 2G51A 2IOTA 1UK3A 2OQUA 4UFEH 1ZHRA 1YKTA 2QA9E 1XMNB 3AAUA 5LGOA 3M3SA 1SVPA 2BOKA 2J92A 5A0CA 1FY5A 1LKBA 2PSYA 2ANKH 3SZNA 1HXEH 5A2MH 6GCHG 3OYPA 1K1LA 2UUFB 1W7GH 2BM2A 4Q7ZA 2W5EA 4UFDH 4ZXXH 3BTFE 1D6WA 2ZU3A 2CXVA 2HGTH 2IN2A 2OXSA 1O32A 1FY4A 2FOCA 1TPOA 3F9HA 3ZVBA 2ZGBH 3KHVA 1HRTH 1V2WT 1NU7B 1Z1JA 3E1XB 2A45B 3UWJH 1GDUA 3MYWA 1C5RA 3KIDU 4VGCB 5L30H 3DFJA 4X8TH 1A0HB 1LVBA 1S84A 1O3BA 1OOKB 3PWBA 1HPGA 1C2MA 2TGTA 1N6YA 1EB2A 2HPQH 4YO9A 2NU3E 2D8WA 2JETB 2UUKB 3SU5A 1K1JA 4Q80A 5GXPA 1GMDF 1C1MA 3S69A 1KXDA 3BTEE 4DY7B 1GHWH 4DOQA 2ZQ2A 5JBCS 4MNVA 2XRCA 4TPIZ 5T6FA 1K22H 2VB0A 2H9TH 1UK2A 3QN7A 2BD3A 4AOQA 3RM0H 3E3TA 4GLYA 1UTQA 2JH6D 3A83A 4BAQB 4UD9H 1A61H 4WXVA 3GY8A 1EZSC 1IQKA 1TFXA 1G3EA 5FPYA 3KQBA 2GVFA 1C5YB 1FIWA 5C5OA 1J16A 1TX8A 2J34A 4NIYA 4OS4A 1NRSH 1BITA 3GY3A 1KTTB 2GZ7A 4OGYA 3HK6B 1BZXE 4CR5A 1FV9A 1HIAB 3RC6A 3GCNA 3M5OA 2STBE 2HLCA 2BD7A 4UFGH 1YYY1 2UWOA 3F6UH 2PLXA 3ATKA 1DVAH 2UWLA 1YPHC 3D23A 4JYVH 4KKDA 5C20A 1UVTH 4NIVA 1G30B 3HK3B 2BMGB 1SSXA 2Z9LA 2VVVA 2FESH 3RLWH 1QB9A 3ZZ7A 3M7QA 2FOFA 2VH0A 3FANA 1UVUH 3KL6A 3A80A 1HAYB 1LCYA 1PJPA 3AW0A 2VJ1A 3U98H 1XM1A 1O3AA 2SGAA 1D3PB 3LT3A 1O2RA 1ZZZA 1UTPA 1HDTH 3RLYH 1BTHH 1YPKH 3GCHC 1VZQH 4I33A 4IS5A 1BB0B 1SGIB 1O36A 1O2OA 2PKSC 4CRDA 1AKSB 4GHTA 5LPFA 1V2NT 1KIGH 2A2QH 1ZMNA 4MNWA 4B2CA 5JBTA 1OWKA 4ZMAH 4ZHMU 2ZP0H 3SO3A 1SGNE 1ZPZA 3UR6A 1HAZB 1WYKA 1O31A 3E0NB 1GHZA 2F3CE 2J2UA 3QGJA 4O3UA 2FI5E 4X2VA 4A7IB 2BQ7B 2OBQA 3BG8A 1E38B 1C5NH 1TMUH 5L2YH 3RU4E 3URDA 4HTCH 4BAMB 3GDSA 1C1QA 4NWLA 1FJSA 1LPGB 1CHOG 2ZDAH 3RXQA 1L4ZA 3SV6A 1ETRH 2F9OA 1EAWA 1G3CA 2O8TA 2Z94A 4NA7A 1J14A 4J1YA 4AX9H 2OP9A 1BJUA 1O35A 1BMLA 4YT6H 1SLVB 1A4WH 1GI7B 1EPTC 3VB5A 1EB1H 4O03A 2ZF0H 1AO5A 1D6RA 1O3JA 1Q31A 4NCYA 2QXIA 4YOGA 2ZDMA 3L3TA 2A7CA 3SJKA 3ELAH 3VGCC 5GWZA 1P2NA 2TRMA 5A09A 1GBDA 4CRFA 1Y3VA 4NG9H 4D9QA 2NU1E 2F9UA 5H4IB 4IW4E 4E06H 1OWHA 4JZIA 3UOUA 5EU8A 2BD4A 2PSXA 3ODDA 4JK5A 4K8BA 4KGAA 5DG6A 5EPYA 3RXBA 3RXSA 2PKAA 1A46H 1GJ6A 3SV9A 2ZCKP 1ZPCA 1PQAA 3TIUA 1ELDE 3CENA 4Y0YE 1YPEH 2FOGA 3KCGH 2VGCC 4AB8A 3E16B 2XWAA 1W3CA 1W13U 3RXIA 2FP7B 4CRGA 5JYIA 3U69H 4Y71A 5HXFA 1TABE 1O2YA 1NZQH 1EKBB 1CBWC 1S83A 1RRKA 3S7HB 1YLDA 1J15A 1B0EA 2GZ9A 1GMHG 4NSYA 3SJ8A 1LQEA 1G2LA 4AGKA 3E90B 2QIQA 1SGRE 1CGIE 3PMJA 2KAIA 4BANB 1B7XB 2FZZA 2Y7XA 2C8WB 3K65B 1ELBA 4CR9A 4RKOB 2FM2A 1MBQA 3RP2A 1GCDA 5DP5A 3V13A 2V35A 5EXNA 1XX9A 3CS7A 2Z9GA 4Y11E 1BTWA 5E0GA 3DD2H 3LGYA 4FVDA 3UNSA 3V3MA 4BAKB 2BD9A 2WV4A 2ANYA 3SV7A 1INCA 1P11E 1AFQC 5GCHF 4U32A 4BXWA 1SOZA 1IQMA 1BHXB 4E7NA 1O3PB 5JBAS 1BA8B 1O2TA 2ZCLP 3AW1A 4K60A 8LPRA 3RC5A 1ZMLA 5DP4A 1GPZA 3IWMA 3QZRA 4BAOB 1HJ8A 1Q3XA 1GCTB 1TNGA 1G32B 3MMGA 2Y80A 4X1NU 1E36B 4IGDA 3RXPA 1H8IH 1SGYE 1AB9B 1QRZA 1QURH 3LONA 4WH8A 1JBUH 1P09A 1DX5M 1GI1A 2CN0H 4X6PA 3RXAA 1OKXA 1J9CH 1SGDE 2OQ5A 3A82A 1TALA 2PTNA 1SGQE 2YNAA 1Y3XA 2YOLA 1ZTKA 3BIUH 4K2YA 5EQRA 2FIRH 1FPHH 1ACBE 3T26A 1UHBB 2BHGA 5DJ7A 1TMBH 1WQSA 1GBIA 1DSUA 1ZGVA 2XNIA 1W0YH 3TVJB 1QRXA 2C90B 1L4DA 1OX1A 2EI7A 3A86A 3NKKA 1SFIA 4D7GA 3RXLA 1V2ST 1EPTA 2R0LA 2P3TB 1HV7A 3LOXA 3A7TA 1MCTA 2ZNKH 1OP2A 2TBSA 1DDJA 2BQ6B 3HGPA 4A6LA 4B2AA 1EOLA 4KP0A 1BRAA 4R8TB 5EW2H 5EXLA 1AY6H 3ZZ5A 4Y7BA 3L33A 1O33A 3AAVA 5ESTE 1V2TT 1PYTD 1HNEE 1PPGE 4TY7A 2SGEE 5AFZH 4O9VA 1MMJN 1GVKB 4ISNA 3RXTA 2OC8A 1GBEA 3AASA 3UREA 1MTNB 2BVXH 3KQDA 1AWFH 1LPKB 4ZHLU 2ZTYA 3BSQA 5C5NA 1TRYA 1O2GH 4YTAA 3QX5H 2UUYA 3BTWE 1CA8B 4FXGH 1IQEA 4KTUA 1SQOA 3URCA 3P8NA 5GIBA 1GWAA 3MHWU 1EJMA 1S85A 5B6OA 1NU9A 1NFUA 1Z8IB 1SGCA 1KXAA 2ASUB 1DOJA 1TQ7B 3A7WA 2Y5HA 3UWIA 1GI5A 2AFQB 1IHTH 1SLXB 1PPFE 4ISIH 2H5DA 3KF2A 1K9OE 1V3XA 3BG4B 1GHVH 3RXKA 4NIWA 3VFEA 2Q1JA 1BTUA 2QY0B 1GVZA 4AGJA 2Z9JA 1ANDA 1OYTH 4ABDA 2YNBA 1W11U 1FIZA 1KXCA 3GICB 3JZ2B 2ZPQA 2WPMS 1HJ9A 4Y79A 2Q6DA 2WYJA 2VIDA 2CV3A 1BTZA 1SL3A 3ZYEA 3P6ZB 1FY8E 5I25A 1LTOA 3M37A 3MH4A 2ZKSA 1FAKH 1VCQA 2XC0A 1MH0A 5EGMA 4XOJA 1T4VH 1TBQH 3Q77A 4NFFA 1Z71A 1ELEE 4ZUHA 3PTNA 3Q76A 4J2YB 5A8ZA 1YPMH 2ALPA 5JPMH 4ZKSU 2BDCA 1VGCC 2H9HA 3SQEE 2ZHDA 1ELTA 2G5VA 3T25A 1Z8GA 8KME2 5ABWA 1PYTC 3UTUH 1XUFA 3EA7A 4XE4A 3A87A 1BT7A 4GAWA 4ISLA 1MBMA 2EC9H 2J94A 1O2JA 2BDGA 2VWNA 4JZEH 4K1TA 1DWBH 1C5SA 2Q6GA 1GJ5H 1NRRH 1SGFA 5JB8S 2QYIA 2M5TA 3PV4A 1HFDA 5TCAA 1GGDB 2OC0A 1DPOA 4H42U 1RXPA 1HAPH 1F0SA 4WH6A 2AEIH 3RXRA 2ZTXA 2ZIQH 1QHRB 1TIOA 2Y5FA 1FY3A 1SB1H 2I6SA 1BRCE 4HFPB 1GMCG 1IQNA 3HKJB 4AG2A 4Y76A 2EEKA 2GCTB 2VVCA 3SHAH 1GJ4H 4ABIA 1GBTA 1HUTH 1TQ0B 4IC6A 4ASHA 1AVGH 5PTPA 4A5TS 5CHAC 3ITIA 4RN6A 5HM2A 3UY9A 2BOHB 4IN1A 2P16A 1QL7A 2WPLS 2NU0E 2FYRA 8GCHG 5TCCA 3S7KB 2JH0D 3BTTE 4KTSA 4NIXA 3ZVGA 1TX6A 4Y8YA 2GT8A 1OWJA 3SJIA 2BVSH 4XBBA 2J38A 3LU9B 3TJOA 3Q3KA 3W94A 3U1JB 4ABJA 1NM6A 3MO3A 3QDZB 3VB7A 1QNJA 2J95A 2BLWA 1NRQH 2AIQA 1FN8A 1HBTH 5K0HA 3TJUA 1Z7KA 3SGQE 1JRTA 1YC0A 2WPKS 4NZLA 4YLQH 4AFSA 2C8ZB 1ZTLA 2H1UA 1ELCA 5L6NH 3NUMA 1ESAA 3BEIB 1C5OH 2FMJA 1GG6C 1K28D 1UVPA 1UTKA 3S9BA 1O3LA 1TPAE 2DUCA 2V6NA 3W95A 2BD5A 3SU2A 1LO6A 4JYUH 3QTOH 3TNSA 3GY7A 5GCHG 3BEFB 2ZU1A 2VIVA 1ETSH 1GBHA 4X8SH 1AWHB 1P2MA 1JMOH 6CHAC 3SUGA 4FUDA 1DY9A 1O2SA 3KN2A 4X8VH 1DUAA 3MNSA 3PTBA 4ABBA 1O2LA 1P10A 3I29A 1DANH 1EXFA 1K1OA 4O3TA 3ZV9A 1GHBF 2OBOA 1MKXK 2ZTZA 1DWEH 3M3VA 3QTVH 2P94A 5LPRA 3QWCH 1AU8A 3PLBA 1GJ9B 3IG6B 2FTLE 2C8XB 3OY5U 4Q7YA 5I46H 1C1SA 4FUBA 3GCTG 3RM2H 1CA0B 4UEHH 4D8NA 1O5EH 1O5AB 1GI0A 1TMTH 1BBRK 1Y3WA 1RJXB 1HAGE 1A2CH 4WXIA 1C1VH 4X6NA 3SNDA 1PPCE 4U01A 2A7HA 5FBIA 1FLEE 1KSNA 1VJAU 2C8YB 1LHDH 3RU4D 3QLPH 1CT2E 2PUQH 3UIRA 1C2JA 1GHXH 1Y5UT 2QAAA 3I77A 3H7OA 1C5MD 2VIQA 1YCPK 3STJA 4X1QU 4CHAC 4GSOA 1P2OA 3GCOA 5EODA 1C5UA 2QGRA 2P8OC 3KEEA 3PMBB 1DLKB 2PW8H 1DITH 5FPSA 1BMMH 3E91A 2GCHF 1ZMJA 4GVUA 2GMTC 3ATMA 3GY6A 1MTWA 1NRNH 2QF0A 1AMHA 2ZO3H 2VNTA 2ZU4A 1AI8H 1RIWC 2Z3CA 7LPRA 1AVXA 1UTNA 1W12U 5J4QA 1GHAF 2CHAC 2ZDLA 1XUHA 1T32A 3MH6A 1V2PT 5FCKA 1K1MA 1BRBE 4MNYA 1MZDA 1BBRE 1UK4A 4JYTA 1NS3A 1D3TB 4NA9H 2BX4A 2ZGCA 1XUJA 4ABFA 1MTVA 3MO6A 1D9IA 3FP7E 1ELGA 4IMQA 1FDPA 1FONA 3TH2H 2BY8X 4MPVA 1MTSA 3LJJA 4H4FA 1E35B 3LH1A 2B5TB 2H2ZA 1AUTC 4SGAE 4FUJA 2Y5GA 3QK1A 1DXWA 5JBBS 1DXPA 4WVPE 1QCPA 4MPWA 1PPHE 4UE7H 4B73A 1RD3B 1JOUB 1FNIA 1FN6A 4K3JA 4X2XA 4TY6A 1HAOH 2FYQA 3K9XB 1RFNA 4FU7A 4D7FA 3TLOA 2XC4A 2ALVA 1MD8A 1ZOMA 4X1PU 1GDNA 2K1QA 1TNIA 3U9AH 1CU1A 1V2JT 4X6OA 1QBNA 1XKBC 3SV2H 4I8GA 1HXFH 1TNKA 4Z0KA 5DP3A 4CRCA 3BTDE 2Z3EA 2PTCE 3GY2A 3P8GA 4CH2B 2Y82A 2FOBA 1C1WH 1C1TA 3M5LA 1A3BH 3NZIA 3L6PA 2HNTE 2GZ8A 1AZ8A 1TPPA 1XXDA 1W14U 3SHCH 4ABAA 3LC5A 3U8RH 2BTCE 2A2XH 2G4UA 2VWOA 1NC6A 4OGXA 3TK5A 1NTPA 5F6MA 4NWKA 3K6ZA 2JKHA 1GJAB 4NFEA 1A0JA 1CVWH 4PROA 2QV1A 2TGPZ 1SBWA 4ZKNU 5A0BA 1JWTA 1QJ7B 3HATH 2WPIS 4M7GA 1VR1H 1MZAA 2ANWA 2XYAA 4FUIA 2OLGA 1O2XA 2AGIX 4YM9A 1C5VA 1QTFA 1BDAA 1KXFA 4XDEA 2SGPE 1BTYA 3OY6U 4MPUA 1GJ7B 1GBLA 2FS9A 1GI3A 3PO1C 7GCHG 1O2IA 1BCUH 4RSPA 1F5KU 1QQUA 1C4V2