1E3OC

Crystal structure of oct-1 pou dimer bound to more
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
160
structure length
132
Chain Sequence
EEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMSKLKPLLEKWLNDAEKRTSIETNIRVALEKSFMENQKPTSEDITLIAEQLNMEKEVIRVWFSNRRQKEKRIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*TP*GP*CP*AP*TP*GP*AP*GP*GP*A)-3'
publication title Differential Dimer Activities of the Transcription Factor Oct-1 by DNA-Induced Interface Swapping
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 44
structure length 132
sequence length 160
ec nomenclature
pdb deposition date 2000-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00046 Homeodomain Homeodomain
C PF00157 Pou Pou domain - N-terminal to homeobox domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1e3oC02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1e3oC01
1MBEA 4FBIA 2R5YB 2DTZA 5IP6A 1LQCA 9ANTA 2DA1A 3NAUA 3BTIA 2HI3A 1Y9QA 2BNOA 3JRBA 5FKMA 4MFDA 3TEDA 5FKNA 3HB9A 3NARA 3JXCL 2NS7A 2CSFA 1JT0A 2ME6A 2GRMA 2LR8A 1WH5A 5IP7J 1ZUGA 3LSPA 3HM5A 4Z59A 2NOGA 2WUSR 1PNRA 1TWHJ 3S1RJ 1BW6A 3CMYA 2G0EA 3PO2J 5C4JJ 3CDLA 2HDDA 3GTKJ 3BTJA 1UG2A 2M2EA 2HYJA 2PUEA 2DA7A 3Q0WA 5C4XJ 2ECCA 2R5ZA 5M3FJ 2JN6A 1R63A 4DZJA 4A3IJ 4YBAA 4I76A 3HOYJ 4FE4A 5K7ZA 3JR9A 1X57A 2XGCA 2Y9YA 1D5YA 5EGOA 5K7HA 5EEAA 2ID3A 5K7FA 1HCRA 2O49A 2HINA 3DCFA 2LYRA 3CECA 2JWTA 3Q3SA 5EF6A 1Y1WJ 1B0NA 1I50J 3FMYA 3BR5A 4M3DA 4X4FA 5E3MA 2PE5A 1RESA 4IEJA 2FX0A 2LYSA 2MG4A 1VFCA 3G1LA 1SANA 2E19A 5FJ8J 5F0FA 1T56A 4BBRJ 5E3OA 5FLMJ 2E2HJ 4NDWA 5HODA 4J1WA 4MIMA 3BR1A 4JX6A 1W0UA 2ID6A 2XGEA 3KZ3A 1Q1VA 1X58A 4BXXJ 3DEWA 1MBJA 3FKIJ 4ABZA 4X4DA 3ZHMA 3BTLA 1GVDA 2VPRA 1K83J 2R5ZB 2XPVA 3MLFA 5EYRA 4X6AJ 3A02A 2NS8A 4FCYA 2VKVA 1XG1A 4PU8A 2LYLA 2LKXA 2EBYA 3HDDA 1ITYA 5IYDJ 4X4CA 2D5VA 3CCYA 3UKGA 5J1YA 4LOCA 5EGOB 3CQZJ 3FIWA 3BR6A 1H88C 1MBHA 2JA8J 2WAQN 2JCGA 3RZOJ 1FEXA 1JUSA 4Z5HA 2MSYA 2XB5A 2DMQA 1ETYA 2NVTJ 4JCXA 1ZQ3P 1DU6A 3GN5A 3S16J 4JX4A 1AKHA 3ZHIA 5C3EJ 2PUGA 3O8GA 3G7DA 2DN0A 4B4CA 2L7ZA 3RQIA 1EFAA 3K7AJ 4M3FA 3TRBA 2KDZA 2LFBA 4S0HB 1EF4A 4GFBA 1WIZA 2L49A 2DA3A 4CYCA 2LYKA 2PUDA 2X9DA 1GDTA 3TW6A 4MCXA 2JA6J 2VI6A 2EF8A 1IC8A 4RBOA 2JK3A 3GTLJ 1ENHA 3O9XA 2YU9J 5F0CA 4Y42A 3RZDJ 1QPIA 4B3AA 2KEIA 3BR2A 4J1XA 1POGA 4DYRA 2NVQJ 3LSJA 3GN5B 3Q0UA 4M3BA 3R1FA 5M3MJ 3ZQCA 1W0TA 4O8BA 2IVGA 2LCVA 2XPUA 4GHJA 1QRYA 5EZGA 2OPTA 2LYJA 2EBIA 4XK4A 2GM4A 2NVYJ 3FYAA 1IV6A 2OF7A 4CYCB 4XIDA 2HOAA 1MBFA 3E7LA 4IVZA 4X4EA 2ZB9A 1H89C 2PMZN 2M0CA 3S8QA 1I3QJ 1BDIA 3IH3A 3IH4A 5M5WJ 1IDZA 4I6UA 3B6AA 2JJ7A 3DNVB 1WGXA 2TCTA 4JP0A 1UXCA 1RKTA 1FTTA 2X48A 1DWKA 2B5AA 2DA5A 2PUBA 1JJ6C 4IHXA 2AHQA 3ZQIA 3U3WA 3JRHA 1YSEA 3OIOA 1JTXA 1JKOC 1PERL 4GQMA 2A6CA 1U9OA 2FJ1A 2XB0X 3H3VK 2MEZA 3H0GJ 3VPRA 3QYXA 3BS3A 3M3YJ 4XRMA 1VPWA 3ZOBA 3KJXA 2CQQA 2R0QC 1ZZ7A 2LVSA 2X6OA 2IVQA 4BBSJ 2XSDC 5C44J 2M9HA 2DA6A 4D7MA 1ZPQA 4FTHA 2Y9ZA 3HOWJ 2ELKA 4AYBN 3BR0A 5DS9A 2Y31A 1X2LA 1OSLA 4XICA 2O7OA 3S17J 1HF0A 2JA5J 2HXIA 4X4BA 3OQOA 1ETQA 1NTCA 4DW6A 1H8AC 2YUSA 2R93J 5DTDA 4Z58A 2L0KA 2LY9A 1I6HJ 3W6VA 3JRDA 4X4GA 1R69A 2EZKA 1JH9A 2W48A 5GP9A 2JMWA 4A69C 4IA8A 4X4HA 2VKEA 5JLXA 1FJLA 2HOTA 1JUPA 2AO9A 1LE8A 3G1MA 3HOUJ 1ZAYA 4D7NA 2L7MP 2IVBA 3A03A 5EG0A 2XGDA 3HOXJ 1MH3A 3O8HA 1ADRA 3CROL 4A3DJ 1WPKA 1S7EA 2EZIA 1JFTA 1T33A 1PUFA 2KT0A 1QQBA 2ME0A 1YRNA 1JJ8C 3UFDA 2WV1A 4PU4C 2MW8A 3PO3J 1RR7A 4V2FA 5J3LA 4BY7J 2BNNA 5EZHA 3GBFA 2O8KA 2CQXA 3BQZA 5E3LA 1FTZA 2AXUA 1QVUA 4V2GA 5E3NA 3JXBC 3IVPA 1JKQC 4YG4A 2DA2A 1LMB3 2EH3A 2NVXJ 1ETWA 3SDGA 4AC0A 1ZZ8A 1ZZBA 4EEFG 1LE8B 3A01A 4Z5DA 1MBGA 1IUFA 2HXOA 2ECBA 5GPCA 2TRTA 1LFBA 5EG0B 2K9NA 1BA5A 1A6IA 3LISA 3BG9A 1ZR2A 2AUWA 2Y0SN 3LOCA 3FYMA 5GPAA 1RKWA 2H8RA 1IRZA 4RDUA 4Y52J 3ZQHA 3OOUA 5F04A 1RETA 3HEFA 4M3GA 2DMPA 3GTQJ 2XCJA 4I6ZA 1BW5A 1YRNB 2XIUA 3QWGA 2R1JL 4I6TA 2JVLA 1G2HA 4F8DA 2N8GA 3GBGA 2XJ3A 2CUEA 1ETVA 2E1OA 4QIWN 3MKLA 2FD5A 2LTPA 1DU0A 4JYKA 4W97A 4Z5CA 3Q0VA 1BJZA 5FKOA 5F08A 2FQ4A 1TWCJ 1PRUA 2M8GX 2HOSA 2O9LA 3A01B 3H5TA 2EQRA 4QSHA 5FKKA 4AUXA 1QP4A 4A3GJ 1A5JA 4BY1J 3ZKCA 1AKHB 3TW7A 2P81A 2MGQA 5IOZA 1Y1VJ 3TP3A 3HOZJ 3M4OJ 1UXDA 2CU7A 2K9SA 3QQ6A 1P7JA 1IDYA 4Y7NJ 4C3IJ 3MVPA 3SFIA 4FE7A 1R9TJ 4MO7A 3S2HJ 4PU3C 1WH7A 3HGGA 3GTOJ 5F27A 2VUMJ 1RIOA 2CUFA 2LLKA 5IP9J 1GT0C 2AW6A 3HZIB 4JX5A 3BG5A 2BJCA 1WCMJ 5K98B 1O4XA 2QCOA 2KZ8A 3HBLA 1XS9A 2BNMA 2FJRA 1UTXA 2L7FP 2AXZA 4M6VA 3ZQGA 4DYCA 2ICTA 1TC3C 5FLVA 3RZZA 1Z0XA 4C2MJ 5F1JA 3OQMA 2CJJA 1QVTA 3JRIA 2M34A 2KPJA 2IV1A 3JREA 2R63A 1ZTRA 2H1KA 4X4IA 2R7ZJ 1LLIA 2K40A 1B8IA 3S1MJ 4A3LJ 2PPXA 1MSFC 3GTPJ 4A3EJ 1Z77A 3S1QJ 1JUMA 3QQAA 3OSGA 1OCTC 1LFUP 1CJGA 4BKXA 1IG7A 3HGYA 3G5GA 3BQYA 5M5XJ 2EZLA 2L9RA 1RZRD 2COBA 2E2JJ 1SQ8A 4A3FJ 3F51A 5J1UA 2IU7A 2DMUA 1XC5A 1MBKA 1B72A 3HOVJ 1LCCA 3G1OA 2HSGA 4YG7B 1P7IA 4X1EA 1FIPA 3FISA 3LFPA 1HDPA 2PUCA 4D5CA 3S2DJ 1Y7YA 1SFOJ 4IHVA 4YARA 2PUAA 2OR1L 4A3KJ 3IV5A 1B8IB 2CROA 1ZR4A 4A3JJ 4HNVA 4MLOA 1JT6A 1JGGA 4A3CJ 4UUTA 1WH8A 1E3OC 5JLWA 3CLCA 3WHBA 3F6WA 3ZQLA 4UUSA 1QPZA 3BR3A 4NDLA 3TP0A 1ORKA 1VF9A 1IJWC 3JXDL 3MN2A 3I4MJ 2Y30A 3BTCA 3EUSA 1WETA 1PRAA 1ZKGA 1ZZ6A 1OJLA 1AHDP 4G12A 1B72B 1MNMC 3PXPA 3OMTA 4IWRA 3S14J 2IAIA 1TWAJ 2HQ5A 2YS9A 3SCFA 1APLC 1BDHA 1ZZ9A 2XI8A 1HLVA 1IGNA 1POUA 1OCPA 1U9NA 2DMTA 2RAEA 1BL0A 2Y2ZA 5IYBJ 1TWGJ 2GRLA 1FIAA 1GV2A 1NK2P 4A3BJ 2LK2A 3QPSA 3LSGA 3F0CA 1PRVA 3B6CA 2AXVA 2LP0A 1NK3P 2XPWA 4A3MJ 5BNGA 3FK6A 1UMQA 1PUFB 3GTMJ 5FKLA 4UUSB 1U78A 1JKPC 4FISA 1HDDC 3OQNA 3SCGA 1RPEL 2K9QA 4QTRA 3LNQA 2IUOA 1LCDA 1NEQA 1U8BA 4L5EA 3SCHA 3JRCA 3HKZN 4M3EA 3S15J 2EZHA 3PM1A 5IPAA 1ETOA 4IHYA 1ETKA 1OFCX 4DZPA 1X2NA 2IBDA 4B1RA 1ZGWA 1JWLA 1QP0A 1ZZCA 1WH6A 4I8TA 3FK7A 3JRGA 2WB1N 1WI3A 1MH4A 4XRSA 3C2BA 5EDNA 2PIJA 4MCTA 1X2MA 2AWIA 1ETXA 1DW9A 4C3HJ 3BD1A 2GBYA 5F0HA 4JQDA 3I4NJ 2O38A 2CRGA 2MQKA 4I6RA 4JCYA 3JRFA 1NERA 3L1PA 3LSRA 1HOMA 3S1NJ 5M5YJ 1AU7A 1JFSA 1GUUA 3QF3A 1ZVVA 2GLOA 2O4AA 2XRLA 3F52A 3RKQA 3KXAA 4A93J 4DYQA 2LYPA 4J19A 2I10A 3ZQFA 1RPWA 4W1UA 1JKRC 2R5YA 3B7HA 3BT9A 1K61A 1ZS4A 4C3JJ 3OP9A 3K2AA 3OSFA 2KEJA 4OB4A 2DJNA 2L8NA 1QP7A 3SJMA 2E2IJ 2LYQA 1VI0A 2R92J 2KEKA 5J1RA 2LD5A 5IYCJ 4XRSG 3GTJJ 1QQAA 3BDNA 2DA4A 2JA7J 2OFYA 1VNDA 2QF7A 4D5FA 5IOYA 2GZUA 2ICPA 4PU7A 1UHSA 3GTGJ 3JRAA 1F36A 1RZSA 1TWFJ 4IHWA 3BG3A 2DMNA 3WHCA 2B63J 1F43A 5A7LA 3VK0A 2PUFA 2WIUB 1JTYA 1RZRA 1L1MA 1ZK8A 4FN3A 4MFEA 3QPLA 1CQTA 1GV5A 2IEKA 1MSEC 1XWRA 3IH2A 2EWTA 4YG1A 3D1NI
chains in the Genus database with same CATH superfamily
4LG0B 3GZDC 1YIOA 1MJ9A 2BNOA 3NAUA 1XSVA 2HI3A 5GADJ 4A0XA 1FBSA 5FKMA 3CJNA 4AVZA 2F5FA 4MFDA 3QYEA 3HB9A 3GX4X 2D1HA 2WTEA 1JT0A 3DTEA 2R7SA 1ZUGA 3LSPA 2EFWA 3BP8A 1ODDA 2Z99A 2NOGA 4MNUA 2JPBA 1XMXA 1BW6A 3CMYA 2G0EA 3PO2J 4CCOA 4BU2A 3SEZA 2W57A 5GAGi 5GAHi 2DA7A 5D5VB 1P4XA 2LNMA 2VLAA 2KRFA 3S3MA 3J7AO 2XXPA 2R4GA 4I76A 4KITB 3DP7A 3ZMZA 1X57A 2XGCA 1D5YA 4EATA 4CGZA 2GOMA 5EEAA 2ZCWA 2ID3A 5EGOA 4MEXF 2HINA 3CECA 4PJJA 1Q1HA 4G7OF 1I50J 3G0TA 2PE5A 4NB5A 4HDUA 4IRHA 3H0DA 4ANJA 2E19A 3KP6A 4EZIA 3DU6A 5K5QA 3GZ5A 2K02A 1X19A 4A0ZA 2IS4A 2KISA 3OYMA 2GZWA 2K5CA 4WXHA 3BJOA 4AVPA 1UELB 4X4DA 2VPRA 4IPAA 3OWQA 5EYRA 4X6AJ 3KYCB 1XG1A 1G3YA 2CUZA 3LAPA 3W2AA 3TKYA 1FY7A 3FMQA 4CHUA 2MC3A 5EGOB 4JQFA 3FIWA 5DUIA 2ICWG 2CQ7A 2JCGA 3RZOJ 1BN5A 4Z5HA 2YU3A 4BDYA 2MSYA 1ETYA 2NVTJ 3P5JA 2ZJPF 4OMYA 4KA4A 1RUNA 3GN5A 3S32A 3DWLE 4JX4A 3WTXC 5C3EJ 4IO9F 2CG4A 2PUGA 2P5KA 4LB6B 2JA2A 3QRFF 3H9GA 3RQIA 1EH8A 1EFAA 1FC3A 1LEBA 1TNTA 2IS1A 1IRXA 2LFBA 3CCMI 2L2OA 4KN7X 1WIZA 4GFBA 2QSHX 2LYKA 3VYTB 3TW6A 2RQQA 2VT2A 4L9VA 2JA6J 3COAC 5E8IA 3IRRA 2EF8A 1H0MA 3CC7I 3GTLJ 1D0ZA 3O9XA 2HCNA 3CESA 1TW3A 5EEHA 2QBYA 3T8RA 4B3AA 2HOEA 2NYXA 3OYJA 2QLZA 1R5HA 2X1DA 3BR2A 4J1XA 4DE9A 2OQGA 2NVQJ 3F8NA 3LSJA 3GN5B 5DRTA 3R1FA 3G6EI 3ZQCA 4Y13A 5FFZA 3RTRA 4O8BA 1R5GA 2EB7A 2IVGA 3TELA 1ZN2A 3F8FA 1YJ9I 3DV8A 2OPTA 1HW5A 5B66C 3CDHA 2LYJA 4IF4A 3I64A 3OYDA 1ERDA 3L2RA 1IV6A 2X1EA 2OV7A 4EKIA 4XIDA 1RNLA 2HOAA 2VKDA 1QQIA 4ASNA 4B48A 4J01A 2EILH 4X4EA 1GHCA 2VODA 3S8QA 3K4MA 4G8XA 1HA8A 4XLEA 2FFHA 1BJAA 3OWTA 3OYBA 4I0AA 5M5WJ 1WVRA 3BROA 4LIUA 4YFKF 5LGNA 2TCTA 1XD7A 2JT1A 1UXCA 1RKTA 2CFOA 2CYYA 3FMRA 1DWKA 2B5AA 3H5NA 3K9TA 4IHXA 3JRHA 2R7VA 2GA2A 3OIOA 4EJOA 2R3SA 2F5DA 1U9OA 3PNTA 4N9HA 3H3VK 3H0GJ 3OOPA 3QYXA 4YIRX 3M3YJ 1X1DA 1ON2A 2F5VA 1R1VA 3ZOBA 3KJXA 4X0GA 2CQQA 2KIMA 3K70D 2LVSA 2X6OA 3TMOA 2XSDC 5C44J 4ESJA 2M9HA 2DA6A 3I53A 2PI0A 2RQPA 1AA7A 1D1CA 2A61A 5DS9A 2RDPA 5HDNA 3R6SA 2O7OA 2JA5J 2E7XA 2HS5A 3KEQA 1BBYA 2L0KA 2EK5A 2WB1A 5ILSA 3GFIA 3F22A 2EZKA 2W82A 2BXYA 2YX7A 2P6TA 1PP8F 3AL0C 4HX8A 4PJLA 2M0MA 2PXQA 3NXHA 1ZAYA 3G1MA 2LREA 1Z3XA 2MABA 3AFHA 4YFNF 3JAMK 2EIKH 3A03A 2XROA 3KFWX 3C1DA 1MH3A 1ADRA 3ERED 4ZZLA 2A07F 5AIQA 2VBYA 3DPTA 5LFAA 3ZMVA 3D5LA 2V6EA 2YBDA 3NWTA 4RB3C 1T33A 3C7JA 4DOZA 1A36A 1YRNA 4HNTA 2WV1A 2BNNA 1RR7A 2ISYA 2MH9A 2QSFX 4BY7J 2HVRA 3C3WA 4H4KC 1WJAA 2O8KA 1SVMA 1L0OC 2AXUA 3H36A 1KZHA 3PIOF 3H35A 3RQ4A 5ICGA 4YG4A 2P8TA 4EKGA 2HEOA 1X3UA 2BY2A 4AC0A 1ZZBA 4NUBA 2LH9A 1IUFA 3GZCA 5DTRA 1LFBA 4RAGA 4XR6A 3G2BA 2R7WA 4S04A 5CYVA 4BXFA 2Y0SN 3I5UA 2H8RA 3GZNB 3HEFA 2DMPA 3GTQJ 4R79A 3MKZA 2XIUA 2P4WA 3GXOA 3CCUI 1YRNB 2R1JL 4I6TA 1JHFA 1G2HA 4BEHA 3G73A 2X4HA 3HHGA 4LGWA 3W3CA 2CUEA 1ONVA 2KRHA 4KMUX 2ZNZA 3KL4A 3RJPA 4RAYA 1OYIA 5ERIA 4ER5A 5FKOA 5F08A 2FQ4A 2COMA 3ZQ7A 3BG6A 1QBJA 2VIXA 2ELJA 1KQ0A 1XGSA 1BOBA 5DD8A 3N4MA 3BDDA 4BY1J 2VJ5A 4D0PA 1J9IA 5IOZA 1Y1VJ 1R4NB 5HLIA 1V54H 4BE2A 1RRJA 3QQ6A 4Y7NJ 2PMHA 4Q5SF 4PU3C 4DIQA 4BEHB 1IRFA 4UV9A 3QOPA 3GTOJ 5F27A 2CUFA 2LLKA 2GOXB 1SC7A 1IN4A 5LEJA 4JX5A 3MFKA 2K86A 1MGTA 1OCRH 3ROUA 1VQ6I 3K70C 2BNMA 4EJVA 1VQ5I 2VQGA 2L7FP 3V8LA 4P96A 3DU5A 1KQ8A 3GVAA 4ESFA 5FGMA 1Z0XA 5F1JA 3I3LA 2CJJA 3TOBA 5ICCA 5JI6A 2KPJA 3TDZC 1AWCA 1ZTRA 2RKHA 2Z2SB 2ZJ2A 3QOWA 2OZUA 1CGPA 1HW2A 3QOXA 5EEGA 2K40A 1B8IA 2HFZA 1FWZA 2V1XA 3HSEA 1QZZA 4LIVA 3EYIA 1BI3A 1PYVA 3G5GA 1X4PA 2F48A 1B4AA 3X2QH 1LDDA 2H1LA 2WAQA 2E2JJ 3LA2A 4A3FJ 4MHGA 2VC0A 2IU7A 1MBKA 3A4CA 4L0ZB 5DV5A 2EA4A 2L02A 5DTMA 1P2FA 3IWZA 4X1EA 2D45A 2XKOA 5CVIA 2V9KA 3S2DJ 1Z3YA 4OAYA 3MEXA 3KYLA 1SFOJ 4Q2JA 4M9SA 4HDVA 1B8IB 2DQRA 2CROA 3B02A 2W1OA 2M87A 1SD4A 3CP8A 4LLLA 2A6EF 4UUTA 3JTHA 5L3BA 1WH8A 3FBNB 3WHBA 3ZQLA 1ZRCA 1ORKA 1XTAA 3EQLF 3VSKA 3DEEA 2VBWA 3BTCA 2RVCA 1AHDP 4L9TA 5KCMA 2JSCA 3H92A 2OD5A 2FOKA 2ZMEA 3SCFA 5LHHA 1OYYA 2HR3A 2M7AA 1K6YA 3K2ZA 5LRRA 4WWCA 1OCPA 2RAEA 4RM3A 1YO5C 3EUAA 2Y2ZA 1TWGJ 3OKZA 2FRHA 3TQNA 1YG2A 2WV0A 2QYOA 1SMTA 1S3JA 1NK2P 4A3BJ 3CMAI 4PFPA 5AONA 4B44A 1PRVA 4A3MJ 2CQNA 5BNGA 3ERMA 1HDDC 3L9FA 3SCGA 1I1SA 3LNQA 4QTRA 3GYHX 1I1GA 2ZXJA 4FT8A 4XN3A 1NEQA 1U8BA 2WC2A 1IN5A 3JRCA 2EV0A 1LB2A 3HKZN 4M3EA 3S15J 3CCLI 2LF8A 3PM1A 2Q2EA 4IHYA 3I4PA 3IHUA 4KDPA 2CUJA 1X2NA 3DPLC 1ZGWA 2ZMEB 1QP0A 3ZN1A 4I8TA 4U7DA 2ISZA 2K9MA 1WI3A 4XKVA 5HDGA 4DNCA 2M1BA 2LMDA 4ENJA 3WGHA 3TO6A 1ETXA 1DW9A 4C3HJ 3BD1A 5F0HA 2IGMA 1EH7A 2O38A 2A69F 4AYBA 2YR2A 1D1BA 1X1PA 4JCYA 3L1PA 1PP7U 1XCBA 2MBFA 1ZHFA 3V8KA 1X1CA 3LSRA 1C0WA 6PAXA 2DW4A 3GMEA 5M5YJ 2WAEA 3QF3A 1GLNA 3H9QA 4DYQA 1FNNA 3BG7A 5DUKA 4J19A 4Q4ZF 2Q2EB 3NRVA 1HXDA 3NQOA 3OYLA 2R5YA 1W5CC 3EUHC 3SYTA 1BR2A 4G6DA 1XB4A 3OSFA 3OYEA 1QP7A 2OA4A 3R60A 2E2IJ 1QHHD 1KA8A 1T0FC 2VC1A 2ADUA 3I55I 3WTZA 1UAAA 5IYCJ 4XRSG 2DA4A 2HQNA 2JA7J 2LOOA 4D5FA 1N75A 2P7CB 2VBZA 2VXDA 3WU0A 3F72A 1W5SA 1T95A 1TZLA 1UHSA 5D8KB 2GXBA 2ZXIA 2L1PA 3FMSA 1RZSA 3ULQB 4XKCA 3DTKA 1J59A 4IHWA 3WHCA 1F43A 5A7LA 1FMWA 4RB2C 1JTYA 1RZRA 1K6OA 1L1MA 4M6XA 2B9SA 3QPLA 1HKQA 2IEKA 2EWTA 1XWRA 2DT6A 3K69A 4G9YA 3LL7A 3P9CA 4IJAA 4FBIA 2R5YB 2O61A 1LQCA 9ANTA 2DA1A 3BTIA 3WTTC 2VKHA 2YPRA 3RI4A 1MMGA 1N78A 2BVMA 3JRBA 3TEDA 2EFOA 3NARA 5H6QA 2G7UA 2NS7A 2P0WA 1XMKA 2GRMA 2LR8A 3IKVA 1V5EA 5IP7J 3BWGA 2H94A 3DBRB 4BE1A 5JVGF 1FSEA 4XORA 2WUSR 1R4MB 1TWHJ 1D3YA 1TLHB 3FHNA 2L9SA 3S1RJ 2AXLA 1A6QA 3CDLA 2HDDA 3TO7A 5ICEA 1DP3A 3FBIB 3LFUA 4WXDA 2JQEA 2M2EA 1W7PA 2IGNA 4AIJA 5FLXZ 2XF7A 2JN6A 1HKTA 1R63A 4DZJA 4XNFA 4G6TB 4E7HA 2PLYA 3HG9A 4YBAA 1W36C 3HOYJ 4FE4A 2KLOA 1E17A 2NVUB 4E7JA 4PGHA 4HSRA 4CICA 5K7HA 1ZREA 4II3A 4BJTA 3A2KA 4IL6C 3DCFA 1LFPA 2J7UA 4X4FA 1E2XA 4RM2A 5D6FA 5E3MA 4CXFA 4M71A 2E60A 2QWWA 2V6CA 2MG4A 1U5TA 2VJJA 5FROA 5FJ8J 2KIFA 2HZTA 4HG2A 3FXRA 2PXUA 3M8JA 4NDWA 1R1UA 1J09A 1W0UA 4OIOF 5J40A 3KZYA 3WTWC 2XGEA 3KZ3A 1Q1VA 1TBXA 3C2GA 3DEWA 1MIJA 1W7PB 4I0BA 1ZG1A 3BZKA 5H2FC 2LRDA 3MD2A 5CQGA 4PU8A 2XV4S 2LYLA 1USTA 3ML6A 2G9WA 1YJWI 3V4GA 4X4CA 5E20A 5GAGJ 3DLAA 4D1QA 2MYSA 1DQUA 3BR6A 3LQQA 3F8MA 3NZLA 2DFFA 1XPXA 4XL9A 4HLYA 1JUSA 4HYEA 1WJ5A 4E7ZA 2R7TA 2O0YA 2XB5A 2DMQA 1ZQ3P 3J7YJ 1R7JA 1U5TB 5DEQA 1TQMA 2HU9A 3S16J 1ACIA 1AKHA 2E1MC 2XAUA 3CUQC 3G7DA 1BI1A 2L7ZA 2LLWA 1FT9A 3QU3A 2HKOA 5HS8A 3TRBA 3CJQB 2KDZA 1H9GA 5LHIA 4S0HB 2MD0A 2L49A 5DTQA 4CYCA 2PJPA 2HTSA 4U88A 4MCXA 4RBOA 4HA8A 4HNUA 1ENHA 2L9NA 2ZFUA 2WADA 1TL8A 3RKYA 2YU9J 2V79A 1NHAA 1EV7A 3W6JB 1FX7A 2E34A 1MNDA 3OV8A 5HDKA 2FNAA 3VFZA 3CCEI 1WWXA 4DYRA 1RUOA 1OR7A 2BY3A 2I5UA 4M3BA 4LFUA 4C9YA 1VQKI 2HCSA 2ZO4A 4CZZA 1U3EM 4E4HA 2LCVA 5HOOA 5J47A 2BW3A 3JW4A 1VQ7I 3ISPA 4QWQA 3CLOA 3DQVC 2NVYJ 3L7WA 5TISC 4CYCB 2KJCA 2Y69H 3ABMH 1SFKA 4NNJA 2DOEA 4CCNA 1W4MA 2M0CA 3ZMTA 1I3QJ 1YTYA 1VQMI 2I8DA 3DFGA 2HPIA 3B6AA 1Y8QB 1FPQA 1WGXA 4BQQA 2IXSA 1E3PA 3U1DA 3GWZA 2MC4A 5KVRA 3DLLF 1Y0UA 4MEYF 1OLTA 3ZQIA 2Q1ZB 1PERL 1JTXA 1TT0A 3HHHA 4FASD 1SEUA 1UCRA 2OU2A 4L9JA 4Y17A 2A6CA 2BW3B 2FJ1A 3BC8A 2MEZA 4NQWA 1ZG3A 2DPUA 4ZZDA 4AU7A 2DK8A 1VPWA 4YIIA 2DFHA 3A9YA 2EIJH 3H3ZA 2IVQA 3OYIA 2DDBA 4HRIA 2GIZA 3CCJI 2PQ8A 4GYIA 1KU2A 2R7RA 1ZLKA 2ESHA 4LLGF 2ELKA 5A2QK 3BR0A 3HOWJ 1OSLA 2W00A 1GVJA 3BLYA 2HXIA 4G7HF 1D1AA 2Q8KA 4NC7A 4MQVA 1S72I 3D5RC 1ZGJA 2CO5A 3SDBA 4BACA 4Z58A 2LY9A 1I6HJ 1ZRFA 3W6VA 2UWMA 1R5ID 1R69A 3MZ8A 4ZC3A 5GP9A 1Y0NA 4UNOA 1J0RA 2RN7A 3ZP5A 2GWRA 4XOTA 2HOTA 1JUPA 4XM3A 2IA1A 4NQWB 5F1RA 1BM9A 3G71I 3TFLA 4JK1X 3WTUC 2CV0A 3SX0A 1R1TA 1ZH5A 1JXSA 4HW0A 2R7XA 4A3DJ 1R23A 2AQFA 4XQFA 3K4NA 2F4MB 3O6BB 4GO1A 2EZIA 1JFTA 3D5SC 1PUFA 4ER3A 1QNTA 4RLQA 3UFDA 2MW8A 5J3LA 5HLTA 3WTYC 4OU0A 3GBFA 3LSKA 1J2XA 3BQZA 4HF0A 3JXBC 4HLXA 2VJ4A 3IP4B 2KL4A 2UXXA 2V9PA 2FSWA 3HRUA 1KU9A 1KONA 4HBLA 1RI7A 3K4JA 3M1CA 2JUCA 2AXTC 2NVXJ 3J80K 3EETA 3HZJA 4EEFG 2RNJA 4BHPA 1MBGA 2TRTA 2BEOA 2K9NA 2FF4A 2OBPA 1A6IA 2QQ9A 2OTJI 3BG9A 3CF2A 4AIKA 2PXEA 3C18A 5J4VA 4M3GA 3QWGA 1BW5A 4ZYEA 4RB1A 5DCMA 3ABTA 2KP6A 3CMEI 4F8DA 3CO6C 3I9V2 4HV5A 3GBGA 4N9IA 2E1OA 1TT5B 2BOLA 2HFHA 4QIWN 2PXKA 2BYVE 3DBHB 3EPZA 2FD5A 2CQKA 4JYKA 5CVVA 2DFEA 3KP4A 4ESBA 3ASOH 4EVIA 1TWCJ 5BS6A 1PRUA 5TGTA 1ZRDA 2PXBA 1ZARA 4F52A 2O9LA 4B09A 1VQ8I 2EQRA 4AUXA 2WWYA 3QWLA 2A05A 3Q5FA 3ZCOA 2FMYA 2Y0MA 3ELKA 1OCOH 3KLOA 3TP3A 3JTGA 1TQIA 2CU7A 2K9SA 4CCKA 5JHFA 1IDYA 2J5OA 3SFIA 5DCMB 1T98A 4ITVA 3HIFA 4KT5C 1VZ0A 2VUMJ 3E6BA 1W5TA 4P5OA 3W2VA 2H8WA 3OYAA 2BJCA 2IS2A 4N0BA 2K9LA 2QCOA 5TJJA 2KZ8A 1QHGA 3KYDB 3CMMA 2Z16A 1E3HA 5D5UB 3QYFA 2LKSA 2QBYB 2XUBA 2AXZA 4DYCA 3E6CC 2HYFA 2V1UA 5FLVA 2F5CA 2V26A 1XGOA 1IRGA 4H0EA 2OCEA 3OQMA 1QVTA 2W7NA 2HDCA 4XOPA 2CV1A 5HS9A 2R63A 4X4IA 2QSGX 4OIRF 2R7ZJ 4IVNA 2IT0A 2PPXA 2BY1A 1F9NA 2HYGD 2WY7Q 1MSFC 2L3DA 1Z77A 1YX3A 3U9GA 2FBHA 3QQAA 4I2OA 3OSGA 4MTDA 3RSNA 1QPMA 5M5XJ 1LPQA 3CLQA 2WA0A 1RZRD 3I0TA 2COBA 5FRNA 4EJWA 4KIGA 1LJ9A 1P9QC 3DTIA 2DFIA 3S3NA 3RPUA 5K5OA 2XF6A 4M6YA 2PXLA 1MJAA 1G4DA 2DMUA 1XC5A 1SAUA 1LCCA 1U2WA 3G1OA 3GZDA 1HDPA 2Y48A 2OJED 4D5CA 3D0SA 4IHVA 2D1VA 3UR3C 2PUAA 3H9JA 3KP7A 1D8KA 4A3KJ 3KP3A 4A3JJ 2DODA 1G3WA 4XMYA 1FP1D 4MGRA 1OCZH 4HNVA 1VQPI 2NNNA 4A3CJ 3IUOA 1DUXC 3ABUA 2E71A 4A2UA 3LA7A 1W7PD 4XONA 3F6WA 2ZMEC 1F1ZA 4NDLA 2BGCA 3VEPA 3ZR8X 1AOYA 1JGSA 2HPMA 1WETA 2Y30A 3EUSA 4B8XA 1MW7A 2ESNA 1PRAA 4CSWA 4YIFA 5LBQA 3OMTA 3S14J 2H6CA 1TWAJ 2HQ5A 2DO7A 3WE3A 3GF2A 1BDHA 5L3DA 4F55A 4ZYGA 5DDGA 1HLVA 1Z91A 2W24A 1U9NA 3TBIA 4Y4RA 1VQLI 4KFCA 3ZGKA 5LLQA 2QUFA 3E0JB 5F64A 2LK2A 3QPSA 3WTSC 4V19K 4F3QA 2LP0A 2XPWA 4BS9A 3DPUA 3GTMJ 4A5MA 3OS2A 3FXJA 1JKPC 5LD2C 2K9QA 3FXOA 3OYHA 2CV2A 2KIQA 2DYRH 3M8EA 3AG1H 4E6KG 5KK1A 4B1RA 2KZGA 3ZMSA 5CKTA 4XBFA 1HBXG 3GO5A 3G4SI 2PIJA 2O6GE 4II2A 4RAZA 2ZJRF 1YHQI 4HX4A 1LQ1A 2CW8A 4JQDA 2X0LA 3M07A 1B9MA 2CRGA 2F4IA 3I59A 2DBBA 4K2EA 1KQ9A 1B1BA 4QPOA 1HOMA 5B1BH 2RC4A 1AU7A 1JFSA 1GXQA 2O4AA 2E5ZA 2XVCA 4L18B 3RKQA 4FQGA 2GLOA 2LYPA 2GIVA 1WFXA 3I54A 5BOXA 1V55H 4W1UA 1JKRC 3BT9A 2R7DA 4KIBA 1ZS4A 3OIQA 3OP9A 3T5XA 2KEJA 4KN4X 3PE5A 2L8NA 3SJMA 4XLFA 2LYQA 1VI0A 2R92J 3OMYA 1QQAA 3BDNA 2O5RA 1D5VA 3TEPA 5IOYA 3FXKA 3JCUC 4CCJA 4R8HA 3I59B 3ZXSA 4ZH4F 3CCVI 2FEZA 1MJBA 3JRAA 3MQ0A 2DMNA 3VK0A 1PDNC 1MMNA 3BCBA 4P55A 2P5LC 5ICFA 4KYWA 1IV8A 2A3SA 2MLGA 3IH2A 4IVZA 5JFRA 5DCFA 3M9LA 3CUOA 3R09A 1LDJA 3K1NA 4ER7A 1WJBA 2E35A 3OY9A 2EV6A 5FKNA 1YI2I 3BCAA 3JXCL 4EQQA 3RYPA 4A6DA 2K3FA 1SD5A 2W25A 2Y0SA 2LNBA 1IXRC 2VQHA 1PJRA 2UUZA 4Y15A 1PNRA 2EJRA 3K1MA 2QA4I 2IPQX 4EMSA 2GAUA 3NWSA 3GTKJ 3BTJA 1UG2A 3IAS2 2HYJA 4Q48A 1KU3A 4ZTJA 4KJZA 1VQ4I 3Q0WA 5C4XJ 2KJBA 2IGOA 2R5ZA 1YS6A 3L2WA 5M3FJ 1JE8A 1XN7A 5HVQC 1ZAOA 1ON1A 1FMVA 3TGNA 3H5RA 3TOAA 2Y9YA 1K79A 1DDNA 1LKXA 1K78A 4RS8A 4MTEA 3ZMUA 5K7FA 1HCRA 2O49A 4E7IA 2JWTA 3FMYA 1Y1WJ 2FBKA 2C6YA 1B0NA 2W84A 3BR5A 5IT3A 4I98B 5K1YA 1RESA 1UB9A 2LG4A 2XAJA 3FWEA 2FX0A 3ZMDA 2LYSA 1WJFA 1B9NA 1SANA 3G1LA 4AIDA 5F0FA 1T56A 4BBRJ 5FLMJ 2E2HJ 3FXLA 4MIMA 5H6RA 3BR1A 3OYGA 1MMAA 4JX6A 2ID6A 4EV0A 1L3LA 4BXXJ 3CCSI 4ABZA 4BJ5C 2V1NA 1USSA 3BTLA 4A0YA 1K83J 2R5ZB 2KFDA 2VN2A 3A02A 1FOWA 2NS8A 2LY2A 2VKVA 3ESWB 3PUFA 3R61A 3U2RA 4FCYA 5KAIC 4UB8C 2D5VA 3CCYA 3SXYA 4IX7A 2E1NA 1K78B 5J1YA 2PFBA 2O3FA 1H88C 1IAWA 1MBHA 3BOQA 4RLFA 3T0YA 2CH0A 2PBIA 1IW7F 3K6GA 3R0JA 4HF1A 4XLCA 1CF7A 5HNHA 4S05A 1DU6A 1WSUA 3IRQA 3PSFA 2DQLA 3AL0B 3FF5A 3O2PE 3O8GA 1NG6A 4B4CA 2Z3YA 4BQNA 1G59A 5KAFC 2JVGA 3K7AJ 3V7RA 3WODF 2BBYA 4I09A 5DSXA 1EF4A 1HW1A 2DA3A 2XDVA 3HPGA 2X9DA 1GDTA 5JR3A 1MZBA 2E5NA 3A0BC 1HSTA 3LFKA 2MD5A 1OR7C 3IC7A 4O5VA 4YFXF 2BZTA 5F0CA 4IOAF 3PJRA 3J7AY 1BR4A 1QPIA 5D6EA 3FX3A 2V1DA 2KEIA 2LYCA 1CF7B 5HLGA 4Y3OA 2VOOA 3ZN0A 5E17F 3GFMA 3K4LA 3VOEA 1OYWA 1W0TA 2OUMA 1BIBA 4GHJA 1O7LA 1Y6IA 4IKFA 3E6DA 2GM4A 3FYAA 3F6OA 2BY0A 2P7VB 2ZJQF 3E7LA 3S2WA 1R58A 2KMUA 2PMZN 1X3WB 1O3TA 5DRYA 1Z7UA 1BDIA 3HRTA 3IH4A 4GXOA 5CVJA 4YRVA 1IDZA 4I6UA 5LGUA 4G7ZF 3MMYB 2HZDA 2XXAA 3DNVB 4L9NA 1QO0D 1FTTA 3ONQA 4LITA 2R7QA 2WY8Q 2DOFA 1DP7P 1T6SA 2DA5A 2GQQA 2GXGA 2LC2A 2RGVA 4ENNA 2PUBA 3HUGA 2DDAA 4Z6YA 1DPRA 3CD6I 1YSEA 3U3WA 1JKOC 4I7HA 3PQKA 4FETA 1S29A 1S8NA 2H6BA 2XB0X 4A5NA 1Z9CA 3VPRA 2FBIA 5E18F 5H20A 4DBQA 3OR1C 4ENKA 2R0QC 1ZZ7A 2DJIA 4U0YA 3KEOA 3QPHA 4D7MA 4UUVA 3DBLB 4FTHA 1ZPQA 3QU6A 4PJNA 2NNYA 4ER6A 3CJTB 3BPVA 3HKZA 3WE2A 4HV6A 4OIQF 4XICA 4X4BA 1HF0A 5KHDA 3OQOA 1ETQA 1NTCA 1QZYA 4DW6A 2R93J 2YUSA 4CYDA 2M4KA 1FYMA 4ETSA 2LKPA 4X4GA 1JH9A 3VYRB 2BHYA 2W48A 3DF8A 3IWFA 3HUGB 1X1BA 4KIFA 4C30A 2JMWA 1V3FA 2KHMA 4A69C 3OYFA 3JSOA 4B3XA 2VKEA 1SFEA 5JLXA 1FJLA 1BC7C 3HOUJ 3J81Z 4HQMA 1WI9A 2VE8A 1IO2A 2VOPA 2QKLB 4LK1F 3HOXJ 3F23A 3CROL 4PFOA 1P4WA 2A5YB 5BMZA 4YEJA 3AG3H 2KT0A 2ME0A 1BOAA 3OL3A 1O3SA 1JJ8C 4PU4C 3PO3J 2YX4A 1Z21A 2M3AA 1NW3A 5EZHA 4ENMA 3KPHA 4ZDLA 1OMIA 3QPTA 4V2GA 5E3NA 1N77A 4YELA 2MLKA 1YOVB 1JKQC 1LMB3 3SHFA 1ETWA 3SDGA 2R7OA 2M30A 3B73A 4LJZF 5LRSA 3TO9A 3ASNH 2XAGA 4U87A 2AUWA 3FYMA 5GPAA 1RKWA 1IRZA 3RIRA 4Y52J 3ZQHA 3OOUA 5F04A 1RETA 1YW7A 5FD5A 2XCJA 1P4AA 3KIOA 3CF5F 2JVLA 1QZXA 2N8GA 2P6SA 2J7WA 5DM6F 1ETVA 2B7EA 3QP6A 3IL2A 2EFNA 3MKLA 3ABKH 3CC2I 2LTPA 5CVUA 1DU0A 4W97A 4Z5CA 4HQEA 2XIGA 2NRAC 4UHTA 3AG4H 3FDYA 2CW0F 3DM5A 2M8GX 2HOSA 3T8TA 1SFUA 3PQJA 1OISA 5FKKA 3J7ZI 2CMPA 3TL4X 2ZKZA 4Y33A 2R7FA 3FHZA 3ZKCA 1AKHB 2EINH 4FX0A 2XAFA 5DT2A 5J4YA 2P81A 2MGQA 3LQRA 1SFXA 1OPCA 1UXDA 3S3OA 2PG4A 4BHCA 5J6XA 4FE7A 3NROA 4MO7A 4QLCU 3S2HJ 2WAFA 4CDGA 3GZ6A 1YE9A 1RIOA 2CSOA 5IP9J 4HAMA 2AW6A 1Y39A 3HZIB 1TQPA 2DTRA 2AQEA 2PMUA 1B59A 4P1WA 3BG5A 5L3GA 1A31A 1XGNA 2HQAA 2Z1DA 5D5WB 4R1HA 1UTXA 1XDUA 4M73A 1SVLA 4M6VA 3ZQGA 4EQZA 5EJCA 5CJ9A 3WGGA 1TC3C 3RZZA 4HEA2 1ZGAA 3GLXA 1G6NA 4C2MJ 4UV8A 2M34A 4UVCA 2A6HF 3JREA 2H1KA 3BY6A 3PFIA 2O8XA 3QODA 3S1MJ 4A3LJ 5CVRA 1QGPA 1T0FA 2QGUA 1RIOH 4A3EJ 5D4RA 3S1QJ 1OCTC 3VYUB 1J75A 4IQJA 4BKXA 1CJGA 3DKWA 3BQYA 1J7KA 4O3MA 1DPUA 2QKMB 2L9RA 1ZELA 2XASA 1FOYA 3P9IA 3O3KA 3F51A 5D5XB 2HVQA 4BDZA 4PJMA 3MCZA 1B72A 4RAFA 3LFPA 2A68F 1T39A 2QQ8A 2RREA 2ZXWH 1BI0A 2J5PA 1XMAA 2X6XA 3RKWA 3VSLA 3L2VA 2OR1L 5LGTA 1X1AA 1S7OA 1ZR4A 3K0LA 4MLOA 1JT6A 3ECHA 3C2HA 4PGGA 4C2TA 2BHZA 2EV5A 2KZVA 1E3OC 2CS3A 3BZCA 4TV7A 4A6EA 3CLCA 2HKXA 3FKJA 1MD0A 3FZVA 4UUSA 1QPZA 4CZCA 3M7GA 3VWSA 3TP0A 1YITI 1VF9A 2FOWA 3JXDL 3MN2A 1FSHA 3PFYA 1FYLA 2VQCA 3A9XA 2ZC2A 1OJLA 3WU2C 3VODA 4G12A 1FYKA 1B72B 5L3CA 1MNMC 2EPFA 3PXPA 4AIHA 1U6GA 4KT6A 5IT9Z 2G7HA 4CH7A 5DYMA 4BJ6C 2YS9A 1UJ8A 3HPHA 4BUPA 1SVOA 1IGNA 2LSOA 5AIPA 2DMTA 3F9KA 3HC7A 1QU3A 5IYBJ 1O57A 1P6RA 1FIAA 4J00A 3F8CA 4PSWA 3OS0A 1J5YA 2BXZA 1E0EA 2JTVA 4ZYAA 3RDIA 2DLLA 4OMZA 3F0CA 2AXVA 1NK3P 3FK6A 1LUJB 4RGSA 1VQ9I 1PUFB 3ECOA 4UUSB 3Q9VA 4FX4A 1EA3A 3OQNA 1RPEL 4RGRA 4AM3A 2IUOA 3E5XA 2PXTA 3FXUA 2X1CA 4L5EA 4RA2A 5A2QZ 2HNHA 5BPDA 2EZHA 5IPAA 1Z7LA 4JBAA 3HTSB 1ETKA 1N25A 3S8PA 4DZPA 5IY5H 2PXVA 2F2EA 4GGGA 1JWLA 2K3PA 1WH6A 4UVAA 2FNPA 4F91B 2WB1N 3CZ6A 1LDKB 2F6CA 2KDOA 3N05A 1MH4A 3V7SA 1K4SA 4OAZA 4XRSA 5EDNA 2VONA 5BPIA 2AWIA 2QVOA 2GBYA 1LEAA 3VYSB 3KLNA 1PUEE 1BI2A 2HDWA 5GTIC 2XC7A 1V5FA 2HQRA 4D9JA 4A12A 2PXFA 2MFZA 4IQ4A 5DM7F 4CCMA 3JRFA 3HRSA 1NERA 3CP2A 3E1SA 3CUQA 4AWXB 1KYWA 3PUBA 3VDXA 4BNCA 1I39A 4LD5A 1XSXA 4IHTA 1GUUA 1IZ1A 2MA3A 3MWMA 3P9KA 4ON0A 3S93A 3W2WA 2XRLA 5BQTA 3AKZA 3L2CA 2DPDA 1YLFA 2IW5A 4U0WA 2I10A 3ZQFA 1RPWA 3B7HA 3HXLA 5CQEA 2TDXA 2RV8A 2IRFG 4C3JJ 3K2AA 4XLHA 1D8JA 1WHUA 2DJNA 4OIPF 3MEJA 4OB4A 4M72A 3KCCA 4Q47A 1G3SA 4L5IA 2QENA 2LD5A 4EK9A 2NXNB 3CDIA 2OFYA 1VNDA 2QF7A 3J80Z 3TDUC 4PU7A 2KQRA 2QQAA 2A6TA 3GCMA 3LSMA 4BQAA 3SZTA 2E1MB 5J8FA 3CUQB 2OTLI 1TWFJ 4KUMA 5B1AH 1ZK8A 1MMSA 2UV1A 4MFEA 3QAHA 4BHBA 3QOEA 1CQTA 1MSEC 1HC8A 4YG1A 1EH6A 3T1BA 4ZDOA 3CTAA 1M1EB 2UXNA 2QM3A 1MBEA 3K4CA 3R4KA 1IF1A 2ODRD 2DTZA 3CCRI 5IP6A 1Y9QA 2AS5F 1QA6A 3H5AA 3PNVA 3OIPA 3N97A 2JPCA 4WXCA 2XAQA 1I3AA 4BL0B 2H09A 1XDSA 1S6LA 2CSFA 3ZPLA 2BE5F 2ME6A 5JUWA 3WTVC 1R71A 1WH5A 3SQNA 1XX5A 3HM5A 2LF7A 2VBXA 2PXPA 4Z59A 4L0YB 1JI8A 2DXIA 4BAYA 3HRMA 5HLHA 2CWEA 3EYYA 2XRNA 5C4JJ 3DKXA 1ZLJA 3VB2A 3OYCA 4ZYHA 2ZFWA 2PUEA 1WRJA 2ECCA 4EJTA 4LG3A 1F5TA 4KMFA 4B43A 4XSZF 4A3IJ 4IOCF 1NH3A 5K7ZA 3JR9A 5E1WA 3LSIA 2K4JA 5DD4A 4F93B 5GTHC 2VE9A 1UHMA 3M1EA 3V8JA 2L01A 2LYRA 3Q3SA 5EF6A 2FU4A 4M3DA 2UZKA 1S7AA 4IEJA 1VQOI 1VFCA 3HOSA 5LEKA 1LVKA 2HWVA 5E3OA 3KP5A 5HODA 4AD9A 4OINF 4J1WA 3GFJA 4M9ZA 1YIJI 3K4KA 1I27A 4YG2F 2XXQA 1X58A 3GUDA 4I02A 1Z1DA 2EWNA 3L09A 3KX2A 4IZZA 1MBJA 2K7LA 3FKIJ 5FD6A 3ZHMA 1GVDA 3MLFA 3QP5A 2XPVA 3OS1A 1A35A 1FOXA 1RZ4A 2LKXA 2EBYA 1P92A 3HDDA 5IYDJ 1ITYA 4RGXA 1BR1A 2F4OB 2IVMA 3L2QA 1A04A 3H3UA 3UKGA 2LLVA 4LOCA 1O3RA 3CQZJ 2JA8J 2WAQN 3ABLH 1FEXA 2OZ6A 1B6AA 2IS6A 1IXCA 1YYVA 4JCXA 2D2WA 4EM1A 1O7FA 3E5UA 2M4HA 2JVHA 1V5GA 3G3ZA 5E1ZB 3BZ6A 3ZHIA 3KZZA 2XAHA 2O03A 4BYYA 5L3FA 2DN0A 4HZFA 3RKXA 3LAJA 5TRDA 3HOTA 1IN8A 3Q9SA 1YW8A 4M3FA 1QB2A 1Z05A 2EFPA 5ILVA 4O6JA 2DI3A 1DULA 1HQCA 4DGWB 5B5EC 2PUDA 1XCVA 3OR2C 3JAMZ 1PVEA 2VI6A 1I5ZA 1YX5A 2OCCH 3EUKL 1IC8A 2JK3A 1K4TA 2ZBKA 4Y42A 3U1KA 3RZDJ 4PK4A 3HL2A 4BQOA 1IUYA 3KZIC 3WG9A 1R49A 1UG0A 1POGA 2W4SA 5L3EA 2EFQA 4U0VA 3Q0UA 3ZPXA 2VQLA 5M3MJ 2KRCA 2PX9A 3I58A 1T2KA 4B47A 2XPUA 1HKSA 1QRYA 4C2UA 5EZGA 5FB2A 1RR8C 2EBIA 1BIAA 2GA1A 4XK4A 3DXJF 2VASA 2OF7A 3LWFA 2BVLA 2XF5A 1MBFA 1Z6TA 2ZB9A 5E1XA 5GAEJ 1H89C 4XLPF 4N4NB 3IH3A 2VL8A 3LA3A 2JJ7A 2PJRA 1WJDA 4JP0A 2ACJA 2X48A 2ZXHA 2DK5A 1JJ6C 2AHQA 3CJRB 2IP2A 1FLIA 1BC8C 2GXAA 2JZYA 2FA5A 1R6RA 4GQMA 2E1CA 2DOAA 2L9VA 3FM3A 1OCCH 4KNYA 2LY1A 3ZQQA 3HJEA 3FXMA 2Z9OA 3BS3A 3LSTA 4KICA 1XGMA 4XRMA 2M4GA 3K1PA 4EM2A 3MKYB 3KP2A 4BBSJ 4ZYDA 3GFLA 4G94A 2Y9ZA 1Y8RB 4CO8A 4AYBN 2X6YA 5J8CA 2Y31A 5KNLA 3A1YA 1X2LA 3S17J 2Q0OA 1OKRA 3NEUA 2PJRB 1H8AC 1U5TC 3MZYA 5DTDA 1TW2A 2K4BA 1FBQA 2ZSHB 3JRDA 4GRIA 4LMYA 3H1CA 1SAXA 4PCQA 3WG7H 2EA2A 1ULYA 2PEXA 4IA8A 4BH9A 4X4HA 5HS7A 1K7AA 2V3CC 1FBUA 1TP4A 1LE8A 2AO9A 1X3ZB 2FXAA 4D7NA 2L5QA 2L7MP 2OAZA 4RGUA 2IVBA 2NAZA 1SMYF 3M9AA 5EG0A 2VXZA 2XGDA 3O8HA 3BJAA 1JHHA 4BGDA 3LQXA 1LVAA 1WPKA 4OBMA 4E70A 1S7EA 1W1WE 2ZNYA 2E7WA 3VWBA 1QQBA 3LSHA 3MZHA 1ZG5A 1S5LC 4V2FA 1S9HA 2R7UA 3PL8A 3BPXA 4PJ0C 2MXDA 2CQXA 1NG7A 5E3LA 1FTZA 1Z67A 1QVUA 3QFIA 1H9TA 1DGWY 4HSTA 3IVPA 3OYNA 3V7CA 2DA2A 2CFXA 4RMNA 2EH3A 1ZZ8A 3MAJA 5JHUA 1W36D 5D4SA 3A01A 1LE8B 2STWA 4Z5DA 1EKEA 4NC8A 2ECBA 2HXOA 5GPCA 1T38A 5EG0B 1IN7A 1BA5A 1WZ2A 3LISA 2Y75A 1ZR2A 1MFQC 3LOCA 2CGPA 5FRMA 3A9ZA 3DKYA 3FM5A 3HTUA 4RDUA 4UB6C 1U8RA 4I6ZA 4I99C 4GYGA 4CA0A 2VJIA 3BJ6A 2XJ3A 4FHTA 2X6WA 1X4OA 4NBQA 1TTYA 1I6XA 3KETA 2Z33A 2L4MA 1HQ1A 3Q0VA 1QZEA 5JVTA 3AAFA 1BJZA 2M7BA 2P5VA 3WGIA 2X51A 4LK0F 4WVLA 5LHGA 4E7LA 3A01B 4M9XA 3H5TA 4UVBA 1U0JA 4QSHA 1HSJA 1MNEA 2KPMA 4NHJA 1OQYA 1QP4A 2DYSH 4A3GJ 1A5JA 3L00A 3TW7A 1T08B 2FE3A 2XHKA 1YW9A 5FLXK 3HOZJ 1YJNI 3M4OJ 3E3VA 3F3XA 1P7JA 5HNFA 5D8LB 4C3IJ 3MVPA 1D0YA 4RB0A 1R9TJ 4UY8I 1WH7A 2DU9A 2V9VA 3HGGA 4GDFA 3UWPA 3CCQI 3SFZA 4XKWA 3V42A 2PXDA 3FXQA 4I01A 3F21A 1GT0C 1Y56A 3CC4I 3HSRA 3ME5A 2XGXA 1WCMJ 3RYRA 5K98B 1O4XA 5K5RA 4F7ZA 3J81K 4HF2A 1T8IA 2HTJA 3HBLA 1XS9A 1UFMA 4IRIA 4E7SA 1XSDA 2FJRA 1VQNI 3A0HC 2ICTA 2LBFA 4GCVA 3SR4A 2F5EA 2L7KA 3JRIA 2B0LA 2IA2A 2IV1A 1YQAA 2DCEA 3WU1B 3OYKA 2STTA 3F8BA 1LLIA 2NOJB 3GTPJ 2JRMA 1JUMA 1LFUP 1IG7A 3HGYA 1KGSA 5B3SH 2EZLA 1R00A 2ZSIB 3KEYA 2JSPA 4L5JA 5E79C 1SQ8A 3P7NA 2FUG2 1UZCA 2A5WA 5J1UA 4F92B 3SEQA 3IKTA 2WBMA 3HOVJ 2K85A 1WJEA 3EDPA 2LBFB 1WKMA 3RPUD 1P7IA 2HSGA 1FIPA 4YG7B 2M5WA 3FISA 5CLSA 2PUCA 1Y7YA 3AG2H 4XN0A 4WK8F 2ETHA 2IJLA 2K27A 3PSIA 4P9FA 1IN6A 3KE2A 3PNYA 3IV5A 3CO7C 2XKPA 3GLLA 2E36A 3LMMA 2EIMH 1JGGA 3HSFA 1ZYRF 2KKOA 4WX9A 1MDMA 5ILUA 2DT7B 5JLWA 4ZJZA 1FP2A 2M45A 2QZ8A 3HYIA 4HX7A 4DE8A 3BR3A 1YS7A 3U21A 1STZA 2BV6A 1DGRM 2QQBA 3R0AA 4WF2A 1IJWC 1TNSA 3I4MJ 2YSRA 1V4RA 1ZKGA 2VT3A 2RNGA 4LLNA 1ZZ6A 2DT5A 1FZPB 4IWRA 2IAIA 4PSXA 2V4JC 2FMLA 2X85A 3OL4A 1APLC 3IAM2 2HGCA 1Z6RA 1UHWA 1ZZ9A 2XI8A 1G8XA 5CPRB 1POUA 1BL0A 2VPLA 3ZRGA 2GRLA 1GV2A 4BXUA 2PMZA 2JUGA 2MH2A 3LSGA 3GUUA 1MDMB 3B6CA 2JRTA 5ED4A 1VTNC 3E5QA 1UMQA 2OC6A 1O3QA 5FKLA 3M8FA 1U78A 3QYBA 4FISA 4EJUA 4KISA 4JOMA 5FFXA 2KIUA 5E8GA 5GAHJ 4HPQA 4XLAA 1LCDA 1IXSB 4CUGA 4DBRA 4U7BA 2OQRA 3L2UA 3SCHA 4CCLA 4EGYA 4IHSA 2JQ7A 4PZJA 1ETOA 4ZTFA 1OFCX 1WQ2A 1RC9A 2IBDA 2Z5UA 4M74A 4QPQA 1ZZCA 1KYZA 3FK7A 3JRGA 4DJAA 4XKBA 3I71A 3RPQA 4ZDPA 3C2BA 4OOIA 4MCTA 2CW7A 1X2MA 2LDUA 1FOKA 1WJCA 1R22A 4HOBA 2DAOA 1R36A 4IRGA 5F6FA 4Z2YA 3I4NJ 1LNWA 2MQKA 2NS0A 2XSJC 4MQ9F 3SZGA 4I6RA 3I56I 2H27A 3S1NJ 3K4BA 4DQ2A 1F4KA 4XSXF 3GEZA 4WCGA 2IA0A 1ZVVA 5FO5A 2IGKA 3RCOA 2VEOA 3KXAA 3PIPF 4LB5A 3F52A 4A93J 3E97A 4OWRB 1SD7A 1MMDA 2W85A 4LG0A 1G3TA 1SD6A 1K61A 3GW2A 4EM0B 3UNGC 4BE0A 1U2ZA 2L4AA 4N4OB 2L54A 4PUSA 2KEKA 4XRFA 5J1RA 2M8EA 3GTJJ 4IXAA 2FQ3A 3W6KB 2ICPA 2GZUA 2PN6A 2QEXI 3EUHA 3JSPA 2ELHA 1GXPA 3GTGJ 4NC6A 1F36A 1REPC 3DEUA 4ER0A 3REOA 3K10A 3BG3A 2VB6A 4UXNA 2V7FA 3MKWB 2B63J 4G6QA 2PUFA 3SZPA 2WIUB 4EGZA 4PDKA 1YFHA 1EJ9A 1D0XA 4P9UA 1KU7A 2HVSA 5IT9K 4FN3A 1MKMA 1GV5A 4XLNF 3E6MA 4E7KA 4YARA 3F6VA 3NDBB 3D1NI 4HRAA
chains in the Genus database with same CATH topology
1MBEA 4FBIA 2R5YB 2DTZA 5IP6A 1LQCA 9ANTA 2DA1A 3NAUA 3BTIA 2HI3A 1Y9QA 2BNOA 3JRBA 5FKMA 4MFDA 3TEDA 5FKNA 3HB9A 3NARA 3JXCL 2NS7A 2CSFA 1JT0A 2ME6A 2GRMA 2LR8A 1WH5A 5IP7J 1ZUGA 3LSPA 3HM5A 4Z59A 2NOGA 2WUSR 1PNRA 1TWHJ 3S1RJ 1BW6A 3CMYA 2G0EA 3PO2J 5C4JJ 3CDLA 2HDDA 3GTKJ 3BTJA 1UG2A 2M2EA 2HYJA 2PUEA 2DA7A 3Q0WA 5C4XJ 2ECCA 2R5ZA 5M3FJ 2JN6A 1R63A 4DZJA 4A3IJ 4YBAA 4I76A 3HOYJ 4FE4A 5K7ZA 3JR9A 1X57A 2XGCA 2Y9YA 1D5YA 5EGOA 5K7HA 5EEAA 2ID3A 5K7FA 1HCRA 2O49A 2HINA 3DCFA 2LYRA 3CECA 2JWTA 3Q3SA 5EF6A 1Y1WJ 1B0NA 1I50J 3FMYA 3BR5A 4M3DA 4X4FA 5E3MA 2PE5A 1RESA 4IEJA 2FX0A 2LYSA 2MG4A 1VFCA 3G1LA 1SANA 2E19A 5FJ8J 5F0FA 1T56A 4BBRJ 5E3OA 5FLMJ 2E2HJ 4NDWA 5HODA 4J1WA 4MIMA 3BR1A 4JX6A 1W0UA 2ID6A 2XGEA 3KZ3A 1Q1VA 1X58A 4BXXJ 3DEWA 1MBJA 3FKIJ 4ABZA 4X4DA 3ZHMA 3BTLA 1GVDA 2VPRA 1K83J 2R5ZB 2XPVA 3MLFA 5EYRA 4X6AJ 3A02A 2NS8A 4FCYA 2VKVA 1XG1A 4PU8A 2LYLA 2LKXA 2EBYA 3HDDA 1ITYA 5IYDJ 4X4CA 2D5VA 3CCYA 3UKGA 5J1YA 4LOCA 5EGOB 3CQZJ 3FIWA 3BR6A 1H88C 1MBHA 2JA8J 2WAQN 2JCGA 3RZOJ 1FEXA 1JUSA 4Z5HA 2MSYA 2XB5A 2DMQA 1ETYA 2NVTJ 4JCXA 1ZQ3P 1DU6A 3GN5A 3S16J 4JX4A 1AKHA 3ZHIA 5C3EJ 2PUGA 3O8GA 3G7DA 2DN0A 4B4CA 2L7ZA 3RQIA 1EFAA 3K7AJ 4M3FA 3TRBA 2KDZA 2LFBA 4S0HB 1EF4A 4GFBA 1WIZA 2L49A 2DA3A 4CYCA 2LYKA 2PUDA 2X9DA 1GDTA 3TW6A 4MCXA 2JA6J 2VI6A 2EF8A 1IC8A 4RBOA 2JK3A 3GTLJ 1ENHA 3O9XA 2YU9J 5F0CA 4Y42A 3RZDJ 1QPIA 4B3AA 2KEIA 3BR2A 4J1XA 1POGA 4DYRA 2NVQJ 3LSJA 3GN5B 3Q0UA 4M3BA 3R1FA 5M3MJ 3ZQCA 1W0TA 4O8BA 2IVGA 2LCVA 2XPUA 4GHJA 1QRYA 5EZGA 2OPTA 2LYJA 2EBIA 4XK4A 2GM4A 2NVYJ 3FYAA 1IV6A 2OF7A 4CYCB 4XIDA 2HOAA 1MBFA 3E7LA 4IVZA 4X4EA 2ZB9A 1H89C 2PMZN 2M0CA 3S8QA 1I3QJ 1BDIA 3IH3A 3IH4A 5M5WJ 1IDZA 4I6UA 3B6AA 2JJ7A 3DNVB 1WGXA 2TCTA 4JP0A 1UXCA 1RKTA 1FTTA 2X48A 1DWKA 2B5AA 2DA5A 2PUBA 1JJ6C 4IHXA 2AHQA 3ZQIA 3U3WA 3JRHA 1YSEA 3OIOA 1JTXA 1JKOC 1PERL 4GQMA 2A6CA 1U9OA 2FJ1A 2XB0X 3H3VK 2MEZA 3H0GJ 3VPRA 3QYXA 3BS3A 3M3YJ 4XRMA 1VPWA 3ZOBA 3KJXA 2CQQA 2R0QC 1ZZ7A 2LVSA 2X6OA 2IVQA 4BBSJ 2XSDC 5C44J 2M9HA 2DA6A 4D7MA 1ZPQA 4FTHA 2Y9ZA 3HOWJ 2ELKA 4AYBN 3BR0A 5DS9A 2Y31A 1X2LA 1OSLA 4XICA 2O7OA 3S17J 1HF0A 2JA5J 2HXIA 4X4BA 3OQOA 1ETQA 1NTCA 4DW6A 1H8AC 2YUSA 2R93J 5DTDA 4Z58A 2L0KA 2LY9A 1I6HJ 3W6VA 3JRDA 4X4GA 1R69A 2EZKA 1JH9A 2W48A 5GP9A 2JMWA 4A69C 4IA8A 4X4HA 2VKEA 5JLXA 1FJLA 2HOTA 1JUPA 2AO9A 1LE8A 3G1MA 3HOUJ 1ZAYA 4D7NA 2L7MP 2IVBA 3A03A 5EG0A 2XGDA 3HOXJ 1MH3A 3O8HA 1ADRA 3CROL 4A3DJ 1WPKA 1S7EA 2EZIA 1JFTA 1T33A 1PUFA 2KT0A 1QQBA 2ME0A 1YRNA 1JJ8C 3UFDA 2WV1A 4PU4C 2MW8A 3PO3J 1RR7A 4V2FA 5J3LA 4BY7J 2BNNA 5EZHA 3GBFA 2O8KA 2CQXA 3BQZA 5E3LA 1FTZA 2AXUA 1QVUA 4V2GA 5E3NA 3JXBC 3IVPA 1JKQC 4YG4A 2DA2A 1LMB3 2EH3A 2NVXJ 1ETWA 3SDGA 4AC0A 1ZZ8A 1ZZBA 4EEFG 1LE8B 3A01A 4Z5DA 1MBGA 1IUFA 2HXOA 2ECBA 5GPCA 2TRTA 1LFBA 5EG0B 2K9NA 1BA5A 1A6IA 3LISA 3BG9A 1ZR2A 2AUWA 2Y0SN 3LOCA 3FYMA 5GPAA 1RKWA 2H8RA 1IRZA 4RDUA 4Y52J 3ZQHA 3OOUA 5F04A 1RETA 3HEFA 4M3GA 2DMPA 3GTQJ 2XCJA 4I6ZA 1BW5A 1YRNB 2XIUA 3QWGA 2R1JL 4I6TA 2JVLA 1G2HA 4F8DA 2N8GA 3GBGA 2XJ3A 2CUEA 1ETVA 2E1OA 4QIWN 3MKLA 2FD5A 2LTPA 1DU0A 4JYKA 4W97A 4Z5CA 3Q0VA 1BJZA 5FKOA 5F08A 2FQ4A 1TWCJ 1PRUA 2M8GX 2HOSA 2O9LA 3A01B 3H5TA 2EQRA 4QSHA 5FKKA 4AUXA 1QP4A 4A3GJ 1A5JA 4BY1J 3ZKCA 1AKHB 3TW7A 2P81A 2MGQA 5IOZA 1Y1VJ 3TP3A 3HOZJ 3M4OJ 1UXDA 2CU7A 2K9SA 3QQ6A 1P7JA 1IDYA 4Y7NJ 4C3IJ 3MVPA 3SFIA 4FE7A 1R9TJ 4MO7A 3S2HJ 4PU3C 1WH7A 3HGGA 3GTOJ 5F27A 2VUMJ 1RIOA 2CUFA 2LLKA 5IP9J 1GT0C 2AW6A 3HZIB 4JX5A 3BG5A 2BJCA 1WCMJ 5K98B 1O4XA 2QCOA 2KZ8A 3HBLA 1XS9A 2BNMA 2FJRA 1UTXA 2L7FP 2AXZA 4M6VA 3ZQGA 4DYCA 2ICTA 1TC3C 5FLVA 3RZZA 1Z0XA 4C2MJ 5F1JA 3OQMA 2CJJA 1QVTA 3JRIA 2M34A 2KPJA 2IV1A 3JREA 2R63A 1ZTRA 2H1KA 4X4IA 2R7ZJ 1LLIA 2K40A 1B8IA 3S1MJ 4A3LJ 2PPXA 1MSFC 3GTPJ 4A3EJ 1Z77A 3S1QJ 1JUMA 3QQAA 3OSGA 1OCTC 1LFUP 1CJGA 4BKXA 1IG7A 3HGYA 3G5GA 3BQYA 5M5XJ 2EZLA 2L9RA 1RZRD 2COBA 2E2JJ 1SQ8A 4A3FJ 3F51A 5J1UA 2IU7A 2DMUA 1XC5A 1MBKA 1B72A 3HOVJ 1LCCA 3G1OA 2HSGA 4YG7B 1P7IA 4X1EA 1FIPA 3FISA 3LFPA 1HDPA 2PUCA 4D5CA 3S2DJ 1Y7YA 1SFOJ 4IHVA 4YARA 2PUAA 2OR1L 4A3KJ 3IV5A 1B8IB 2CROA 1ZR4A 4A3JJ 4HNVA 4MLOA 1JT6A 1JGGA 4A3CJ 4UUTA 1WH8A 1E3OC 5JLWA 3CLCA 3WHBA 3F6WA 3ZQLA 4UUSA 1QPZA 3BR3A 4NDLA 3TP0A 1ORKA 1VF9A 1IJWC 3JXDL 3MN2A 3I4MJ 2Y30A 3BTCA 3EUSA 1WETA 1PRAA 1ZKGA 1ZZ6A 1OJLA 1AHDP 4G12A 1B72B 1MNMC 3PXPA 3OMTA 4IWRA 3S14J 2IAIA 1TWAJ 2HQ5A 2YS9A 3SCFA 1APLC 1BDHA 1ZZ9A 2XI8A 1HLVA 1IGNA 1POUA 1OCPA 1U9NA 2DMTA 2RAEA 1BL0A 2Y2ZA 5IYBJ 1TWGJ 2GRLA 1FIAA 1GV2A 1NK2P 4A3BJ 2LK2A 3QPSA 3LSGA 3F0CA 1PRVA 3B6CA 2AXVA 2LP0A 1NK3P 2XPWA 4A3MJ 5BNGA 3FK6A 1UMQA 1PUFB 3GTMJ 5FKLA 4UUSB 1U78A 1JKPC 4FISA 1HDDC 3OQNA 3SCGA 1RPEL 2K9QA 4QTRA 3LNQA 2IUOA 1LCDA 1NEQA 1U8BA 4L5EA 3SCHA 3JRCA 3HKZN 4M3EA 3S15J 2EZHA 3PM1A 5IPAA 1ETOA 4IHYA 1ETKA 1OFCX 4DZPA 1X2NA 2IBDA 4B1RA 1ZGWA 1JWLA 1QP0A 1ZZCA 1WH6A 4I8TA 3FK7A 3JRGA 2WB1N 1WI3A 1MH4A 4XRSA 3C2BA 5EDNA 2PIJA 4MCTA 1X2MA 2AWIA 1ETXA 1DW9A 4C3HJ 3BD1A 2GBYA 5F0HA 4JQDA 3I4NJ 2O38A 2CRGA 2MQKA 4I6RA 4JCYA 3JRFA 1NERA 3L1PA 3LSRA 1HOMA 3S1NJ 5M5YJ 1AU7A 1JFSA 1GUUA 3QF3A 1ZVVA 2GLOA 2O4AA 2XRLA 3F52A 3RKQA 3KXAA 4A93J 4DYQA 2LYPA 4J19A 2I10A 3ZQFA 1RPWA 4W1UA 1JKRC 2R5YA 3B7HA 3BT9A 1K61A 1ZS4A 4C3JJ 3OP9A 3K2AA 3OSFA 2KEJA 4OB4A 2DJNA 2L8NA 1QP7A 3SJMA 2E2IJ 2LYQA 1VI0A 2R92J 2KEKA 5J1RA 2LD5A 5IYCJ 4XRSG 3GTJJ 1QQAA 3BDNA 2DA4A 2JA7J 2OFYA 1VNDA 2QF7A 4D5FA 5IOYA 2GZUA 2ICPA 4PU7A 1UHSA 3GTGJ 3JRAA 1F36A 1RZSA 1TWFJ 4IHWA 3BG3A 2DMNA 3WHCA 2B63J 1F43A 5A7LA 3VK0A 2PUFA 2WIUB 1JTYA 1RZRA 1L1MA 1ZK8A 4FN3A 4MFEA 3QPLA 1CQTA 1GV5A 2IEKA 1MSEC 1XWRA 3IH2A 2EWTA 4YG1A 3D1NI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MBE A;  4FBI A;  2R5Y B;  2DTZ A;  5IP6 A;  1LQC A;  9ANT A;  2DA1 A;  3NAU A;  3BTI A;  2HI3 A;  1Y9Q A;  2BNO A;  3JRB A;  5FKM A;  4MFD A;  3TED A;  5FKN A;  3HB9 A;  3NAR A;  3JXC L;  2NS7 A;  2CSF A;  1JT0 A;  2ME6 A;  2GRM A;  2LR8 A;  1WH5 A;  5IP7 J;  1ZUG A;  3LSP A;  3HM5 A;  4Z59 A;  2NOG A;  2WUS R;  1PNR A;  1TWH J;  3S1R J;  1BW6 A;  3CMY A;  2G0E A;  3PO2 J;  5C4J J;  3CDL A;  2HDD A;  3GTK J;  3BTJ A;  1UG2 A;  2M2E A;  2HYJ A;  2PUE A;  2DA7 A;  3Q0W A;  5C4X J;  2ECC A;  2R5Z A;  5M3F J;  2JN6 A;  1R63 A;  4DZJ A;  4A3I J;  4YBA A;  4I76 A;  3HOY J;  4FE4 A;  5K7Z A;  3JR9 A;  1X57 A;  2XGC A;  2Y9Y A;  1D5Y A;  5EGO A;  5K7H A;  5EEA A;  2ID3 A;  5K7F A;  1HCR A;  2O49 A;  2HIN A;  3DCF A;  2LYR A;  3CEC A;  2JWT A;  3Q3S A;  5EF6 A;  1Y1W J;  1B0N A;  1I50 J;  3FMY A;  3BR5 A;  4M3D A;  4X4F A;  5E3M A;  2PE5 A;  1RES A;  4IEJ A;  2FX0 A;  2LYS A;  2MG4 A;  1VFC A;  3G1L A;  1SAN A;  2E19 A;  5FJ8 J;  5F0F A;  1T56 A;  4BBR J;  5E3O A;  5FLM J;  2E2H J;  4NDW A;  5HOD A;  4J1W A;  4MIM A;  3BR1 A;  4JX6 A;  1W0U A;  2ID6 A;  2XGE A;  3KZ3 A;  1Q1V A;  1X58 A;  4BXX J;  3DEW A;  1MBJ A;  3FKI J;  4ABZ A;  4X4D A;  3ZHM A;  3BTL A;  1GVD A;  2VPR A;  1K83 J;  2R5Z B;  2XPV A;  3MLF A;  5EYR A;  4X6A J;  3A02 A;  2NS8 A;  4FCY A;  2VKV A;  1XG1 A;  4PU8 A;  2LYL A;  2LKX A;  2EBY A;  3HDD A;  1ITY A;  5IYD J;  4X4C A;  2D5V A;  3CCY A;  3UKG A;  5J1Y A;  4LOC A;  5EGO B;  3CQZ J;  3FIW A;  3BR6 A;  1H88 C;  1MBH A;  2JA8 J;  2WAQ N;  2JCG A;  3RZO J;  1FEX A;  1JUS A;  4Z5H A;  2MSY A;  2XB5 A;  2DMQ A;  1ETY A;  2NVT J;  4JCX A;  1ZQ3 P;  1DU6 A;  3GN5 A;  3S16 J;  4JX4 A;  1AKH A;  3ZHI A;  5C3E J;  2PUG A;  3O8G A;  3G7D A;  2DN0 A;  4B4C A;  2L7Z A;  3RQI A;  1EFA A;  3K7A J;  4M3F A;  3TRB A;  2KDZ A;  2LFB A;  4S0H B;  1EF4 A;  4GFB A;  1WIZ A;  2L49 A;  2DA3 A;  4CYC A;  2LYK A;  2PUD A;  2X9D A;  1GDT A;  3TW6 A;  4MCX A;  2JA6 J;  2VI6 A;  2EF8 A;  1IC8 A;  4RBO A;  2JK3 A;  3GTL J;  1ENH A;  3O9X A;  2YU9 J;  5F0C A;  4Y42 A;  3RZD J;  1QPI A;  4B3A A;  2KEI A;  3BR2 A;  4J1X A;  1POG A;  4DYR A;  2NVQ J;  3LSJ A;  3GN5 B;  3Q0U A;  4M3B A;  3R1F A;  5M3M J;  3ZQC A;  1W0T A;  4O8B A;  2IVG A;  2LCV A;  2XPU A;  4GHJ A;  1QRY A;  5EZG A;  2OPT A;  2LYJ A;  2EBI A;  4XK4 A;  2GM4 A;  2NVY J;  3FYA A;  1IV6 A;  2OF7 A;  4CYC B;  4XID A;  2HOA A;  1MBF A;  3E7L A;  4IVZ A;  4X4E A;  2ZB9 A;  1H89 C;  2PMZ N;  2M0C A;  3S8Q A;  1I3Q J;  1BDI A;  3IH3 A;  3IH4 A;  5M5W J;  1IDZ A;  4I6U A;  3B6A A;  2JJ7 A;  3DNV B;  1WGX A;  2TCT A;  4JP0 A;  1UXC A;  1RKT A;  1FTT A;  2X48 A;  1DWK A;  2B5A A;  2DA5 A;  2PUB A;  1JJ6 C;  4IHX A;  2AHQ A;  3ZQI A;  3U3W A;  3JRH A;  1YSE A;  3OIO A;  1JTX A;  1JKO C;  1PER L;  4GQM A;  2A6C A;  1U9O A;  2FJ1 A;  2XB0 X;  3H3V K;  2MEZ A;  3H0G J;  3VPR A;  3QYX A;  3BS3 A;  3M3Y J;  4XRM A;  1VPW A;  3ZOB A;  3KJX A;  2CQQ A;  2R0Q C;  1ZZ7 A;  2LVS A;  2X6O A;  2IVQ A;  4BBS J;  2XSD C;  5C44 J;  2M9H A;  2DA6 A;  4D7M A;  1ZPQ A;  4FTH A;  2Y9Z A;  3HOW J;  2ELK A;  4AYB N;  3BR0 A;  5DS9 A;  2Y31 A;  1X2L A;  1OSL A;  4XIC A;  2O7O A;  3S17 J;  1HF0 A;  2JA5 J;  2HXI A;  4X4B A;  3OQO A;  1ETQ A;  1NTC A;  4DW6 A;  1H8A C;  2YUS A;  2R93 J;  5DTD A;  4Z58 A;  2L0K A;  2LY9 A;  1I6H J;  3W6V A;  3JRD A;  4X4G A;  1R69 A;  2EZK A;  1JH9 A;  2W48 A;  5GP9 A;  2JMW A;  4A69 C;  4IA8 A;  4X4H A;  2VKE A;  5JLX A;  1FJL A;  2HOT A;  1JUP A;  2AO9 A;  1LE8 A;  3G1M A;  3HOU J;  1ZAY A;  4D7N A;  2L7M P;  2IVB A;  3A03 A;  5EG0 A;  2XGD A;  3HOX J;  1MH3 A;  3O8H A;  1ADR A;  3CRO L;  4A3D J;  1WPK A;  1S7E A;  2EZI A;  1JFT A;  1T33 A;  1PUF A;  2KT0 A;  1QQB A;  2ME0 A;  1YRN A;  1JJ8 C;  3UFD A;  2WV1 A;  4PU4 C;  2MW8 A;  3PO3 J;  1RR7 A;  4V2F A;  5J3L A;  4BY7 J;  2BNN A;  5EZH A;  3GBF A;  2O8K A;  2CQX A;  3BQZ A;  5E3L A;  1FTZ A;  2AXU A;  1QVU A;  4V2G A;  5E3N A;  3JXB C;  3IVP A;  1JKQ C;  4YG4 A;  2DA2 A;  1LMB 3;  2EH3 A;  2NVX J;  1ETW A;  3SDG A;  4AC0 A;  1ZZ8 A;  1ZZB A;  4EEF G;  1LE8 B;  3A01 A;  4Z5D A;  1MBG A;  1IUF A;  2HXO A;  2ECB A;  5GPC A;  2TRT A;  1LFB A;  5EG0 B;  2K9N A;  1BA5 A;  1A6I A;  3LIS A;  3BG9 A;  1ZR2 A;  2AUW A;  2Y0S N;  3LOC A;  3FYM A;  5GPA A;  1RKW A;  2H8R A;  1IRZ A;  4RDU A;  4Y52 J;  3ZQH A;  3OOU A;  5F04 A;  1RET A;  3HEF A;  4M3G A;  2DMP A;  3GTQ J;  2XCJ A;  4I6Z A;  1BW5 A;  1YRN B;  2XIU A;  3QWG A;  2R1J L;  4I6T A;  2JVL A;  1G2H A;  4F8D A;  2N8G A;  3GBG A;  2XJ3 A;  2CUE A;  1ETV A;  2E1O A;  4QIW N;  3MKL A;  2FD5 A;  2LTP A;  1DU0 A;  4JYK A;  4W97 A;  4Z5C A;  3Q0V A;  1BJZ A;  5FKO A;  5F08 A;  2FQ4 A;  1TWC J;  1PRU A;  2M8G X;  2HOS A;  2O9L A;  3A01 B;  3H5T A;  2EQR A;  4QSH A;  5FKK A;  4AUX A;  1QP4 A;  4A3G J;  1A5J A;  4BY1 J;  3ZKC A;  1AKH B;  3TW7 A;  2P81 A;  2MGQ A;  5IOZ A;  1Y1V J;  3TP3 A;  3HOZ J;  3M4O J;  1UXD A;  2CU7 A;  2K9S A;  3QQ6 A;  1P7J A;  1IDY A;  4Y7N J;  4C3I J;  3MVP A;  3SFI A;  4FE7 A;  1R9T J;  4MO7 A;  3S2H J;  4PU3 C;  1WH7 A;  3HGG A;  3GTO J;  5F27 A;  2VUM J;  1RIO A;  2CUF A;  2LLK A;  5IP9 J;  1GT0 C;  2AW6 A;  3HZI B;  4JX5 A;  3BG5 A;  2BJC A;  1WCM J;  5K98 B;  1O4X A;  2QCO A;  2KZ8 A;  3HBL A;  1XS9 A;  2BNM A;  2FJR A;  1UTX A;  2L7F P;  2AXZ A;  4M6V A;  3ZQG A;  4DYC A;  2ICT A;  1TC3 C;  5FLV A;  3RZZ A;  1Z0X A;  4C2M J;  5F1J A;  3OQM A;  2CJJ A;  1QVT A;  3JRI A;  2M34 A;  2KPJ A;  2IV1 A;  3JRE A;  2R63 A;  1ZTR A;  2H1K A;  4X4I A;  2R7Z J;  1LLI A;  2K40 A;  1B8I A;  3S1M J;  4A3L J;  2PPX A;  1MSF C;  3GTP J;  4A3E J;  1Z77 A;  3S1Q J;  1JUM A;  3QQA A;  3OSG A;  1OCT C;  1LFU P;  1CJG A;  4BKX A;  1IG7 A;  3HGY A;  3G5G A;  3BQY A;  5M5X J;  2EZL A;  2L9R A;  1RZR D;  2COB A;  2E2J J;  1SQ8 A;  4A3F J;  3F51 A;  5J1U A;  2IU7 A;  2DMU A;  1XC5 A;  1MBK A;  1B72 A;  3HOV J;  1LCC A;  3G1O A;  2HSG A;  4YG7 B;  1P7I A;  4X1E A;  1FIP A;  3FIS A;  3LFP A;  1HDP A;  2PUC A;  4D5C A;  3S2D J;  1Y7Y A;  1SFO J;  4IHV A;  4YAR A;  2PUA A;  2OR1 L;  4A3K J;  3IV5 A;  1B8I B;  2CRO A;  1ZR4 A;  4A3J J;  4HNV A;  4MLO A;  1JT6 A;  1JGG A;  4A3C J;  4UUT A;  1WH8 A;  1E3O C;  5JLW A;  3CLC A;  3WHB A;  3F6W A;  3ZQL A;  4UUS A;  1QPZ A;  3BR3 A;  4NDL A;  3TP0 A;  1ORK A;  1VF9 A;  1IJW C;  3JXD L;  3MN2 A;  3I4M J;  2Y30 A;  3BTC A;  3EUS A;  1WET A;  1PRA A;  1ZKG A;  1ZZ6 A;  1OJL A;  1AHD P;  4G12 A;  1B72 B;  1MNM C;  3PXP A;  3OMT A;  4IWR A;  3S14 J;  2IAI A;  1TWA J;  2HQ5 A;  2YS9 A;  3SCF A;  1APL C;  1BDH A;  1ZZ9 A;  2XI8 A;  1HLV A;  1IGN A;  1POU A;  1OCP A;  1U9N A;  2DMT A;  2RAE A;  1BL0 A;  2Y2Z A;  5IYB J;  1TWG J;  2GRL A;  1FIA A;  1GV2 A;  1NK2 P;  4A3B J;  2LK2 A;  3QPS A;  3LSG A;  3F0C A;  1PRV A;  3B6C A;  2AXV A;  2LP0 A;  1NK3 P;  2XPW A;  4A3M J;  5BNG A;  3FK6 A;  1UMQ A;  1PUF B;  3GTM J;  5FKL A;  4UUS B;  1U78 A;  1JKP C;  4FIS A;  1HDD C;  3OQN A;  3SCG A;  1RPE L;  2K9Q A;  4QTR A;  3LNQ A;  2IUO A;  1LCD A;  1NEQ A;  1U8B A;  4L5E A;  3SCH A;  3JRC A;  3HKZ N;  4M3E A;  3S15 J;  2EZH A;  3PM1 A;  5IPA A;  1ETO A;  4IHY A;  1ETK A;  1OFC X;  4DZP A;  1X2N A;  2IBD A;  4B1R A;  1ZGW A;  1JWL A;  1QP0 A;  1ZZC A;  1WH6 A;  4I8T A;  3FK7 A;  3JRG A;  2WB1 N;  1WI3 A;  1MH4 A;  4XRS A;  3C2B A;  5EDN A;  2PIJ A;  4MCT A;  1X2M A;  2AWI A;  1ETX A;  1DW9 A;  4C3H J;  3BD1 A;  2GBY A;  5F0H A;  4JQD A;  3I4N J;  2O38 A;  2CRG A;  2MQK A;  4I6R A;  4JCY A;  3JRF A;  1NER A;  3L1P A;  3LSR A;  1HOM A;  3S1N J;  5M5Y J;  1AU7 A;  1JFS A;  1GUU A;  3QF3 A;  1ZVV A;  2GLO A;  2O4A A;  2XRL A;  3F52 A;  3RKQ A;  3KXA A;  4A93 J;  4DYQ A;  2LYP A;  4J19 A;  2I10 A;  3ZQF A;  1RPW A;  4W1U A;  1JKR C;  2R5Y A;  3B7H A;  3BT9 A;  1K61 A;  1ZS4 A;  4C3J J;  3OP9 A;  3K2A A;  3OSF A;  2KEJ A;  4OB4 A;  2DJN A;  2L8N A;  1QP7 A;  3SJM A;  2E2I J;  2LYQ A;  1VI0 A;  2R92 J;  2KEK A;  5J1R A;  2LD5 A;  5IYC J;  4XRS G;  3GTJ J;  1QQA A;  3BDN A;  2DA4 A;  2JA7 J;  2OFY A;  1VND A;  2QF7 A;  4D5F A;  5IOY A;  2GZU A;  2ICP A;  4PU7 A;  1UHS A;  3GTG J;  3JRA A;  1F36 A;  1RZS A;  1TWF J;  4IHW A;  3BG3 A;  2DMN A;  3WHC A;  2B63 J;  1F43 A;  5A7L A;  3VK0 A;  2PUF A;  2WIU B;  1JTY A;  1RZR A;  1L1M A;  1ZK8 A;  4FN3 A;  4MFE A;  3QPL A;  1CQT A;  1GV5 A;  2IEK A;  1MSE C;  1XWR A;  3IH2 A;  2EWT A;  4YG1 A;  3D1N I; 
#chains in the Genus database with same CATH topology
 4LG0 B;  3GZD C;  1YIO A;  1MJ9 A;  2BNO A;  3NAU A;  1XSV A;  2HI3 A;  5GAD J;  4A0X A;  1FBS A;  5FKM A;  3CJN A;  4AVZ A;  2F5F A;  4MFD A;  3QYE A;  3HB9 A;  3GX4 X;  2D1H A;  2WTE A;  1JT0 A;  3DTE A;  2R7S A;  1ZUG A;  3LSP A;  2EFW A;  3BP8 A;  1ODD A;  2Z99 A;  2NOG A;  4MNU A;  2JPB A;  1XMX A;  1BW6 A;  3CMY A;  2G0E A;  3PO2 J;  4CCO A;  4BU2 A;  3SEZ A;  2W57 A;  5GAG i;  5GAH i;  2DA7 A;  5D5V B;  1P4X A;  2LNM A;  2VLA A;  2KRF A;  3S3M A;  3J7A O;  2XXP A;  2R4G A;  4I76 A;  4KIT B;  3DP7 A;  3ZMZ A;  1X57 A;  2XGC A;  1D5Y A;  4EAT A;  4CGZ A;  2GOM A;  5EEA A;  2ZCW A;  2ID3 A;  5EGO A;  4MEX F;  2HIN A;  3CEC A;  4PJJ A;  1Q1H A;  4G7O F;  1I50 J;  3G0T A;  2PE5 A;  4NB5 A;  4HDU A;  4IRH A;  3H0D A;  4ANJ A;  2E19 A;  3KP6 A;  4EZI A;  3DU6 A;  5K5Q A;  3GZ5 A;  2K02 A;  1X19 A;  4A0Z A;  2IS4 A;  2KIS A;  3OYM A;  2GZW A;  2K5C A;  4WXH A;  3BJO A;  4AVP A;  1UEL B;  4X4D A;  2VPR A;  4IPA A;  3OWQ A;  5EYR A;  4X6A J;  3KYC B;  1XG1 A;  1G3Y A;  2CUZ A;  3LAP A;  3W2A A;  3TKY A;  1FY7 A;  3FMQ A;  4CHU A;  2MC3 A;  5EGO B;  4JQF A;  3FIW A;  5DUI A;  2ICW G;  2CQ7 A;  2JCG A;  3RZO J;  1BN5 A;  4Z5H A;  2YU3 A;  4BDY A;  2MSY A;  1ETY A;  2NVT J;  3P5J A;  2ZJP F;  4OMY A;  4KA4 A;  1RUN A;  3GN5 A;  3S32 A;  3DWL E;  4JX4 A;  3WTX C;  5C3E J;  4IO9 F;  2CG4 A;  2PUG A;  2P5K A;  4LB6 B;  2JA2 A;  3QRF F;  3H9G A;  3RQI A;  1EH8 A;  1EFA A;  1FC3 A;  1LEB A;  1TNT A;  2IS1 A;  1IRX A;  2LFB A;  3CCM I;  2L2O A;  4KN7 X;  1WIZ A;  4GFB A;  2QSH X;  2LYK A;  3VYT B;  3TW6 A;  2RQQ A;  2VT2 A;  4L9V A;  2JA6 J;  3COA C;  5E8I A;  3IRR A;  2EF8 A;  1H0M A;  3CC7 I;  3GTL J;  1D0Z A;  3O9X A;  2HCN A;  3CES A;  1TW3 A;  5EEH A;  2QBY A;  3T8R A;  4B3A A;  2HOE A;  2NYX A;  3OYJ A;  2QLZ A;  1R5H A;  2X1D A;  3BR2 A;  4J1X A;  4DE9 A;  2OQG A;  2NVQ J;  3F8N A;  3LSJ A;  3GN5 B;  5DRT A;  3R1F A;  3G6E I;  3ZQC A;  4Y13 A;  5FFZ A;  3RTR A;  4O8B A;  1R5G A;  2EB7 A;  2IVG A;  3TEL A;  1ZN2 A;  3F8F A;  1YJ9 I;  3DV8 A;  2OPT A;  1HW5 A;  5B66 C;  3CDH A;  2LYJ A;  4IF4 A;  3I64 A;  3OYD A;  1ERD A;  3L2R A;  1IV6 A;  2X1E A;  2OV7 A;  4EKI A;  4XID A;  1RNL A;  2HOA A;  2VKD A;  1QQI A;  4ASN A;  4B48 A;  4J01 A;  2EIL H;  4X4E A;  1GHC A;  2VOD A;  3S8Q A;  3K4M A;  4G8X A;  1HA8 A;  4XLE A;  2FFH A;  1BJA A;  3OWT A;  3OYB A;  4I0A A;  5M5W J;  1WVR A;  3BRO A;  4LIU A;  4YFK F;  5LGN A;  2TCT A;  1XD7 A;  2JT1 A;  1UXC A;  1RKT A;  2CFO A;  2CYY A;  3FMR A;  1DWK A;  2B5A A;  3H5N A;  3K9T A;  4IHX A;  3JRH A;  2R7V A;  2GA2 A;  3OIO A;  4EJO A;  2R3S A;  2F5D A;  1U9O A;  3PNT A;  4N9H A;  3H3V K;  3H0G J;  3OOP A;  3QYX A;  4YIR X;  3M3Y J;  1X1D A;  1ON2 A;  2F5V A;  1R1V A;  3ZOB A;  3KJX A;  4X0G A;  2CQQ A;  2KIM A;  3K70 D;  2LVS A;  2X6O A;  3TMO A;  2XSD C;  5C44 J;  4ESJ A;  2M9H A;  2DA6 A;  3I53 A;  2PI0 A;  2RQP A;  1AA7 A;  1D1C A;  2A61 A;  5DS9 A;  2RDP A;  5HDN A;  3R6S A;  2O7O A;  2JA5 J;  2E7X A;  2HS5 A;  3KEQ A;  1BBY A;  2L0K A;  2EK5 A;  2WB1 A;  5ILS A;  3GFI A;  3F22 A;  2EZK A;  2W82 A;  2BXY A;  2YX7 A;  2P6T A;  1PP8 F;  3AL0 C;  4HX8 A;  4PJL A;  2M0M A;  2PXQ A;  3NXH A;  1ZAY A;  3G1M A;  2LRE A;  1Z3X A;  2MAB A;  3AFH A;  4YFN F;  3JAM K;  2EIK H;  3A03 A;  2XRO A;  3KFW X;  3C1D A;  1MH3 A;  1ADR A;  3ERE D;  4ZZL A;  2A07 F;  5AIQ A;  2VBY A;  3DPT A;  5LFA A;  3ZMV A;  3D5L A;  2V6E A;  2YBD A;  3NWT A;  4RB3 C;  1T33 A;  3C7J A;  4DOZ A;  1A36 A;  1YRN A;  4HNT A;  2WV1 A;  2BNN A;  1RR7 A;  2ISY A;  2MH9 A;  2QSF X;  4BY7 J;  2HVR A;  3C3W A;  4H4K C;  1WJA A;  2O8K A;  1SVM A;  1L0O C;  2AXU A;  3H36 A;  1KZH A;  3PIO F;  3H35 A;  3RQ4 A;  5ICG A;  4YG4 A;  2P8T A;  4EKG A;  2HEO A;  1X3U A;  2BY2 A;  4AC0 A;  1ZZB A;  4NUB A;  2LH9 A;  1IUF A;  3GZC A;  5DTR A;  1LFB A;  4RAG A;  4XR6 A;  3G2B A;  2R7W A;  4S04 A;  5CYV A;  4BXF A;  2Y0S N;  3I5U A;  2H8R A;  3GZN B;  3HEF A;  2DMP A;  3GTQ J;  4R79 A;  3MKZ A;  2XIU A;  2P4W A;  3GXO A;  3CCU I;  1YRN B;  2R1J L;  4I6T A;  1JHF A;  1G2H A;  4BEH A;  3G73 A;  2X4H A;  3HHG A;  4LGW A;  3W3C A;  2CUE A;  1ONV A;  2KRH A;  4KMU X;  2ZNZ A;  3KL4 A;  3RJP A;  4RAY A;  1OYI A;  5ERI A;  4ER5 A;  5FKO A;  5F08 A;  2FQ4 A;  2COM A;  3ZQ7 A;  3BG6 A;  1QBJ A;  2VIX A;  2ELJ A;  1KQ0 A;  1XGS A;  1BOB A;  5DD8 A;  3N4M A;  3BDD A;  4BY1 J;  2VJ5 A;  4D0P A;  1J9I A;  5IOZ A;  1Y1V J;  1R4N B;  5HLI A;  1V54 H;  4BE2 A;  1RRJ A;  3QQ6 A;  4Y7N J;  2PMH A;  4Q5S F;  4PU3 C;  4DIQ A;  4BEH B;  1IRF A;  4UV9 A;  3QOP A;  3GTO J;  5F27 A;  2CUF A;  2LLK A;  2GOX B;  1SC7 A;  1IN4 A;  5LEJ A;  4JX5 A;  3MFK A;  2K86 A;  1MGT A;  1OCR H;  3ROU A;  1VQ6 I;  3K70 C;  2BNM A;  4EJV A;  1VQ5 I;  2VQG A;  2L7F P;  3V8L A;  4P96 A;  3DU5 A;  1KQ8 A;  3GVA A;  4ESF A;  5FGM A;  1Z0X A;  5F1J A;  3I3L A;  2CJJ A;  3TOB A;  5ICC A;  5JI6 A;  2KPJ A;  3TDZ C;  1AWC A;  1ZTR A;  2RKH A;  2Z2S B;  2ZJ2 A;  3QOW A;  2OZU A;  1CGP A;  1HW2 A;  3QOX A;  5EEG A;  2K40 A;  1B8I A;  2HFZ A;  1FWZ A;  2V1X A;  3HSE A;  1QZZ A;  4LIV A;  3EYI A;  1BI3 A;  1PYV A;  3G5G A;  1X4P A;  2F48 A;  1B4A A;  3X2Q H;  1LDD A;  2H1L A;  2WAQ A;  2E2J J;  3LA2 A;  4A3F J;  4MHG A;  2VC0 A;  2IU7 A;  1MBK A;  3A4C A;  4L0Z B;  5DV5 A;  2EA4 A;  2L02 A;  5DTM A;  1P2F A;  3IWZ A;  4X1E A;  2D45 A;  2XKO A;  5CVI A;  2V9K A;  3S2D J;  1Z3Y A;  4OAY A;  3MEX A;  3KYL A;  1SFO J;  4Q2J A;  4M9S A;  4HDV A;  1B8I B;  2DQR A;  2CRO A;  3B02 A;  2W1O A;  2M87 A;  1SD4 A;  3CP8 A;  4LLL A;  2A6E F;  4UUT A;  3JTH A;  5L3B A;  1WH8 A;  3FBN B;  3WHB A;  3ZQL A;  1ZRC A;  1ORK A;  1XTA A;  3EQL F;  3VSK A;  3DEE A;  2VBW A;  3BTC A;  2RVC A;  1AHD P;  4L9T A;  5KCM A;  2JSC A;  3H92 A;  2OD5 A;  2FOK A;  2ZME A;  3SCF A;  5LHH A;  1OYY A;  2HR3 A;  2M7A A;  1K6Y A;  3K2Z A;  5LRR A;  4WWC A;  1OCP A;  2RAE A;  4RM3 A;  1YO5 C;  3EUA A;  2Y2Z A;  1TWG J;  3OKZ A;  2FRH A;  3TQN A;  1YG2 A;  2WV0 A;  2QYO A;  1SMT A;  1S3J A;  1NK2 P;  4A3B J;  3CMA I;  4PFP A;  5AON A;  4B44 A;  1PRV A;  4A3M J;  2CQN A;  5BNG A;  3ERM A;  1HDD C;  3L9F A;  3SCG A;  1I1S A;  3LNQ A;  4QTR A;  3GYH X;  1I1G A;  2ZXJ A;  4FT8 A;  4XN3 A;  1NEQ A;  1U8B A;  2WC2 A;  1IN5 A;  3JRC A;  2EV0 A;  1LB2 A;  3HKZ N;  4M3E A;  3S15 J;  3CCL I;  2LF8 A;  3PM1 A;  2Q2E A;  4IHY A;  3I4P A;  3IHU A;  4KDP A;  2CUJ A;  1X2N A;  3DPL C;  1ZGW A;  2ZME B;  1QP0 A;  3ZN1 A;  4I8T A;  4U7D A;  2ISZ A;  2K9M A;  1WI3 A;  4XKV A;  5HDG A;  4DNC A;  2M1B A;  2LMD A;  4ENJ A;  3WGH A;  3TO6 A;  1ETX A;  1DW9 A;  4C3H J;  3BD1 A;  5F0H A;  2IGM A;  1EH7 A;  2O38 A;  2A69 F;  4AYB A;  2YR2 A;  1D1B A;  1X1P A;  4JCY A;  3L1P A;  1PP7 U;  1XCB A;  2MBF A;  1ZHF A;  3V8K A;  1X1C A;  3LSR A;  1C0W A;  6PAX A;  2DW4 A;  3GME A;  5M5Y J;  2WAE A;  3QF3 A;  1GLN A;  3H9Q A;  4DYQ A;  1FNN A;  3BG7 A;  5DUK A;  4J19 A;  4Q4Z F;  2Q2E B;  3NRV A;  1HXD A;  3NQO A;  3OYL A;  2R5Y A;  1W5C C;  3EUH C;  3SYT A;  1BR2 A;  4G6D A;  1XB4 A;  3OSF A;  3OYE A;  1QP7 A;  2OA4 A;  3R60 A;  2E2I J;  1QHH D;  1KA8 A;  1T0F C;  2VC1 A;  2ADU A;  3I55 I;  3WTZ A;  1UAA A;  5IYC J;  4XRS G;  2DA4 A;  2HQN A;  2JA7 J;  2LOO A;  4D5F A;  1N75 A;  2P7C B;  2VBZ A;  2VXD A;  3WU0 A;  3F72 A;  1W5S A;  1T95 A;  1TZL A;  1UHS A;  5D8K B;  2GXB A;  2ZXI A;  2L1P A;  3FMS A;  1RZS A;  3ULQ B;  4XKC A;  3DTK A;  1J59 A;  4IHW A;  3WHC A;  1F43 A;  5A7L A;  1FMW A;  4RB2 C;  1JTY A;  1RZR A;  1K6O A;  1L1M A;  4M6X A;  2B9S A;  3QPL A;  1HKQ A;  2IEK A;  2EWT A;  1XWR A;  2DT6 A;  3K69 A;  4G9Y A;  3LL7 A;  3P9C A;  4IJA A;  4FBI A;  2R5Y B;  2O61 A;  1LQC A;  9ANT A;  2DA1 A;  3BTI A;  3WTT C;  2VKH A;  2YPR A;  3RI4 A;  1MMG A;  1N78 A;  2BVM A;  3JRB A;  3TED A;  2EFO A;  3NAR A;  5H6Q A;  2G7U A;  2NS7 A;  2P0W A;  1XMK A;  2GRM A;  2LR8 A;  3IKV A;  1V5E A;  5IP7 J;  3BWG A;  2H94 A;  3DBR B;  4BE1 A;  5JVG F;  1FSE A;  4XOR A;  2WUS R;  1R4M B;  1TWH J;  1D3Y A;  1TLH B;  3FHN A;  2L9S A;  3S1R J;  2AXL A;  1A6Q A;  3CDL A;  2HDD A;  3TO7 A;  5ICE A;  1DP3 A;  3FBI B;  3LFU A;  4WXD A;  2JQE A;  2M2E A;  1W7P A;  2IGN A;  4AIJ A;  5FLX Z;  2XF7 A;  2JN6 A;  1HKT A;  1R63 A;  4DZJ A;  4XNF A;  4G6T B;  4E7H A;  2PLY A;  3HG9 A;  4YBA A;  1W36 C;  3HOY J;  4FE4 A;  2KLO A;  1E17 A;  2NVU B;  4E7J A;  4PGH A;  4HSR A;  4CIC A;  5K7H A;  1ZRE A;  4II3 A;  4BJT A;  3A2K A;  4IL6 C;  3DCF A;  1LFP A;  2J7U A;  4X4F A;  1E2X A;  4RM2 A;  5D6F A;  5E3M A;  4CXF A;  4M71 A;  2E60 A;  2QWW A;  2V6C A;  2MG4 A;  1U5T A;  2VJJ A;  5FRO A;  5FJ8 J;  2KIF A;  2HZT A;  4HG2 A;  3FXR A;  2PXU A;  3M8J A;  4NDW A;  1R1U A;  1J09 A;  1W0U A;  4OIO F;  5J40 A;  3KZY A;  3WTW C;  2XGE A;  3KZ3 A;  1Q1V A;  1TBX A;  3C2G A;  3DEW A;  1MIJ A;  1W7P B;  4I0B A;  1ZG1 A;  3BZK A;  5H2F C;  2LRD A;  3MD2 A;  5CQG A;  4PU8 A;  2XV4 S;  2LYL A;  1UST A;  3ML6 A;  2G9W A;  1YJW I;  3V4G A;  4X4C A;  5E20 A;  5GAG J;  3DLA A;  4D1Q A;  2MYS A;  1DQU A;  3BR6 A;  3LQQ A;  3F8M A;  3NZL A;  2DFF A;  1XPX A;  4XL9 A;  4HLY A;  1JUS A;  4HYE A;  1WJ5 A;  4E7Z A;  2R7T A;  2O0Y A;  2XB5 A;  2DMQ A;  1ZQ3 P;  3J7Y J;  1R7J A;  1U5T B;  5DEQ A;  1TQM A;  2HU9 A;  3S16 J;  1ACI A;  1AKH A;  2E1M C;  2XAU A;  3CUQ C;  3G7D A;  1BI1 A;  2L7Z A;  2LLW A;  1FT9 A;  3QU3 A;  2HKO A;  5HS8 A;  3TRB A;  3CJQ B;  2KDZ A;  1H9G A;  5LHI A;  4S0H B;  2MD0 A;  2L49 A;  5DTQ A;  4CYC A;  2PJP A;  2HTS A;  4U88 A;  4MCX A;  4RBO A;  4HA8 A;  4HNU A;  1ENH A;  2L9N A;  2ZFU A;  2WAD A;  1TL8 A;  3RKY A;  2YU9 J;  2V79 A;  1NHA A;  1EV7 A;  3W6J B;  1FX7 A;  2E34 A;  1MND A;  3OV8 A;  5HDK A;  2FNA A;  3VFZ A;  3CCE I;  1WWX A;  4DYR A;  1RUO A;  1OR7 A;  2BY3 A;  2I5U A;  4M3B A;  4LFU A;  4C9Y A;  1VQK I;  2HCS A;  2ZO4 A;  4CZZ A;  1U3E M;  4E4H A;  2LCV A;  5HOO A;  5J47 A;  2BW3 A;  3JW4 A;  1VQ7 I;  3ISP A;  4QWQ A;  3CLO A;  3DQV C;  2NVY J;  3L7W A;  5TIS C;  4CYC B;  2KJC A;  2Y69 H;  3ABM H;  1SFK A;  4NNJ A;  2DOE A;  4CCN A;  1W4M A;  2M0C A;  3ZMT A;  1I3Q J;  1YTY A;  1VQM I;  2I8D A;  3DFG A;  2HPI A;  3B6A A;  1Y8Q B;  1FPQ A;  1WGX A;  4BQQ A;  2IXS A;  1E3P A;  3U1D A;  3GWZ A;  2MC4 A;  5KVR A;  3DLL F;  1Y0U A;  4MEY F;  1OLT A;  3ZQI A;  2Q1Z B;  1PER L;  1JTX A;  1TT0 A;  3HHH A;  4FAS D;  1SEU A;  1UCR A;  2OU2 A;  4L9J A;  4Y17 A;  2A6C A;  2BW3 B;  2FJ1 A;  3BC8 A;  2MEZ A;  4NQW A;  1ZG3 A;  2DPU A;  4ZZD A;  4AU7 A;  2DK8 A;  1VPW A;  4YII A;  2DFH A;  3A9Y A;  2EIJ H;  3H3Z A;  2IVQ A;  3OYI A;  2DDB A;  4HRI A;  2GIZ A;  3CCJ I;  2PQ8 A;  4GYI A;  1KU2 A;  2R7R A;  1ZLK A;  2ESH A;  4LLG F;  2ELK A;  5A2Q K;  3BR0 A;  3HOW J;  1OSL A;  2W00 A;  1GVJ A;  3BLY A;  2HXI A;  4G7H F;  1D1A A;  2Q8K A;  4NC7 A;  4MQV A;  1S72 I;  3D5R C;  1ZGJ A;  2CO5 A;  3SDB A;  4BAC A;  4Z58 A;  2LY9 A;  1I6H J;  1ZRF A;  3W6V A;  2UWM A;  1R5I D;  1R69 A;  3MZ8 A;  4ZC3 A;  5GP9 A;  1Y0N A;  4UNO A;  1J0R A;  2RN7 A;  3ZP5 A;  2GWR A;  4XOT A;  2HOT A;  1JUP A;  4XM3 A;  2IA1 A;  4NQW B;  5F1R A;  1BM9 A;  3G71 I;  3TFL A;  4JK1 X;  3WTU C;  2CV0 A;  3SX0 A;  1R1T A;  1ZH5 A;  1JXS A;  4HW0 A;  2R7X A;  4A3D J;  1R23 A;  2AQF A;  4XQF A;  3K4N A;  2F4M B;  3O6B B;  4GO1 A;  2EZI A;  1JFT A;  3D5S C;  1PUF A;  4ER3 A;  1QNT A;  4RLQ A;  3UFD A;  2MW8 A;  5J3L A;  5HLT A;  3WTY C;  4OU0 A;  3GBF A;  3LSK A;  1J2X A;  3BQZ A;  4HF0 A;  3JXB C;  4HLX A;  2VJ4 A;  3IP4 B;  2KL4 A;  2UXX A;  2V9P A;  2FSW A;  3HRU A;  1KU9 A;  1KON A;  4HBL A;  1RI7 A;  3K4J A;  3M1C A;  2JUC A;  2AXT C;  2NVX J;  3J80 K;  3EET A;  3HZJ A;  4EEF G;  2RNJ A;  4BHP A;  1MBG A;  2TRT A;  2BEO A;  2K9N A;  2FF4 A;  2OBP A;  1A6I A;  2QQ9 A;  2OTJ I;  3BG9 A;  3CF2 A;  4AIK A;  2PXE A;  3C18 A;  5J4V A;  4M3G A;  3QWG A;  1BW5 A;  4ZYE A;  4RB1 A;  5DCM A;  3ABT A;  2KP6 A;  3CME I;  4F8D A;  3CO6 C;  3I9V 2;  4HV5 A;  3GBG A;  4N9I A;  2E1O A;  1TT5 B;  2BOL A;  2HFH A;  4QIW N;  2PXK A;  2BYV E;  3DBH B;  3EPZ A;  2FD5 A;  2CQK A;  4JYK A;  5CVV A;  2DFE A;  3KP4 A;  4ESB A;  3ASO H;  4EVI A;  1TWC J;  5BS6 A;  1PRU A;  5TGT A;  1ZRD A;  2PXB A;  1ZAR A;  4F52 A;  2O9L A;  4B09 A;  1VQ8 I;  2EQR A;  4AUX A;  2WWY A;  3QWL A;  2A05 A;  3Q5F A;  3ZCO A;  2FMY A;  2Y0M A;  3ELK A;  1OCO H;  3KLO A;  3TP3 A;  3JTG A;  1TQI A;  2CU7 A;  2K9S A;  4CCK A;  5JHF A;  1IDY A;  2J5O A;  3SFI A;  5DCM B;  1T98 A;  4ITV A;  3HIF A;  4KT5 C;  1VZ0 A;  2VUM J;  3E6B A;  1W5T A;  4P5O A;  3W2V A;  2H8W A;  3OYA A;  2BJC A;  2IS2 A;  4N0B A;  2K9L A;  2QCO A;  5TJJ A;  2KZ8 A;  1QHG A;  3KYD B;  3CMM A;  2Z16 A;  1E3H A;  5D5U B;  3QYF A;  2LKS A;  2QBY B;  2XUB A;  2AXZ A;  4DYC A;  3E6C C;  2HYF A;  2V1U A;  5FLV A;  2F5C A;  2V26 A;  1XGO A;  1IRG A;  4H0E A;  2OCE A;  3OQM A;  1QVT A;  2W7N A;  2HDC A;  4XOP A;  2CV1 A;  5HS9 A;  2R63 A;  4X4I A;  2QSG X;  4OIR F;  2R7Z J;  4IVN A;  2IT0 A;  2PPX A;  2BY1 A;  1F9N A;  2HYG D;  2WY7 Q;  1MSF C;  2L3D A;  1Z77 A;  1YX3 A;  3U9G A;  2FBH A;  3QQA A;  4I2O A;  3OSG A;  4MTD A;  3RSN A;  1QPM A;  5M5X J;  1LPQ A;  3CLQ A;  2WA0 A;  1RZR D;  3I0T A;  2COB A;  5FRN A;  4EJW A;  4KIG A;  1LJ9 A;  1P9Q C;  3DTI A;  2DFI A;  3S3N A;  3RPU A;  5K5O A;  2XF6 A;  4M6Y A;  2PXL A;  1MJA A;  1G4D A;  2DMU A;  1XC5 A;  1SAU A;  1LCC A;  1U2W A;  3G1O A;  3GZD A;  1HDP A;  2Y48 A;  2OJE D;  4D5C A;  3D0S A;  4IHV A;  2D1V A;  3UR3 C;  2PUA A;  3H9J A;  3KP7 A;  1D8K A;  4A3K J;  3KP3 A;  4A3J J;  2DOD A;  1G3W A;  4XMY A;  1FP1 D;  4MGR A;  1OCZ H;  4HNV A;  1VQP I;  2NNN A;  4A3C J;  3IUO A;  1DUX C;  3ABU A;  2E71 A;  4A2U A;  3LA7 A;  1W7P D;  4XON A;  3F6W A;  2ZME C;  1F1Z A;  4NDL A;  2BGC A;  3VEP A;  3ZR8 X;  1AOY A;  1JGS A;  2HPM A;  1WET A;  2Y30 A;  3EUS A;  4B8X A;  1MW7 A;  2ESN A;  1PRA A;  4CSW A;  4YIF A;  5LBQ A;  3OMT A;  3S14 J;  2H6C A;  1TWA J;  2HQ5 A;  2DO7 A;  3WE3 A;  3GF2 A;  1BDH A;  5L3D A;  4F55 A;  4ZYG A;  5DDG A;  1HLV A;  1Z91 A;  2W24 A;  1U9N A;  3TBI A;  4Y4R A;  1VQL I;  4KFC A;  3ZGK A;  5LLQ A;  2QUF A;  3E0J B;  5F64 A;  2LK2 A;  3QPS A;  3WTS C;  4V19 K;  4F3Q A;  2LP0 A;  2XPW A;  4BS9 A;  3DPU A;  3GTM J;  4A5M A;  3OS2 A;  3FXJ A;  1JKP C;  5LD2 C;  2K9Q A;  3FXO A;  3OYH A;  2CV2 A;  2KIQ A;  2DYR H;  3M8E A;  3AG1 H;  4E6K G;  5KK1 A;  4B1R A;  2KZG A;  3ZMS A;  5CKT A;  4XBF A;  1HBX G;  3GO5 A;  3G4S I;  2PIJ A;  2O6G E;  4II2 A;  4RAZ A;  2ZJR F;  1YHQ I;  4HX4 A;  1LQ1 A;  2CW8 A;  4JQD A;  2X0L A;  3M07 A;  1B9M A;  2CRG A;  2F4I A;  3I59 A;  2DBB A;  4K2E A;  1KQ9 A;  1B1B A;  4QPO A;  1HOM A;  5B1B H;  2RC4 A;  1AU7 A;  1JFS A;  1GXQ A;  2O4A A;  2E5Z A;  2XVC A;  4L18 B;  3RKQ A;  4FQG A;  2GLO A;  2LYP A;  2GIV A;  1WFX A;  3I54 A;  5BOX A;  1V55 H;  4W1U A;  1JKR C;  3BT9 A;  2R7D A;  4KIB A;  1ZS4 A;  3OIQ A;  3OP9 A;  3T5X A;  2KEJ A;  4KN4 X;  3PE5 A;  2L8N A;  3SJM A;  4XLF A;  2LYQ A;  1VI0 A;  2R92 J;  3OMY A;  1QQA A;  3BDN A;  2O5R A;  1D5V A;  3TEP A;  5IOY A;  3FXK A;  3JCU C;  4CCJ A;  4R8H A;  3I59 B;  3ZXS A;  4ZH4 F;  3CCV I;  2FEZ A;  1MJB A;  3JRA A;  3MQ0 A;  2DMN A;  3VK0 A;  1PDN C;  1MMN A;  3BCB A;  4P55 A;  2P5L C;  5ICF A;  4KYW A;  1IV8 A;  2A3S A;  2MLG A;  3IH2 A;  4IVZ A;  5JFR A;  5DCF A;  3M9L A;  3CUO A;  3R09 A;  1LDJ A;  3K1N A;  4ER7 A;  1WJB A;  2E35 A;  3OY9 A;  2EV6 A;  5FKN A;  1YI2 I;  3BCA A;  3JXC L;  4EQQ A;  3RYP A;  4A6D A;  2K3F A;  1SD5 A;  2W25 A;  2Y0S A;  2LNB A;  1IXR C;  2VQH A;  1PJR A;  2UUZ A;  4Y15 A;  1PNR A;  2EJR A;  3K1M A;  2QA4 I;  2IPQ X;  4EMS A;  2GAU A;  3NWS A;  3GTK J;  3BTJ A;  1UG2 A;  3IAS 2;  2HYJ A;  4Q48 A;  1KU3 A;  4ZTJ A;  4KJZ A;  1VQ4 I;  3Q0W A;  5C4X J;  2KJB A;  2IGO A;  2R5Z A;  1YS6 A;  3L2W A;  5M3F J;  1JE8 A;  1XN7 A;  5HVQ C;  1ZAO A;  1ON1 A;  1FMV A;  3TGN A;  3H5R A;  3TOA A;  2Y9Y A;  1K79 A;  1DDN A;  1LKX A;  1K78 A;  4RS8 A;  4MTE A;  3ZMU A;  5K7F A;  1HCR A;  2O49 A;  4E7I A;  2JWT A;  3FMY A;  1Y1W J;  2FBK A;  2C6Y A;  1B0N A;  2W84 A;  3BR5 A;  5IT3 A;  4I98 B;  5K1Y A;  1RES A;  1UB9 A;  2LG4 A;  2XAJ A;  3FWE A;  2FX0 A;  3ZMD A;  2LYS A;  1WJF A;  1B9N A;  1SAN A;  3G1L A;  4AID A;  5F0F A;  1T56 A;  4BBR J;  5FLM J;  2E2H J;  3FXL A;  4MIM A;  5H6R A;  3BR1 A;  3OYG A;  1MMA A;  4JX6 A;  2ID6 A;  4EV0 A;  1L3L A;  4BXX J;  3CCS I;  4ABZ A;  4BJ5 C;  2V1N A;  1USS A;  3BTL A;  4A0Y A;  1K83 J;  2R5Z B;  2KFD A;  2VN2 A;  3A02 A;  1FOW A;  2NS8 A;  2LY2 A;  2VKV A;  3ESW B;  3PUF A;  3R61 A;  3U2R A;  4FCY A;  5KAI C;  4UB8 C;  2D5V A;  3CCY A;  3SXY A;  4IX7 A;  2E1N A;  1K78 B;  5J1Y A;  2PFB A;  2O3F A;  1H88 C;  1IAW A;  1MBH A;  3BOQ A;  4RLF A;  3T0Y A;  2CH0 A;  2PBI A;  1IW7 F;  3K6G A;  3R0J A;  4HF1 A;  4XLC A;  1CF7 A;  5HNH A;  4S05 A;  1DU6 A;  1WSU A;  3IRQ A;  3PSF A;  2DQL A;  3AL0 B;  3FF5 A;  3O2P E;  3O8G A;  1NG6 A;  4B4C A;  2Z3Y A;  4BQN A;  1G59 A;  5KAF C;  2JVG A;  3K7A J;  3V7R A;  3WOD F;  2BBY A;  4I09 A;  5DSX A;  1EF4 A;  1HW1 A;  2DA3 A;  2XDV A;  3HPG A;  2X9D A;  1GDT A;  5JR3 A;  1MZB A;  2E5N A;  3A0B C;  1HST A;  3LFK A;  2MD5 A;  1OR7 C;  3IC7 A;  4O5V A;  4YFX F;  2BZT A;  5F0C A;  4IOA F;  3PJR A;  3J7A Y;  1BR4 A;  1QPI A;  5D6E A;  3FX3 A;  2V1D A;  2KEI A;  2LYC A;  1CF7 B;  5HLG A;  4Y3O A;  2VOO A;  3ZN0 A;  5E17 F;  3GFM A;  3K4L A;  3VOE A;  1OYW A;  1W0T A;  2OUM A;  1BIB A;  4GHJ A;  1O7L A;  1Y6I A;  4IKF A;  3E6D A;  2GM4 A;  3FYA A;  3F6O A;  2BY0 A;  2P7V B;  2ZJQ F;  3E7L A;  3S2W A;  1R58 A;  2KMU A;  2PMZ N;  1X3W B;  1O3T A;  5DRY A;  1Z7U A;  1BDI A;  3HRT A;  3IH4 A;  4GXO A;  5CVJ A;  4YRV A;  1IDZ A;  4I6U A;  5LGU A;  4G7Z F;  3MMY B;  2HZD A;  2XXA A;  3DNV B;  4L9N A;  1QO0 D;  1FTT A;  3ONQ A;  4LIT A;  2R7Q A;  2WY8 Q;  2DOF A;  1DP7 P;  1T6S A;  2DA5 A;  2GQQ A;  2GXG A;  2LC2 A;  2RGV A;  4ENN A;  2PUB A;  3HUG A;  2DDA A;  4Z6Y A;  1DPR A;  3CD6 I;  1YSE A;  3U3W A;  1JKO C;  4I7H A;  3PQK A;  4FET A;  1S29 A;  1S8N A;  2H6B A;  2XB0 X;  4A5N A;  1Z9C A;  3VPR A;  2FBI A;  5E18 F;  5H20 A;  4DBQ A;  3OR1 C;  4ENK A;  2R0Q C;  1ZZ7 A;  2DJI A;  4U0Y A;  3KEO A;  3QPH A;  4D7M A;  4UUV A;  3DBL B;  4FTH A;  1ZPQ A;  3QU6 A;  4PJN A;  2NNY A;  4ER6 A;  3CJT B;  3BPV A;  3HKZ A;  3WE2 A;  4HV6 A;  4OIQ F;  4XIC A;  4X4B A;  1HF0 A;  5KHD A;  3OQO A;  1ETQ A;  1NTC A;  1QZY A;  4DW6 A;  2R93 J;  2YUS A;  4CYD A;  2M4K A;  1FYM A;  4ETS A;  2LKP A;  4X4G A;  1JH9 A;  3VYR B;  2BHY A;  2W48 A;  3DF8 A;  3IWF A;  3HUG B;  1X1B A;  4KIF A;  4C30 A;  2JMW A;  1V3F A;  2KHM A;  4A69 C;  3OYF A;  3JSO A;  4B3X A;  2VKE A;  1SFE A;  5JLX A;  1FJL A;  1BC7 C;  3HOU J;  3J81 Z;  4HQM A;  1WI9 A;  2VE8 A;  1IO2 A;  2VOP A;  2QKL B;  4LK1 F;  3HOX J;  3F23 A;  3CRO L;  4PFO A;  1P4W A;  2A5Y B;  5BMZ A;  4YEJ A;  3AG3 H;  2KT0 A;  2ME0 A;  1BOA A;  3OL3 A;  1O3S A;  1JJ8 C;  4PU4 C;  3PO3 J;  2YX4 A;  1Z21 A;  2M3A A;  1NW3 A;  5EZH A;  4ENM A;  3KPH A;  4ZDL A;  1OMI A;  3QPT A;  4V2G A;  5E3N A;  1N77 A;  4YEL A;  2MLK A;  1YOV B;  1JKQ C;  1LMB 3;  3SHF A;  1ETW A;  3SDG A;  2R7O A;  2M30 A;  3B73 A;  4LJZ F;  5LRS A;  3TO9 A;  3ASN H;  2XAG A;  4U87 A;  2AUW A;  3FYM A;  5GPA A;  1RKW A;  1IRZ A;  3RIR A;  4Y52 J;  3ZQH A;  3OOU A;  5F04 A;  1RET A;  1YW7 A;  5FD5 A;  2XCJ A;  1P4A A;  3KIO A;  3CF5 F;  2JVL A;  1QZX A;  2N8G A;  2P6S A;  2J7W A;  5DM6 F;  1ETV A;  2B7E A;  3QP6 A;  3IL2 A;  2EFN A;  3MKL A;  3ABK H;  3CC2 I;  2LTP A;  5CVU A;  1DU0 A;  4W97 A;  4Z5C A;  4HQE A;  2XIG A;  2NRA C;  4UHT A;  3AG4 H;  3FDY A;  2CW0 F;  3DM5 A;  2M8G X;  2HOS A;  3T8T A;  1SFU A;  3PQJ A;  1OIS A;  5FKK A;  3J7Z I;  2CMP A;  3TL4 X;  2ZKZ A;  4Y33 A;  2R7F A;  3FHZ A;  3ZKC A;  1AKH B;  2EIN H;  4FX0 A;  2XAF A;  5DT2 A;  5J4Y A;  2P81 A;  2MGQ A;  3LQR A;  1SFX A;  1OPC A;  1UXD A;  3S3O A;  2PG4 A;  4BHC A;  5J6X A;  4FE7 A;  3NRO A;  4MO7 A;  4QLC U;  3S2H J;  2WAF A;  4CDG A;  3GZ6 A;  1YE9 A;  1RIO A;  2CSO A;  5IP9 J;  4HAM A;  2AW6 A;  1Y39 A;  3HZI B;  1TQP A;  2DTR A;  2AQE A;  2PMU A;  1B59 A;  4P1W A;  3BG5 A;  5L3G A;  1A31 A;  1XGN A;  2HQA A;  2Z1D A;  5D5W B;  4R1H A;  1UTX A;  1XDU A;  4M73 A;  1SVL A;  4M6V A;  3ZQG A;  4EQZ A;  5EJC A;  5CJ9 A;  3WGG A;  1TC3 C;  3RZZ A;  4HEA 2;  1ZGA A;  3GLX A;  1G6N A;  4C2M J;  4UV8 A;  2M34 A;  4UVC A;  2A6H F;  3JRE A;  2H1K A;  3BY6 A;  3PFI A;  2O8X A;  3QOD A;  3S1M J;  4A3L J;  5CVR A;  1QGP A;  1T0F A;  2QGU A;  1RIO H;  4A3E J;  5D4R A;  3S1Q J;  1OCT C;  3VYU B;  1J75 A;  4IQJ A;  4BKX A;  1CJG A;  3DKW A;  3BQY A;  1J7K A;  4O3M A;  1DPU A;  2QKM B;  2L9R A;  1ZEL A;  2XAS A;  1FOY A;  3P9I A;  3O3K A;  3F51 A;  5D5X B;  2HVQ A;  4BDZ A;  4PJM A;  3MCZ A;  1B72 A;  4RAF A;  3LFP A;  2A68 F;  1T39 A;  2QQ8 A;  2RRE A;  2ZXW H;  1BI0 A;  2J5P A;  1XMA A;  2X6X A;  3RKW A;  3VSL A;  3L2V A;  2OR1 L;  5LGT A;  1X1A A;  1S7O A;  1ZR4 A;  3K0L A;  4MLO A;  1JT6 A;  3ECH A;  3C2H A;  4PGG A;  4C2T A;  2BHZ A;  2EV5 A;  2KZV A;  1E3O C;  2CS3 A;  3BZC A;  4TV7 A;  4A6E A;  3CLC A;  2HKX A;  3FKJ A;  1MD0 A;  3FZV A;  4UUS A;  1QPZ A;  4CZC A;  3M7G A;  3VWS A;  3TP0 A;  1YIT I;  1VF9 A;  2FOW A;  3JXD L;  3MN2 A;  1FSH A;  3PFY A;  1FYL A;  2VQC A;  3A9X A;  2ZC2 A;  1OJL A;  3WU2 C;  3VOD A;  4G12 A;  1FYK A;  1B72 B;  5L3C A;  1MNM C;  2EPF A;  3PXP A;  4AIH A;  1U6G A;  4KT6 A;  5IT9 Z;  2G7H A;  4CH7 A;  5DYM A;  4BJ6 C;  2YS9 A;  1UJ8 A;  3HPH A;  4BUP A;  1SVO A;  1IGN A;  2LSO A;  5AIP A;  2DMT A;  3F9K A;  3HC7 A;  1QU3 A;  5IYB J;  1O57 A;  1P6R A;  1FIA A;  4J00 A;  3F8C A;  4PSW A;  3OS0 A;  1J5Y A;  2BXZ A;  1E0E A;  2JTV A;  4ZYA A;  3RDI A;  2DLL A;  4OMZ A;  3F0C A;  2AXV A;  1NK3 P;  3FK6 A;  1LUJ B;  4RGS A;  1VQ9 I;  1PUF B;  3ECO A;  4UUS B;  3Q9V A;  4FX4 A;  1EA3 A;  3OQN A;  1RPE L;  4RGR A;  4AM3 A;  2IUO A;  3E5X A;  2PXT A;  3FXU A;  2X1C A;  4L5E A;  4RA2 A;  5A2Q Z;  2HNH A;  5BPD A;  2EZH A;  5IPA A;  1Z7L A;  4JBA A;  3HTS B;  1ETK A;  1N25 A;  3S8P A;  4DZP A;  5IY5 H;  2PXV A;  2F2E A;  4GGG A;  1JWL A;  2K3P A;  1WH6 A;  4UVA A;  2FNP A;  4F91 B;  2WB1 N;  3CZ6 A;  1LDK B;  2F6C A;  2KDO A;  3N05 A;  1MH4 A;  3V7S A;  1K4S A;  4OAZ A;  4XRS A;  5EDN A;  2VON A;  5BPI A;  2AWI A;  2QVO A;  2GBY A;  1LEA A;  3VYS B;  3KLN A;  1PUE E;  1BI2 A;  2HDW A;  5GTI C;  2XC7 A;  1V5F A;  2HQR A;  4D9J A;  4A12 A;  2PXF A;  2MFZ A;  4IQ4 A;  5DM7 F;  4CCM A;  3JRF A;  3HRS A;  1NER A;  3CP2 A;  3E1S A;  3CUQ A;  4AWX B;  1KYW A;  3PUB A;  3VDX A;  4BNC A;  1I39 A;  4LD5 A;  1XSX A;  4IHT A;  1GUU A;  1IZ1 A;  2MA3 A;  3MWM A;  3P9K A;  4ON0 A;  3S93 A;  3W2W A;  2XRL A;  5BQT A;  3AKZ A;  3L2C A;  2DPD A;  1YLF A;  2IW5 A;  4U0W A;  2I10 A;  3ZQF A;  1RPW A;  3B7H A;  3HXL A;  5CQE A;  2TDX A;  2RV8 A;  2IRF G;  4C3J J;  3K2A A;  4XLH A;  1D8J A;  1WHU A;  2DJN A;  4OIP F;  3MEJ A;  4OB4 A;  4M72 A;  3KCC A;  4Q47 A;  1G3S A;  4L5I A;  2QEN A;  2LD5 A;  4EK9 A;  2NXN B;  3CDI A;  2OFY A;  1VND A;  2QF7 A;  3J80 Z;  3TDU C;  4PU7 A;  2KQR A;  2QQA A;  2A6T A;  3GCM A;  3LSM A;  4BQA A;  3SZT A;  2E1M B;  5J8F A;  3CUQ B;  2OTL I;  1TWF J;  4KUM A;  5B1A H;  1ZK8 A;  1MMS A;  2UV1 A;  4MFE A;  3QAH A;  4BHB A;  3QOE A;  1CQT A;  1MSE C;  1HC8 A;  4YG1 A;  1EH6 A;  3T1B A;  4ZDO A;  3CTA A;  1M1E B;  2UXN A;  2QM3 A;  1MBE A;  3K4C A;  3R4K A;  1IF1 A;  2ODR D;  2DTZ A;  3CCR I;  5IP6 A;  1Y9Q A;  2AS5 F;  1QA6 A;  3H5A A;  3PNV A;  3OIP A;  3N97 A;  2JPC A;  4WXC A;  2XAQ A;  1I3A A;  4BL0 B;  2H09 A;  1XDS A;  1S6L A;  2CSF A;  3ZPL A;  2BE5 F;  2ME6 A;  5JUW A;  3WTV C;  1R71 A;  1WH5 A;  3SQN A;  1XX5 A;  3HM5 A;  2LF7 A;  2VBX A;  2PXP A;  4Z59 A;  4L0Y B;  1JI8 A;  2DXI A;  4BAY A;  3HRM A;  5HLH A;  2CWE A;  3EYY A;  2XRN A;  5C4J J;  3DKX A;  1ZLJ A;  3VB2 A;  3OYC A;  4ZYH A;  2ZFW A;  2PUE A;  1WRJ A;  2ECC A;  4EJT A;  4LG3 A;  1F5T A;  4KMF A;  4B43 A;  4XSZ F;  4A3I J;  4IOC F;  1NH3 A;  5K7Z A;  3JR9 A;  5E1W A;  3LSI A;  2K4J A;  5DD4 A;  4F93 B;  5GTH C;  2VE9 A;  1UHM A;  3M1E A;  3V8J A;  2L01 A;  2LYR A;  3Q3S A;  5EF6 A;  2FU4 A;  4M3D A;  2UZK A;  1S7A A;  4IEJ A;  1VQO I;  1VFC A;  3HOS A;  5LEK A;  1LVK A;  2HWV A;  5E3O A;  3KP5 A;  5HOD A;  4AD9 A;  4OIN F;  4J1W A;  3GFJ A;  4M9Z A;  1YIJ I;  3K4K A;  1I27 A;  4YG2 F;  2XXQ A;  1X58 A;  3GUD A;  4I02 A;  1Z1D A;  2EWN A;  3L09 A;  3KX2 A;  4IZZ A;  1MBJ A;  2K7L A;  3FKI J;  5FD6 A;  3ZHM A;  1GVD A;  3MLF A;  3QP5 A;  2XPV A;  3OS1 A;  1A35 A;  1FOX A;  1RZ4 A;  2LKX A;  2EBY A;  1P92 A;  3HDD A;  5IYD J;  1ITY A;  4RGX A;  1BR1 A;  2F4O B;  2IVM A;  3L2Q A;  1A04 A;  3H3U A;  3UKG A;  2LLV A;  4LOC A;  1O3R A;  3CQZ J;  2JA8 J;  2WAQ N;  3ABL H;  1FEX A;  2OZ6 A;  1B6A A;  2IS6 A;  1IXC A;  1YYV A;  4JCX A;  2D2W A;  4EM1 A;  1O7F A;  3E5U A;  2M4H A;  2JVH A;  1V5G A;  3G3Z A;  5E1Z B;  3BZ6 A;  3ZHI A;  3KZZ A;  2XAH A;  2O03 A;  4BYY A;  5L3F A;  2DN0 A;  4HZF A;  3RKX A;  3LAJ A;  5TRD A;  3HOT A;  1IN8 A;  3Q9S A;  1YW8 A;  4M3F A;  1QB2 A;  1Z05 A;  2EFP A;  5ILV A;  4O6J A;  2DI3 A;  1DUL A;  1HQC A;  4DGW B;  5B5E C;  2PUD A;  1XCV A;  3OR2 C;  3JAM Z;  1PVE A;  2VI6 A;  1I5Z A;  1YX5 A;  2OCC H;  3EUK L;  1IC8 A;  2JK3 A;  1K4T A;  2ZBK A;  4Y42 A;  3U1K A;  3RZD J;  4PK4 A;  3HL2 A;  4BQO A;  1IUY A;  3KZI C;  3WG9 A;  1R49 A;  1UG0 A;  1POG A;  2W4S A;  5L3E A;  2EFQ A;  4U0V A;  3Q0U A;  3ZPX A;  2VQL A;  5M3M J;  2KRC A;  2PX9 A;  3I58 A;  1T2K A;  4B47 A;  2XPU A;  1HKS A;  1QRY A;  4C2U A;  5EZG A;  5FB2 A;  1RR8 C;  2EBI A;  1BIA A;  2GA1 A;  4XK4 A;  3DXJ F;  2VAS A;  2OF7 A;  3LWF A;  2BVL A;  2XF5 A;  1MBF A;  1Z6T A;  2ZB9 A;  5E1X A;  5GAE J;  1H89 C;  4XLP F;  4N4N B;  3IH3 A;  2VL8 A;  3LA3 A;  2JJ7 A;  2PJR A;  1WJD A;  4JP0 A;  2ACJ A;  2X48 A;  2ZXH A;  2DK5 A;  1JJ6 C;  2AHQ A;  3CJR B;  2IP2 A;  1FLI A;  1BC8 C;  2GXA A;  2JZY A;  2FA5 A;  1R6R A;  4GQM A;  2E1C A;  2DOA A;  2L9V A;  3FM3 A;  1OCC H;  4KNY A;  2LY1 A;  3ZQQ A;  3HJE A;  3FXM A;  2Z9O A;  3BS3 A;  3LST A;  4KIC A;  1XGM A;  4XRM A;  2M4G A;  3K1P A;  4EM2 A;  3MKY B;  3KP2 A;  4BBS J;  4ZYD A;  3GFL A;  4G94 A;  2Y9Z A;  1Y8R B;  4CO8 A;  4AYB N;  2X6Y A;  5J8C A;  2Y31 A;  5KNL A;  3A1Y A;  1X2L A;  3S17 J;  2Q0O A;  1OKR A;  3NEU A;  2PJR B;  1H8A C;  1U5T C;  3MZY A;  5DTD A;  1TW2 A;  2K4B A;  1FBQ A;  2ZSH B;  3JRD A;  4GRI A;  4LMY A;  3H1C A;  1SAX A;  4PCQ A;  3WG7 H;  2EA2 A;  1ULY A;  2PEX A;  4IA8 A;  4BH9 A;  4X4H A;  5HS7 A;  1K7A A;  2V3C C;  1FBU A;  1TP4 A;  1LE8 A;  2AO9 A;  1X3Z B;  2FXA A;  4D7N A;  2L5Q A;  2L7M P;  2OAZ A;  4RGU A;  2IVB A;  2NAZ A;  1SMY F;  3M9A A;  5EG0 A;  2VXZ A;  2XGD A;  3O8H A;  3BJA A;  1JHH A;  4BGD A;  3LQX A;  1LVA A;  1WPK A;  4OBM A;  4E70 A;  1S7E A;  1W1W E;  2ZNY A;  2E7W A;  3VWB A;  1QQB A;  3LSH A;  3MZH A;  1ZG5 A;  1S5L C;  4V2F A;  1S9H A;  2R7U A;  3PL8 A;  3BPX A;  4PJ0 C;  2MXD A;  2CQX A;  1NG7 A;  5E3L A;  1FTZ A;  1Z67 A;  1QVU A;  3QFI A;  1H9T A;  1DGW Y;  4HST A;  3IVP A;  3OYN A;  3V7C A;  2DA2 A;  2CFX A;  4RMN A;  2EH3 A;  1ZZ8 A;  3MAJ A;  5JHU A;  1W36 D;  5D4S A;  3A01 A;  1LE8 B;  2STW A;  4Z5D A;  1EKE A;  4NC8 A;  2ECB A;  2HXO A;  5GPC A;  1T38 A;  5EG0 B;  1IN7 A;  1BA5 A;  1WZ2 A;  3LIS A;  2Y75 A;  1ZR2 A;  1MFQ C;  3LOC A;  2CGP A;  5FRM A;  3A9Z A;  3DKY A;  3FM5 A;  3HTU A;  4RDU A;  4UB6 C;  1U8R A;  4I6Z A;  4I99 C;  4GYG A;  4CA0 A;  2VJI A;  3BJ6 A;  2XJ3 A;  4FHT A;  2X6W A;  1X4O A;  4NBQ A;  1TTY A;  1I6X A;  3KET A;  2Z33 A;  2L4M A;  1HQ1 A;  3Q0V A;  1QZE A;  5JVT A;  3AAF A;  1BJZ A;  2M7B A;  2P5V A;  3WGI A;  2X51 A;  4LK0 F;  4WVL A;  5LHG A;  4E7L A;  3A01 B;  4M9X A;  3H5T A;  4UVB A;  1U0J A;  4QSH A;  1HSJ A;  1MNE A;  2KPM A;  4NHJ A;  1OQY A;  1QP4 A;  2DYS H;  4A3G J;  1A5J A;  3L00 A;  3TW7 A;  1T08 B;  2FE3 A;  2XHK A;  1YW9 A;  5FLX K;  3HOZ J;  1YJN I;  3M4O J;  3E3V A;  3F3X A;  1P7J A;  5HNF A;  5D8L B;  4C3I J;  3MVP A;  1D0Y A;  4RB0 A;  1R9T J;  4UY8 I;  1WH7 A;  2DU9 A;  2V9V A;  3HGG A;  4GDF A;  3UWP A;  3CCQ I;  3SFZ A;  4XKW A;  3V42 A;  2PXD A;  3FXQ A;  4I01 A;  3F21 A;  1GT0 C;  1Y56 A;  3CC4 I;  3HSR A;  3ME5 A;  2XGX A;  1WCM J;  3RYR A;  5K98 B;  1O4X A;  5K5R A;  4F7Z A;  3J81 K;  4HF2 A;  1T8I A;  2HTJ A;  3HBL A;  1XS9 A;  1UFM A;  4IRI A;  4E7S A;  1XSD A;  2FJR A;  1VQN I;  3A0H C;  2ICT A;  2LBF A;  4GCV A;  3SR4 A;  2F5E A;  2L7K A;  3JRI A;  2B0L A;  2IA2 A;  2IV1 A;  1YQA A;  2DCE A;  3WU1 B;  3OYK A;  2STT A;  3F8B A;  1LLI A;  2NOJ B;  3GTP J;  2JRM A;  1JUM A;  1LFU P;  1IG7 A;  3HGY A;  1KGS A;  5B3S H;  2EZL A;  1R00 A;  2ZSI B;  3KEY A;  2JSP A;  4L5J A;  5E79 C;  1SQ8 A;  3P7N A;  2FUG 2;  1UZC A;  2A5W A;  5J1U A;  4F92 B;  3SEQ A;  3IKT A;  2WBM A;  3HOV J;  2K85 A;  1WJE A;  3EDP A;  2LBF B;  1WKM A;  3RPU D;  1P7I A;  2HSG A;  1FIP A;  4YG7 B;  2M5W A;  3FIS A;  5CLS A;  2PUC A;  1Y7Y A;  3AG2 H;  4XN0 A;  4WK8 F;  2ETH A;  2IJL A;  2K27 A;  3PSI A;  4P9F A;  1IN6 A;  3KE2 A;  3PNY A;  3IV5 A;  3CO7 C;  2XKP A;  3GLL A;  2E36 A;  3LMM A;  2EIM H;  1JGG A;  3HSF A;  1ZYR F;  2KKO A;  4WX9 A;  1MDM A;  5ILU A;  2DT7 B;  5JLW A;  4ZJZ A;  1FP2 A;  2M45 A;  2QZ8 A;  3HYI A;  4HX7 A;  4DE8 A;  3BR3 A;  1YS7 A;  3U21 A;  1STZ A;  2BV6 A;  1DGR M;  2QQB A;  3R0A A;  4WF2 A;  1IJW C;  1TNS A;  3I4M J;  2YSR A;  1V4R A;  1ZKG A;  2VT3 A;  2RNG A;  4LLN A;  1ZZ6 A;  2DT5 A;  1FZP B;  4IWR A;  2IAI A;  4PSX A;  2V4J C;  2FML A;  2X85 A;  3OL4 A;  1APL C;  3IAM 2;  2HGC A;  1Z6R A;  1UHW A;  1ZZ9 A;  2XI8 A;  1G8X A;  5CPR B;  1POU A;  1BL0 A;  2VPL A;  3ZRG A;  2GRL A;  1GV2 A;  4BXU A;  2PMZ A;  2JUG A;  2MH2 A;  3LSG A;  3GUU A;  1MDM B;  3B6C A;  2JRT A;  5ED4 A;  1VTN C;  3E5Q A;  1UMQ A;  2OC6 A;  1O3Q A;  5FKL A;  3M8F A;  1U78 A;  3QYB A;  4FIS A;  4EJU A;  4KIS A;  4JOM A;  5FFX A;  2KIU A;  5E8G A;  5GAH J;  4HPQ A;  4XLA A;  1LCD A;  1IXS B;  4CUG A;  4DBR A;  4U7B A;  2OQR A;  3L2U A;  3SCH A;  4CCL A;  4EGY A;  4IHS A;  2JQ7 A;  4PZJ A;  1ETO A;  4ZTF A;  1OFC X;  1WQ2 A;  1RC9 A;  2IBD A;  2Z5U A;  4M74 A;  4QPQ A;  1ZZC A;  1KYZ A;  3FK7 A;  3JRG A;  4DJA A;  4XKB A;  3I71 A;  3RPQ A;  4ZDP A;  3C2B A;  4OOI A;  4MCT A;  2CW7 A;  1X2M A;  2LDU A;  1FOK A;  1WJC A;  1R22 A;  4HOB A;  2DAO A;  1R36 A;  4IRG A;  5F6F A;  4Z2Y A;  3I4N J;  1LNW A;  2MQK A;  2NS0 A;  2XSJ C;  4MQ9 F;  3SZG A;  4I6R A;  3I56 I;  2H27 A;  3S1N J;  3K4B A;  4DQ2 A;  1F4K A;  4XSX F;  3GEZ A;  4WCG A;  2IA0 A;  1ZVV A;  5FO5 A;  2IGK A;  3RCO A;  2VEO A;  3KXA A;  3PIP F;  4LB5 A;  3F52 A;  4A93 J;  3E97 A;  4OWR B;  1SD7 A;  1MMD A;  2W85 A;  4LG0 A;  1G3T A;  1SD6 A;  1K61 A;  3GW2 A;  4EM0 B;  3UNG C;  4BE0 A;  1U2Z A;  2L4A A;  4N4O B;  2L54 A;  4PUS A;  2KEK A;  4XRF A;  5J1R A;  2M8E A;  3GTJ J;  4IXA A;  2FQ3 A;  3W6K B;  2ICP A;  2GZU A;  2PN6 A;  2QEX I;  3EUH A;  3JSP A;  2ELH A;  1GXP A;  3GTG J;  4NC6 A;  1F36 A;  1REP C;  3DEU A;  4ER0 A;  3REO A;  3K10 A;  3BG3 A;  2VB6 A;  4UXN A;  2V7F A;  3MKW B;  2B63 J;  4G6Q A;  2PUF A;  3SZP A;  2WIU B;  4EGZ A;  4PDK A;  1YFH A;  1EJ9 A;  1D0X A;  4P9U A;  1KU7 A;  2HVS A;  5IT9 K;  4FN3 A;  1MKM A;  1GV5 A;  4XLN F;  3E6M A;  4E7K A;  4YAR A;  3F6V A;  3NDB B;  3D1N I;  4HRA A; 
#chains in the Genus database with same CATH homology
 1MBE A;  4FBI A;  2R5Y B;  2DTZ A;  5IP6 A;  1LQC A;  9ANT A;  2DA1 A;  3NAU A;  3BTI A;  2HI3 A;  1Y9Q A;  2BNO A;  3JRB A;  5FKM A;  4MFD A;  3TED A;  5FKN A;  3HB9 A;  3NAR A;  3JXC L;  2NS7 A;  2CSF A;  1JT0 A;  2ME6 A;  2GRM A;  2LR8 A;  1WH5 A;  5IP7 J;  1ZUG A;  3LSP A;  3HM5 A;  4Z59 A;  2NOG A;  2WUS R;  1PNR A;  1TWH J;  3S1R J;  1BW6 A;  3CMY A;  2G0E A;  3PO2 J;  5C4J J;  3CDL A;  2HDD A;  3GTK J;  3BTJ A;  1UG2 A;  2M2E A;  2HYJ A;  2PUE A;  2DA7 A;  3Q0W A;  5C4X J;  2ECC A;  2R5Z A;  5M3F J;  2JN6 A;  1R63 A;  4DZJ A;  4A3I J;  4YBA A;  4I76 A;  3HOY J;  4FE4 A;  5K7Z A;  3JR9 A;  1X57 A;  2XGC A;  2Y9Y A;  1D5Y A;  5EGO A;  5K7H A;  5EEA A;  2ID3 A;  5K7F A;  1HCR A;  2O49 A;  2HIN A;  3DCF A;  2LYR A;  3CEC A;  2JWT A;  3Q3S A;  5EF6 A;  1Y1W J;  1B0N A;  1I50 J;  3FMY A;  3BR5 A;  4M3D A;  4X4F A;  5E3M A;  2PE5 A;  1RES A;  4IEJ A;  2FX0 A;  2LYS A;  2MG4 A;  1VFC A;  3G1L A;  1SAN A;  2E19 A;  5FJ8 J;  5F0F A;  1T56 A;  4BBR J;  5E3O A;  5FLM J;  2E2H J;  4NDW A;  5HOD A;  4J1W A;  4MIM A;  3BR1 A;  4JX6 A;  1W0U A;  2ID6 A;  2XGE A;  3KZ3 A;  1Q1V A;  1X58 A;  4BXX J;  3DEW A;  1MBJ A;  3FKI J;  4ABZ A;  4X4D A;  3ZHM A;  3BTL A;  1GVD A;  2VPR A;  1K83 J;  2R5Z B;  2XPV A;  3MLF A;  5EYR A;  4X6A J;  3A02 A;  2NS8 A;  4FCY A;  2VKV A;  1XG1 A;  4PU8 A;  2LYL A;  2LKX A;  2EBY A;  3HDD A;  1ITY A;  5IYD J;  4X4C A;  2D5V A;  3CCY A;  3UKG A;  5J1Y A;  4LOC A;  5EGO B;  3CQZ J;  3FIW A;  3BR6 A;  1H88 C;  1MBH A;  2JA8 J;  2WAQ N;  2JCG A;  3RZO J;  1FEX A;  1JUS A;  4Z5H A;  2MSY A;  2XB5 A;  2DMQ A;  1ETY A;  2NVT J;  4JCX A;  1ZQ3 P;  1DU6 A;  3GN5 A;  3S16 J;  4JX4 A;  1AKH A;  3ZHI A;  5C3E J;  2PUG A;  3O8G A;  3G7D A;  2DN0 A;  4B4C A;  2L7Z A;  3RQI A;  1EFA A;  3K7A J;  4M3F A;  3TRB A;  2KDZ A;  2LFB A;  4S0H B;  1EF4 A;  4GFB A;  1WIZ A;  2L49 A;  2DA3 A;  4CYC A;  2LYK A;  2PUD A;  2X9D A;  1GDT A;  3TW6 A;  4MCX A;  2JA6 J;  2VI6 A;  2EF8 A;  1IC8 A;  4RBO A;  2JK3 A;  3GTL J;  1ENH A;  3O9X A;  2YU9 J;  5F0C A;  4Y42 A;  3RZD J;  1QPI A;  4B3A A;  2KEI A;  3BR2 A;  4J1X A;  1POG A;  4DYR A;  2NVQ J;  3LSJ A;  3GN5 B;  3Q0U A;  4M3B A;  3R1F A;  5M3M J;  3ZQC A;  1W0T A;  4O8B A;  2IVG A;  2LCV A;  2XPU A;  4GHJ A;  1QRY A;  5EZG A;  2OPT A;  2LYJ A;  2EBI A;  4XK4 A;  2GM4 A;  2NVY J;  3FYA A;  1IV6 A;  2OF7 A;  4CYC B;  4XID A;  2HOA A;  1MBF A;  3E7L A;  4IVZ A;  4X4E A;  2ZB9 A;  1H89 C;  2PMZ N;  2M0C A;  3S8Q A;  1I3Q J;  1BDI A;  3IH3 A;  3IH4 A;  5M5W J;  1IDZ A;  4I6U A;  3B6A A;  2JJ7 A;  3DNV B;  1WGX A;  2TCT A;  4JP0 A;  1UXC A;  1RKT A;  1FTT A;  2X48 A;  1DWK A;  2B5A A;  2DA5 A;  2PUB A;  1JJ6 C;  4IHX A;  2AHQ A;  3ZQI A;  3U3W A;  3JRH A;  1YSE A;  3OIO A;  1JTX A;  1JKO C;  1PER L;  4GQM A;  2A6C A;  1U9O A;  2FJ1 A;  2XB0 X;  3H3V K;  2MEZ A;  3H0G J;  3VPR A;  3QYX A;  3BS3 A;  3M3Y J;  4XRM A;  1VPW A;  3ZOB A;  3KJX A;  2CQQ A;  2R0Q C;  1ZZ7 A;  2LVS A;  2X6O A;  2IVQ A;  4BBS J;  2XSD C;  5C44 J;  2M9H A;  2DA6 A;  4D7M A;  1ZPQ A;  4FTH A;  2Y9Z A;  3HOW J;  2ELK A;  4AYB N;  3BR0 A;  5DS9 A;  2Y31 A;  1X2L A;  1OSL A;  4XIC A;  2O7O A;  3S17 J;  1HF0 A;  2JA5 J;  2HXI A;  4X4B A;  3OQO A;  1ETQ A;  1NTC A;  4DW6 A;  1H8A C;  2YUS A;  2R93 J;  5DTD A;  4Z58 A;  2L0K A;  2LY9 A;  1I6H J;  3W6V A;  3JRD A;  4X4G A;  1R69 A;  2EZK A;  1JH9 A;  2W48 A;  5GP9 A;  2JMW A;  4A69 C;  4IA8 A;  4X4H A;  2VKE A;  5JLX A;  1FJL A;  2HOT A;  1JUP A;  2AO9 A;  1LE8 A;  3G1M A;  3HOU J;  1ZAY A;  4D7N A;  2L7M P;  2IVB A;  3A03 A;  5EG0 A;  2XGD A;  3HOX J;  1MH3 A;  3O8H A;  1ADR A;  3CRO L;  4A3D J;  1WPK A;  1S7E A;  2EZI A;  1JFT A;  1T33 A;  1PUF A;  2KT0 A;  1QQB A;  2ME0 A;  1YRN A;  1JJ8 C;  3UFD A;  2WV1 A;  4PU4 C;  2MW8 A;  3PO3 J;  1RR7 A;  4V2F A;  5J3L A;  4BY7 J;  2BNN A;  5EZH A;  3GBF A;  2O8K A;  2CQX A;  3BQZ A;  5E3L A;  1FTZ A;  2AXU A;  1QVU A;  4V2G A;  5E3N A;  3JXB C;  3IVP A;  1JKQ C;  4YG4 A;  2DA2 A;  1LMB 3;  2EH3 A;  2NVX J;  1ETW A;  3SDG A;  4AC0 A;  1ZZ8 A;  1ZZB A;  4EEF G;  1LE8 B;  3A01 A;  4Z5D A;  1MBG A;  1IUF A;  2HXO A;  2ECB A;  5GPC A;  2TRT A;  1LFB A;  5EG0 B;  2K9N A;  1BA5 A;  1A6I A;  3LIS A;  3BG9 A;  1ZR2 A;  2AUW A;  2Y0S N;  3LOC A;  3FYM A;  5GPA A;  1RKW A;  2H8R A;  1IRZ A;  4RDU A;  4Y52 J;  3ZQH A;  3OOU A;  5F04 A;  1RET A;  3HEF A;  4M3G A;  2DMP A;  3GTQ J;  2XCJ A;  4I6Z A;  1BW5 A;  1YRN B;  2XIU A;  3QWG A;  2R1J L;  4I6T A;  2JVL A;  1G2H A;  4F8D A;  2N8G A;  3GBG A;  2XJ3 A;  2CUE A;  1ETV A;  2E1O A;  4QIW N;  3MKL A;  2FD5 A;  2LTP A;  1DU0 A;  4JYK A;  4W97 A;  4Z5C A;  3Q0V A;  1BJZ A;  5FKO A;  5F08 A;  2FQ4 A;  1TWC J;  1PRU A;  2M8G X;  2HOS A;  2O9L A;  3A01 B;  3H5T A;  2EQR A;  4QSH A;  5FKK A;  4AUX A;  1QP4 A;  4A3G J;  1A5J A;  4BY1 J;  3ZKC A;  1AKH B;  3TW7 A;  2P81 A;  2MGQ A;  5IOZ A;  1Y1V J;  3TP3 A;  3HOZ J;  3M4O J;  1UXD A;  2CU7 A;  2K9S A;  3QQ6 A;  1P7J A;  1IDY A;  4Y7N J;  4C3I J;  3MVP A;  3SFI A;  4FE7 A;  1R9T J;  4MO7 A;  3S2H J;  4PU3 C;  1WH7 A;  3HGG A;  3GTO J;  5F27 A;  2VUM J;  1RIO A;  2CUF A;  2LLK A;  5IP9 J;  1GT0 C;  2AW6 A;  3HZI B;  4JX5 A;  3BG5 A;  2BJC A;  1WCM J;  5K98 B;  1O4X A;  2QCO A;  2KZ8 A;  3HBL A;  1XS9 A;  2BNM A;  2FJR A;  1UTX A;  2L7F P;  2AXZ A;  4M6V A;  3ZQG A;  4DYC A;  2ICT A;  1TC3 C;  5FLV A;  3RZZ A;  1Z0X A;  4C2M J;  5F1J A;  3OQM A;  2CJJ A;  1QVT A;  3JRI A;  2M34 A;  2KPJ A;  2IV1 A;  3JRE A;  2R63 A;  1ZTR A;  2H1K A;  4X4I A;  2R7Z J;  1LLI A;  2K40 A;  1B8I A;  3S1M J;  4A3L J;  2PPX A;  1MSF C;  3GTP J;  4A3E J;  1Z77 A;  3S1Q J;  1JUM A;  3QQA A;  3OSG A;  1OCT C;  1LFU P;  1CJG A;  4BKX A;  1IG7 A;  3HGY A;  3G5G A;  3BQY A;  5M5X J;  2EZL A;  2L9R A;  1RZR D;  2COB A;  2E2J J;  1SQ8 A;  4A3F J;  3F51 A;  5J1U A;  2IU7 A;  2DMU A;  1XC5 A;  1MBK A;  1B72 A;  3HOV J;  1LCC A;  3G1O A;  2HSG A;  4YG7 B;  1P7I A;  4X1E A;  1FIP A;  3FIS A;  3LFP A;  1HDP A;  2PUC A;  4D5C A;  3S2D J;  1Y7Y A;  1SFO J;  4IHV A;  4YAR A;  2PUA A;  2OR1 L;  4A3K J;  3IV5 A;  1B8I B;  2CRO A;  1ZR4 A;  4A3J J;  4HNV A;  4MLO A;  1JT6 A;  1JGG A;  4A3C J;  4UUT A;  1WH8 A;  1E3O C;  5JLW A;  3CLC A;  3WHB A;  3F6W A;  3ZQL A;  4UUS A;  1QPZ A;  3BR3 A;  4NDL A;  3TP0 A;  1ORK A;  1VF9 A;  1IJW C;  3JXD L;  3MN2 A;  3I4M J;  2Y30 A;  3BTC A;  3EUS A;  1WET A;  1PRA A;  1ZKG A;  1ZZ6 A;  1OJL A;  1AHD P;  4G12 A;  1B72 B;  1MNM C;  3PXP A;  3OMT A;  4IWR A;  3S14 J;  2IAI A;  1TWA J;  2HQ5 A;  2YS9 A;  3SCF A;  1APL C;  1BDH A;  1ZZ9 A;  2XI8 A;  1HLV A;  1IGN A;  1POU A;  1OCP A;  1U9N A;  2DMT A;  2RAE A;  1BL0 A;  2Y2Z A;  5IYB J;  1TWG J;  2GRL A;  1FIA A;  1GV2 A;  1NK2 P;  4A3B J;  2LK2 A;  3QPS A;  3LSG A;  3F0C A;  1PRV A;  3B6C A;  2AXV A;  2LP0 A;  1NK3 P;  2XPW A;  4A3M J;  5BNG A;  3FK6 A;  1UMQ A;  1PUF B;  3GTM J;  5FKL A;  4UUS B;  1U78 A;  1JKP C;  4FIS A;  1HDD C;  3OQN A;  3SCG A;  1RPE L;  2K9Q A;  4QTR A;  3LNQ A;  2IUO A;  1LCD A;  1NEQ A;  1U8B A;  4L5E A;  3SCH A;  3JRC A;  3HKZ N;  4M3E A;  3S15 J;  2EZH A;  3PM1 A;  5IPA A;  1ETO A;  4IHY A;  1ETK A;  1OFC X;  4DZP A;  1X2N A;  2IBD A;  4B1R A;  1ZGW A;  1JWL A;  1QP0 A;  1ZZC A;  1WH6 A;  4I8T A;  3FK7 A;  3JRG A;  2WB1 N;  1WI3 A;  1MH4 A;  4XRS A;  3C2B A;  5EDN A;  2PIJ A;  4MCT A;  1X2M A;  2AWI A;  1ETX A;  1DW9 A;  4C3H J;  3BD1 A;  2GBY A;  5F0H A;  4JQD A;  3I4N J;  2O38 A;  2CRG A;  2MQK A;  4I6R A;  4JCY A;  3JRF A;  1NER A;  3L1P A;  3LSR A;  1HOM A;  3S1N J;  5M5Y J;  1AU7 A;  1JFS A;  1GUU A;  3QF3 A;  1ZVV A;  2GLO A;  2O4A A;  2XRL A;  3F52 A;  3RKQ A;  3KXA A;  4A93 J;  4DYQ A;  2LYP A;  4J19 A;  2I10 A;  3ZQF A;  1RPW A;  4W1U A;  1JKR C;  2R5Y A;  3B7H A;  3BT9 A;  1K61 A;  1ZS4 A;  4C3J J;  3OP9 A;  3K2A A;  3OSF A;  2KEJ A;  4OB4 A;  2DJN A;  2L8N A;  1QP7 A;  3SJM A;  2E2I J;  2LYQ A;  1VI0 A;  2R92 J;  2KEK A;  5J1R A;  2LD5 A;  5IYC J;  4XRS G;  3GTJ J;  1QQA A;  3BDN A;  2DA4 A;  2JA7 J;  2OFY A;  1VND A;  2QF7 A;  4D5F A;  5IOY A;  2GZU A;  2ICP A;  4PU7 A;  1UHS A;  3GTG J;  3JRA A;  1F36 A;  1RZS A;  1TWF J;  4IHW A;  3BG3 A;  2DMN A;  3WHC A;  2B63 J;  1F43 A;  5A7L A;  3VK0 A;  2PUF A;  2WIU B;  1JTY A;  1RZR A;  1L1M A;  1ZK8 A;  4FN3 A;  4MFE A;  3QPL A;  1CQT A;  1GV5 A;  2IEK A;  1MSE C;  1XWR A;  3IH2 A;  2EWT A;  4YG1 A;  3D1N I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...