1E3OC

Crystal structure of oct-1 pou dimer bound to more
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
160
structure length
132
Chain Sequence
EEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMSKLKPLLEKWLNDAEKRTSIETNIRVALEKSFMENQKPTSEDITLIAEQLNMEKEVIRVWFSNRRQKEKRIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*TP*GP*CP*AP*TP*GP*AP*GP*GP*A)-3'
publication title Differential Dimer Activities of the Transcription Factor Oct-1 by DNA-Induced Interface Swapping
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 44
structure length 132
sequence length 160
ec nomenclature
pdb deposition date 2000-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00046 Homeodomain Homeodomain
C PF00157 Pou Pou domain - N-terminal to homeobox domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1e3oC02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1e3oC01
2NOGA 4FN3A 2AWIA 3BR2A 2AXVA 5EGOB 1ETVA 3VPRA 1TWAJ 1NTCA 2LKXA 2YS9A 4JX4A 5EDNA 3S1NJ 2EBIA 1QVTA 1Y1VJ 4B4CA 2IU7A 2AW6A 1PUFB 1ITYA 1YRNA 3JXCL 3ZQLA 1HOMA 2AXZA 3CMYA 2XPUA 2XGDA 3B6CA 4F8DA 2GLOA 3O9XA 2NVYJ 1ZZ8A 3RZDJ 2HOSA 2CUEA 3JRGA 1FTTA 1LFUP 4XIDA 1IUFA 1TWGJ 1YSEA 3NARA 3Q0VA 1OCPA 4PU3C 3JRIA 3M3YJ 3ZOBA 1BDHA 2MG4A 4AC0A 3B7HA 1XG1A 5M5WJ 2DA1A 3JRAA 3HM5A 2KDZA 2CUFA 1GUUA 2HOAA 4BBRJ 5DS9A 1B8IB 1ETKA 1QRYA 5J1YA 3G7DA 3NAUA 1H88C 2R5YB 1MBJA 1RR7A 1TWFJ 1ZZ9A 3FYMA 3KZ3A 4Y52J 2LLKA 5GP9A 1T33A 3E7LA 4IEJA 5FLVA 1Y1WJ 3JRBA 3I4MJ 5IP9J 3BR3A 2LYKA 3LFPA 3H3VK 2ID6A 5EYRA 3FK6A 2EZLA 5EG0A 5FKLA 3OMTA 2L9RA 3Q3SA 2M2EA 3JR9A 3UFDA 3BDNA 3SCFA 1ETWA 1MH4A 4O8BA 2EWTA 4FE4A 2IVQA 3O8GA 1XWRA 3GTKJ 1X2NA 4RBOA 1WH7A 1NK2P 1ZTRA 5E3MA 4PU7A 2ECCA 4IHYA 5GPCA 1I6HJ 1ZS4A 2IVGA 2EQRA 3HOXJ 1JJ8C 2DN0A 5K98B 2VUMJ 1FTZA 4M3EA 2EF8A 3H5TA 1APLC 4JCXA 3OQOA 1PRVA 3QWGA 3A01A 3PXPA 3VK0A 3SCGA 2H1KA 1OCTC 3TP0A 2DA3A 2XB5A 4DYQA 4HNVA 3EUSA 5J3LA 3FYAA 2L49A 2DMUA 1RKTA 1BW6A 3GTGJ 2CRGA 2DA7A 2XPWA 3GTPJ 2M34A 5E3LA 1NERA 1WIZA 3LSRA 2R63A 4UUSA 1S7EA 2NS8A 3BTIA 1FIAA 4X4EA 3OQNA 1WI3A 2CU7A 2E2HJ 1LFBA 2XGEA 4B1RA 1OFCX 2XIUA 2W48A 1EF4A 3C2BA 1ZUGA 2DMTA 2NVXJ 3HOWJ 3S17J 5M3MJ 2QF7A 2KEKA 1L1MA 4A3JJ 1JKQC 4V2FA 3JRDA 1IV6A 3HEFA 1ZPQA 1RESA 1WCMJ 2R5ZB 1JKRC 4D7NA 1ORKA 1VPWA 3Q0UA 1QVUA 1ADRA 4AYBN 3BR6A 4A3LJ 2K9SA 4IHVA 1XS9A 3GN5B 2M9HA 3S8QA 2JCGA 2XCJA 4Y42A 2JK3A 4YBAA 2PUAA 9ANTA 4NDLA 1PRAA 4Z58A 1BDIA 3CLCA 2YUSA 3KJXA 2PUDA 5HODA 1WH8A 4YG1A 5IYCJ 1YRNB 1WGXA 1RKWA 1VF9A 1AKHA 2WB1N 1UHSA 1QPIA 4V2GA 1WPKA 2HXOA 3IH2A 4DZJA 4YARA 2PUCA 4IA8A 1Z77A 4FCYA 3JRFA 1T56A 3LSGA 4LOCA 1PNRA 3FISA 3FIWA 2IEKA 4A3EJ 3FMYA 3QQ6A 4ABZA 1B0NA 1JFTA 4IWRA 3PM1A 2EZKA 3S1MJ 2JWTA 2DMNA 3OOUA 1W0UA 1ETQA 2K9NA 2VKEA 1JKPC 1MNMC 1IGNA 4M3FA 5C44J 1MSFC 5K7HA 3SDGA 3UKGA 2HSGA 2Y2ZA 4DYCA 1POUA 2E2JJ 5J1UA 1RPWA 2LR8A 4MFEA 1VNDA 5FKMA 4C3IJ 2XSDC 1SFOJ 3GTQJ 2MQKA 2DA2A 2PUEA 4S0HB 1LQCA 1GV2A 3BT9A 3RZOJ 4X6AJ 3G5GA 2PUFA 4GQMA 2D5VA 4NDWA 3HB9A 2PUGA 4OB4A 3O8HA 2Y30A 3HOUJ 1GVDA 1U9NA 2R93J 1RZRD 3BR1A 1JWLA 2DMQA 3IH3A 3F0CA 5IOZA 5EEAA 2LYRA 1R9TJ 4L5EA 3BTCA 3LSPA 5FKKA 2R7ZJ 2R1JL 1JJ6C 5EG0B 2LYSA 1MBGA 2OF7A 3GBFA 2JA5J 2K40A 2ICTA 1K83J 2E19A 2WIUB 2LK2A 2IVBA 2IV1A 4MIMA 2KEJA 3CQZJ 3Q0WA 1NK3P 3ZQHA 2B5AA 2FJRA 2JVLA 4J1XA 2KZ8A 2LFBA 2VI6A 5BNGA 1ZKGA 3WHBA 1R63A 1DW9A 2MSYA 3OSFA 1VI0A 1IDYA 4M3DA 2JJ7A 1X2LA 2PMZN 3MN2A 3MLFA 2L7MP 3A01B 3QQAA 4J19A 3FKIJ 2KPJA 1H89C 1GT0C 3LISA 2JA8J 5K7ZA 1JTXA 1EFAA 3K7AJ 2I10A 4JQDA 2X6OA 4XRMA 2EZIA 2LTPA 2M0CA 3QPSA 4I6ZA 3M4OJ 4UUSB 2OPTA 1IG7A 2N8GA 2XJ3A 4B3AA 5IPAA 1DU0A 3BTJA 3LOCA 1ZR4A 1H8AC 1BL0A 2CJJA 1GDTA 3F52A 4A69C 5A7LA 2AO9A 2BNOA 1XC5A 4C2MJ 5M5XJ 4I6RA 3PO2J 3TP3A 2LCVA 4X4BA 4QIWN 1ZR2A 1LCDA 2R92J 4QSHA 3OSGA 2GRMA 2XPVA 5F0HA 4CYCA 1HLVA 2LYJA 2XI8A 2ID3A 1ZZ7A 5K7FA 3K2AA 2LYPA 1Y9QA 1IRZA 2XGCA 2E1OA 4JYKA 2JA6J 2PIJA 2LYLA 2BJCA 1DWKA 1RZSA 1DU6A 2MGQA 1MBKA 3DEWA 4Y7NJ 4MLOA 1RZRA 2Y0SN 3HOVJ 2LD5A 2GBYA 4C3HJ 1ZZCA 3RKQA 2K9QA 4DYRA 2DA6A 2HI3A 4A3DJ 2PPXA 3CROL 1ZGWA 3PO3J 4D7MA 2KEIA 4MCXA 4RDUA 2IAIA 3ZQCA 1ZZ6A 1AKHB 1WH6A 4BY1J 2WUSR 4M3GA 4X4GA 3D1NI 1QP4A 3HOZJ 2AUWA 3HZIB 2NVQJ 3DNVB 3HGYA 5IOYA 5FKNA 3HBLA 1Y7YA 3IVPA 2ECBA 2Y31A 5F0FA 1JGGA 3S2DJ 1ZQ3P 1LLIA 2P81A 1I3QJ 2VPRA 1JUSA 5EZHA 1ZVVA 2Y9ZA 3WHCA 2DTZA 1ZZBA 2MEZA 1MH3A 2M8GX 2TCTA 4YG7B 2JA7J 1UXCA 4X4FA 1BJZA 3QYXA 2JN6A 4XRSG 1E3OC 4A3IJ 3SFIA 3ZKCA 1JUPA 1F43A 1IDZA 1U78A 2O38A 4X4DA 1OSLA 2L7FP 4FBIA 2VKVA 4FISA 1FEXA 3G1MA 1B72B 4IVZA 1UG2A 1R69A 2AXUA 2O8KA 3JRCA 3RZZA 3I4NJ 2LVSA 2L7ZA 1HCRA 5IP7J 1IC8A 4G12A 2BNMA 3ZHIA 3GTOJ 2GZUA 1JUMA 5IYDJ 5C4JJ 4IHXA 5EZGA 3HOYJ 4J1WA 2AHQA 1MBEA 1U8BA 1LE8A 4Z5HA 3SJMA 1HF0A 3CDLA 3BR0A 2NVTJ 2O49A 2EBYA 2WV1A 2G0EA 3HKZN 2KT0A 1B72A 4GFBA 3CCYA 4X4IA 3JRHA 2DA4A 2H8RA 3ZQGA 1ZK8A 1PRUA 3L1PA 3S15J 4MFDA 4XRSA 2HOTA 1WETA 3LNQA 1HDDC 5F04A 5C4XJ 3OP9A 5JLXA 3JXBC 2COBA 3F51A 2XB0X 1ETOA 5F0CA 2A6CA 1PERL 2GM4A 3LSJA 3JREA 2LYQA 4A3GJ 3BG9A 4XICA 2O7OA 5EGOA 3ZHMA 1F36A 3IV5A 1I50J 3BG5A 2ME6A 3SCHA 5F08A 2OR1L 1PUFA 2WAQN 3FK7A 1JT0A 4YG4A 4I8TA 5E3OA 1X57A 2O9LA 4I76A 1FJLA 2JMWA 4JCYA 4A3FJ 5F27A 1ZAYA 1TC3C 1MBHA 1POGA 5JLWA 4QTRA 4MCTA 5J1RA 4IHWA 4Z5DA 3QF3A 1Z0XA 3S2HJ 2DA5A 2PUBA 4CYCB 3TW6A 2Y9YA 2ZB9A 2EZHA 1HDPA 1X58A 3HDDA 1UXDA 3BTLA 1RIOA 4FE7A 2IUOA 2HXIA 1CJGA 4BXXJ 1X2MA 1P7IA 5M5YJ 3TEDA 2FQ4A 3JXDL 4AUXA 2CQXA 3BQZA 4X4CA 1QP7A 3GTMJ 2R0QC 1AU7A 1QQBA 1B8IA 4PU8A 1RETA 2CROA 3CECA 3G1LA 3IH4A 2R5YA 1U9OA 2FJ1A 3GTJJ 5M3FJ 5IP6A 1MBFA 4W97A 4A3BJ 1W0TA 2GRLA 1GV5A 3S1RJ 1MSEC 3RQIA 1SANA 1Q1VA 2DMPA 4DZPA 2HQ5A 1O4XA 1LCCA 3TRBA 3QPLA 5FJ8J 4BKXA 3ZQFA 2HINA 2L0KA 1JFSA 4BY7J 1QP0A 1TWHJ 1AHDP 1ENHA 4JP0A 2LP0A 4M3BA 3OQMA 3A03A 4MO7A 3OIOA 2ICPA 5FKOA 1ETYA 1JT6A 2QCOA 4UUTA 2FX0A 3BQYA 1FIPA 2XRLA 3BS3A 3S1QJ 4A3MJ 4FTHA 3ZQIA 1JKOC 5E3NA 1A5JA 2X9DA 2DJNA 3BG3A 3HGGA 5FLMJ 1VFCA 2PE5A 2HYJA 1IJWC 3R1FA 2FD5A 4M6VA 4JX5A 4EEFG 4A3KJ 2E2IJ 4JX6A 3S14J 2ELKA 2CQQA 2CSFA 2BNNA 2X48A 3W6VA 2MW8A 3GBGA 2OFYA 5GPAA 1A6IA 3TW7A 5C3EJ 1K61A 4Z5CA 3GTLJ 2LY9A 2EH3A 1RPEL 4D5FA 1NEQA 1WH5A 4C3JJ 5DTDA 1JTYA 3S16J 3MKLA 1BW5A 4GHJA 4A93J 1G2HA 4I6TA 4PU4C 3DCFA 3U3WA 4Z59A 3BR5A 4W1UA 2ME0A 2TRTA 2NS7A 1UTXA 2RAEA 4D5CA 1LE8B 2YU9J 3B6AA 2IBDA 4BBSJ 1TWCJ 4XK4A 4X4HA 5EF6A 2O4AA 1D5YA 4A3CJ 1QQAA 4DW6A 1QPZA 1SQ8A 1OJLA 1UMQA 3MVPA 1P7JA 1LMB3 2R5ZA 5IYBJ 3KXAA 1JH9A 1BA5A 3BD1A 1CQTA 3A02A 3G1OA 2L8NA 4I6UA 2B63J 3F6WA 1ETXA 3H0GJ 4X1EA 3GN5A 5F1JA 2HDDA
chains in the Genus database with same CATH superfamily
3DTKA 2EFNA 4FN3A 1IO2A 4BDZA 5EGOB 5HLGA 3VPRA 1BR2A 1NTCA 2E60A 3RTRA 3LAPA 3S1NJ 2EBIA 5JHUA 5JR3A 3FXQA 4PUSA 4UXNA 2V1XA 1UELB 2EV0A 3JXCL 1HOMA 2AXZA 2D1HA 2XPUA 1O3TA 2XAHA 2FA5A 2F48A 2GIVA 4B3XA 1JHHA 3B6CA 5HNFA 4F8DA 4QWQA 2KIMA 2NVYJ 2HOSA 1FTTA 4BHCA 2M4GA 1HQ1A 4UVBA 3T8TA 3S32A 2DW4A 2X51A 2FBKA 5FLXZ 1BDHA 4LK0F 3R0JA 1WJFA 1XG1A 1Y8QB 5M5WJ 4EJTA 3JRAA 3HM5A 3BCAA 2KDZA 1IXSB 4EKIA 1GUUA 3A1YA 4BBRJ 1B8IB 1YJ9I 5J1YA 4RS8A 4RAZA 4UB6C 2R5YB 1MBJA 2DI3A 3CO7C 1TWFJ 1ZZ9A 3H3ZA 1TBXA 2OZUA 2ZBKA 3FYMA 3KZ3A 4WF2A 1N77A 1G8XA 4ER3A 1HSTA 3E7LA 4IEJA 1IF1A 2ESNA 1UG0A 5IP9J 3BR3A 1DGRM 2ID6A 1SMTA 4MQ9F 4ZDLA 3TGNA 1W1WE 3FK6A 2EZLA 3OMTA 2KRHA 3I9V2 4ZH4F 2M2EA 3JR9A 1P4XA 3GXOA 4FX0A 5JHFA 1MH4A 3UFDA 1WJEA 3KYDB 4O8BA 2R7TA 4G9YA 4UV8A 2IVQA 4BJ5C 2XKPA 5E3MA 3CUQB 4IHYA 2ELHA 5HS8A 4N9IA 4PJ0C 1YTYA 4EGYA 4BQAA 2J7WA 5K98B 2VUMJ 3H5TA 4JCXA 2PXFA 4HNUA 3RKWA 4XORA 3BROA 4MTEA 2LBFA 2H1KA 5FD6A 3RJPA 3TP0A 3BJOA 1K7AA 3HHGA 3JW4A 1X1PA 4J01A 2CRGA 3O3KA 4WK8F 1LJ9A 3E6MA 4M9SA 2M34A 5E3LA 5J8CA 3LSRA 4EM1A 3N97A 2STWA 2NS8A 3CP8A 2DYRH 3OYCA 3OQNA 3PNYA 2CU7A 1H9TA 3E6CC 4HF2A 5HLIA 3GEZA 4B1RA 1OFCX 3LWFA 4G6TB 2W48A 1EF4A 3C2BA 2BZTA 2NNYA 3HOWJ 4JQFA 5AIPA 4H4KC 3CUOA 3M7GA 5A2QK 3SXYA 3JRDA 1F4KA 2IA1A 3D5LA 5DD4A 4LG3A 4O3MA 4BAYA 4R79A 3MZYA 4PFPA 3Q0UA 2P7VB 1XX5A 4A5MA 1ADRA 2E36A 1KONA 3PNTA 3WE2A 1KZHA 4IPAA 4KIFA 4BYYA 3GN5B 3S8QA 1WQ2A 2RKHA 4YBAA 1BC7C 9ANTA 4NDLA 1WJBA 4EGZA 2LOOA 1KA8A 2L9NA 2Z3YA 3L9FA 4AIKA 4Z58A 1R71A 2ZC2A 5L3BA 5HODA 2R7RA 2Z1DA 1PYVA 1T98A 1YRNB 2L2OA 2KZVA 2W1OA 1AKHA 1QPIA 2KISA 2IA2A 4YARA 1QHHD 2AXLA 3ZR8X 1N25A 1YX5A 4DJAA 4IA8A 3QYFA 2OV7A 4N4OB 1U0JA 3OYEA 3LSHA 2ZXHA 4IRHA 4ZYAA 2CV0A 2IGMA 3OOUA 3F8FA 5D6FA 1W0UA 2BVLA 2VEOA 1JKPC 1J59A 1IGNA 5C44J 5IY5H 1KU7A 1U5TB 1VTNC 1POUA 5J40A 1MMSA 1LFPA 3QWLA 4BGDA 2CH0A 5J1UA 1QBJA 2RC4A 1ODDA 2P5VA 2FQ3A 4DOZA 2AXTC 4X6AJ 4YFKF 2PUFA 1Z05A 2IS1A 3O8HA 5GAHi 2Y30A 1RZRD 3NQOA 4XN0A 1BI3A 1PJRA 2G9WA 3IH3A 5H6QA 1A31A 1B59A 4NHJA 3WE3A 3RKYA 3LSPA 1O57A 2R1JL 3HHHA 1JJ6C 3DQVC 2AS5F 2K40A 2L4MA 2ICTA 1K83J 5ICFA 2LK2A 2IVBA 3TL4X 2M30A 4N9HA 3OYIA 2RGVA 2JVLA 5TISC 3MKYB 1MMNA 3MQ0A 3OSFA 5D4SA 1UZCA 1Z67A 4M3DA 3GZNB 5DM6F 1X2LA 5K5OA 1P92A 3KLOA 3E3VA 4N0BA 4ZC3A 3I53A 4J19A 5FO5A 2COMA 4QPQA 1SVOA 1JTXA 1VQLI 5DTRA 2Z33A 2PJRA 2W24A 3S2WA 2EZIA 3QPSA 1GHCA 3M4OJ 4LITA 5CVRA 2OPTA 1Z1DA 4B3AA 4CCKA 5IPAA 3BTJA 1ZR4A 4M6XA 2CUZA 2DK8A 1Z21A 1GDTA 1CGPA 2HVRA 1XC5A 4C2MJ 5M5XJ 3PO2J 3FMSA 3TP3A 2AQFA 5E8GA 5BQTA 2LCVA 3FHNA 3GZDA 2W85A 1Y0UA 4GO1A 1GXQA 2XI8A 3K2AA 3QFIA 1G3WA 4KN4X 2V9KA 4JYKA 2X1DA 3F8BA 2GXBA 3DEWA 1MBKA 5FFXA 1DU6A 3CDIA 1VQ9I 3HOVJ 4C3HJ 2EINH 3ASOH 2F5EA 2K9QA 2DOEA 3C1DA 2DA6A 4A3DJ 1U3EM 3GO5A 1R7JA 4D7MA 1YS7A 2HGCA 3F8CA 1KYZA 3S8PA 3HZIB 1YW9A 2W82A 2NVQJ 5IOYA 1EKEA 5FKNA 3HBLA 2RN7A 4XMYA 5B1BH 1OCCH 3I59A 3I4PA 4Y3OA 1ZQ3P 2JTVA 2P81A 5KCMA 4ER6A 2IXSA 3GYHX 3M9AA 2ZJRF 2DTZA 1J75A 3VYTB 1J5YA 2PG4A 1R4MB 3W2AA 4P55A 2ZXWH 4EJOA 3AKZA 4BDYA 2H6BA 2PXPA 4MNUA 4A12A 2QWWA 4XRSG 1IAWA 3FHZA 2DFHA 3SFIA 1F43A 1IDZA 1RUNA 4GCVA 2XF7A 1OCRH 2IPQX 1A36A 5DT2A 2CQKA 4LLGF 1FNNA 4FASD 3I64A 2Y69H 1X1DA 2VODA 4IO9F 5DD8A 1NW3A 2A6EF 2LVSA 3BP8A 2ZFUA 4XLEA 4AD9A 5IP7J 3CJNA 3ZHIA 5JUWA 1OR7A 3KP2A 5IYDJ 5EZGA 2GXGA 4A0YA 4Q48A 2OUMA 1U8BA 1LE8A 2DT6A 4DNCA 3SJMA 3F22A 4A6EA 2DQRA 3GF2A 3CJRB 1G59A 1LKXA 2O49A 2KT0A 3WTTC 1DQUA 1ON2A 1Y6IA 1VQ7I 2DA4A 2RQQA 1TL8A 3L1PA 2KIUA 1FOXA 2PXVA 5DCMB 3OP9A 5C4XJ 3JXBC 3BY6A 3F6VA 3LA3A 5F0CA 2A6CA 2VBYA 2K5CA 4HZFA 2GM4A 3JREA 3BG9A 4LK1F 1VQKI 3ERMA 2IGOA 1BI2A 1F36A 3BG5A 2YX7A 2ME6A 3I55I 1MNEA 2V1NA 1PUFA 2JSPA 1BR4A 3WGIA 2OR1L 1JT0A 4XM3A 5E3OA 1X57A 4FQGA 1FJLA 4RGUA 2JMWA 1Z3XA 3KIOA 3ZCOA 1ZAYA 3WU0A 2IS2A 3K69A 2F2EA 5LRRA 2LY1A 3KPHA 4IHWA 4LLNA 3VSKA 1Z0XA 4HNTA 3FXLA 2X6XA 2W84A 1Z6RA 2JUGA 2VBWA 2X1CA 4I09A 5CVUA 2Y9YA 2ZB9A 3QU6A 3CCLI 3F6OA 3C3WA 4L9VA 4RM3A 1J2XA 4NNJA 2QQAA 5E1XA 5M5YJ 3TEDA 2RNGA 3BPVA 4U0WA 3JXDL 5KVRA 3ABKH 3ONQA 5E1WA 1Y8RB 1RETA 2EWNA 1EA3A 4HPQA 3OS0A 3GTJJ 3H0DA 5M3FJ 5HNHA 3V7CA 5IP6A 1MBFA 1CF7B 1FT9A 3SDBA 2JSCA 5LHHA 4OBMA 2P5LC 5LGTA 1MSEC 1SANA 1Q1VA 4DZPA 2KFDA 2DCEA 1O4XA 5L3FA 2EIJH 2VASA 2OZ6A 3ZQFA 4BKXA 2L0KA 4BY7J 1ONVA 1YJWI 5D8LB 3OQMA 2LP0A 4HSRA 3A03A 4IZZA 1ZYRF 2K4BA 4G6DA 1UCRA 5FKOA 2XAJA 2ICWG 2ICPA 4UUTA 5FB2A 1SVLA 3JSOA 1CF7A 1F5TA 4A3MJ 5D5VB 1X19A 3ZQIA 1A5JA 5IT9Z 3BLYA 5LEJA 1HKQA 1VFCA 1GXPA 1UAAA 4X0GA 2HYJA 4LMYA 2R7XA 1QGPA 4JX6A 2XROA 2F6CA 3W6VA 1O3RA 1DPRA 2BVMA 5HS9A 4Z5CA 4C2TA 2XRNA 4D5FA 1NEQA 3VFZA 4C3JJ 1JTYA 3HUGB 2NNNA 1BW5A 1G2HA 1I3AA 1VQ5I 3OYDA 4HLYA 1KU9A 4Z59A 3BR5A 1T8IA 2QSFX 4NC8A 2NS7A 4M6YA 2YU9J 4D5CA 4PJNA 4ESFA 1VQ8I 3PUBA 1WKMA 1JHFA 1QPMA 3RQ4A 3M8JA 1IN5A 1QQIA 1D5YA 3OS1A 4A3CJ 1QQAA 4DW6A 3JAMK 3IP4B 4XR6A 4ZTFA 3HYIA 1MZBA 1UMQA 3KZIC 2FNPA 4XLCA 2BBYA 1P7JA 4MHGA 1LMB3 3CC2I 2KPMA 2JQ7A 2OQGA 2LC2A 4GYIA 3K1PA 2UWMA 2HVSA 2OA4A 3F6WA 2NAZA 4KUMA 5E1ZB 4X1EA 4WXHA 2GXAA 2W57A 5F1JA 3LAJA 1R22A 3AL0B 4IF4A 4KNYA 2AXVA 1GVJA 2PBIA 2YS9A 4JX4A 3CJTB 5EDNA 1QVTA 4XONA 1ZLJA 3RIRA 1ITYA 3PSIA 5HS7A 2BOLA 4XBFA 3WTXC 1G6NA 2XGDA 1MD0A 4EM0B 1LDDA 2X1EA 4I7HA 4F92B 3FBNB 4HV5A 1YI2I 2OTJI 3O9XA 4E7JA 2MXDA 2V1DA 3JRGA 1BIBA 2K3FA 2HDWA 1YSEA 3A9XA 4D1QA 3GFLA 1TQPA 4PU3C 3K0LA 3CCUI 3MKWB 5F64A 3DTIA 3ZN0A 4BHBA 2Q2EB 2CQNA 2EFOA 3PSFA 4R8HA 2X0LA 3D5SC 2EPFA 2DA1A 3HRSA 3R60A 4EVIA 5DSXA 2CUFA 2JPBA 2HOAA 3W6JB 1RR8C 3G7DA 4ZYGA 3FXKA 2B9SA 2QSGX 2WB1A 3QP6A 1MJBA 1QNTA 3T0YA 2Y75A 3ZRGA 3S3MA 3ZMSA 2LLKA 3TOAA 4V19K 4XSXF 4HA8A 2F4IA 3V8LA 2Q2EA 2F5VA 2XIGA 3CTAA 5DYMA 2MBFA 1TQMA 1AA7A 2L1PA 5EG0A 5FKLA 2V1UA 4F3QA 5A2QZ 1QZXA 3Q3SA 1ETWA 2XGXA 1I39A 2MLGA 3O8GA 1NK2P 3OMYA 4BXFA 2ECCA 4CGZA 3BCBA 2IVGA 3HOXJ 1JJ8C 2VKHA 1IN7A 4I01A 3TDZC 1ZRCA 1YS6A 4KMFA 3TEPA 3E6BA 5CVIA 3BG7A 3A01A 2HPMA 4IHTA 3PXPA 2BW3B 1Z7UA 4MQVA 1OCTC 2A3SA 4DYQA 5J3LA 3SZPA 4OINF 1BW6A 3FXMA 5ILVA 2XPWA 4ENKA 1Z7LA 2E1NA 4WWCA 3IRRA 1WIZA 1RZ4A 2QBYA 2R63A 5LGNA 3BTIA 1FP1D 3OIPA 1LVAA 4CZCA 2HTJA 1LFBA 3CJQB 4ON0A 4IOCF 2BY0A 2DMTA 2HOEA 4GYGA 4L18B 1V5GA 3HRUA 1ZAOA 3EYIA 2FMYA 3SHFA 3BJ6A 4UUVA 1SMYF 2KMUA 1WCMJ 1YYVA 2R5ZB 2MQKA 3HIFA 1YW7A 4D7NA 1ORKA 3GZCA 2DU9A 3QPTA 2XF6A 4CCNA 4A3LJ 2FBHA 2DBBA 2M9HA 4HF0A 2XCJA 4Y42A 2JK3A 3Q9SA 4O6JA 4EMSA 3H3UA 4JOMA 3A4CA 5CKTA 1LEBA 2KZGA 4QPOA 2GQQA 4UHTA 3KJXA 2P8TA 2XAQA 1TT5B 4F93B 1XTAA 2F5DA 3N05A 2XSJC 2DJIA 3E6DA 4FHTA 4GGGA 4ZYEA 2DK5A 3DF8A 2WB1N 1UHSA 4PSWA 4V2GA 3MZHA 3IH2A 3U1DA 4DZJA 3C2HA 3A9ZA 2P0WA 2Z99A 3V8JA 1T56A 2J7UA 1HBXG 3FMYA 3GMEA 5LD2C 1PVEA 4OAZA 4CCLA 1PP8F 2DMNA 2VQGA 1PDNC 2KRCA 3HC7A 3J81K 2MLKA 2VQCA 4E70A 1STZA 3WODF 5D5UB 2JQEA 4M3FA 1X3WB 2Q0OA 3SDGA 2DT7B 2HSGA 1B6AA 3GX4X 2D45A 4KICA 2QGUA 2E2JJ 3BOQA 4DBRA 1RPWA 5FKMA 3FKJA 1SFOJ 2PUEA 2ZNZA 3OOPA 5LGUA 1LQCA 5CLSA 3RZOJ 2ZSHB 3G5GA 3EDPA 4GQMA 2D5VA 4NDWA 3LSMA 3A2KA 4IHSA 3FDYA 1U9NA 5AIQA 4PGHA 1ZGAA 3QRFF 3F0CA 1S5LC 5EEAA 2PXQA 1X3UA 1HW5A 4E7KA 1R9TJ 3H5AA 2PXUA 1H9GA 3KLNA 4L5EA 3EYYA 3ERED 2R7ZJ 2LYSA 1FBQA 2M1BA 1BOBA 2HS5A 1OQYA 4BNCA 5KK1A 1IW7F 2ETHA 2IV1A 1R6RA 3CD6I 1WRJA 3L2RA 2FJRA 1NK3P 2PXLA 2EFPA 4J1XA 2KZ8A 3MWMA 2PX9A 2EJRA 3MFKA 2VI6A 1KQ8A 1D1AA 3FWEA 1E3PA 3QODA 3WHBA 3HTUA 1R63A 1DW9A 2HPIA 1VI0A 1IDYA 3WTVC 2JJ7A 3MN2A 5D8KB 1LUJB 4B44A 4CH7A 2K7LA 4EM2A 3W3CA 3QQAA 1ZN2A 3FKIJ 2LBFB 3GW2A 1GT0C 4WCGA 5CQGA 3K7AJ 2I10A 2I8DA 3EETA 2LTPA 1QO0D 2M0CA 3B02A 3IC7A 4I6ZA 2X6YA 2LH9A 1F1ZA 3ISPA 3KE2A 3R09A 4RB2C 2EV6A 4RB1A 1DU0A 1XGSA 2CJJA 1TNTA 3B73A 4RAFA 2CMPA 2BNOA 3L2WA 1K6YA 4KDPA 4PK4A 5CVVA 1ZR2A 1WJCA 4I99C 3TO7A 1O3SA 2XPVA 5F0HA 3FMRA 4RB0A 4JK1X 4CYCA 3HL2A 2MA3A 4ITVA 1ZZ7A 2LYPA 1Y9QA 2XGCA 3DV8A 4BQQA 3SQNA 2IS6A 4LB5A 3SFZA 4B09A 2MGQA 1UHMA 3HOSA 1RZRA 1P4AA 2MC3A 4E7SA 2OAZA 4F52A 2WWYA 2GBYA 2LD5A 1ZZCA 1HXDA 3RKQA 3E5QA 1E3HA 1O7LA 3QU3A 4RLFA 1P2FA 2PPXA 1ZGWA 1KQ0A 3PO3J 2KEIA 4MCXA 1T08B 2L02A 2ZKZA 3ZQCA 1QZZA 4Y33A 1AKHB 1WH6A 1R23A 3BJAA 4M3GA 4X4GA 3LFUA 3U21A 1XD7A 3DKXA 3HGYA 1KU2A 2ECBA 2Y31A 4B43A 3ECHA 5F0FA 3U1KA 2VC0A 2LKPA 3F8MA 2UXXA 1S7AA 1JUSA 3W2VA 5EZHA 3CMMA 2A05A 4ENJA 2IGNA 4DIQA 4HRIA 4HQMA 1MH3A 3OYKA 3SX0A 3DWLE 2M8GX 3K4LA 3KP6A 1MJAA 2TCTA 1ULYA 2XAGA 2V79A 4I2OA 1UXCA 5HOOA 5LLQA 3QYXA 4YIRX 2KHMA 3HSEA 3CZ6A 1E3OC 3GUUA 4XKCA 3SEZA 1JUPA 1SEUA 1U78A 1NH3A 2QQBA 1OSLA 2OQRA 5FGMA 2WY8Q 1NG7A 2M5WA 1ZH5A 3E97A 2MC4A 3BZKA 3DEEA 4L9NA 4LGWA 1QHGA 1W5CC 3KYCB 5DTQA 3F8NA 4IVZA 1UG2A 4G7ZF 2ODRD 3K1NA 3JRCA 3I4NJ 4OIQF 4ER5A 4PJMA 4DQ2A 3ZQQA 1U2WA 1SD5A 2VE8A 5C4JJ 4J1WA 1W4MA 2CV1A 1XMKA 4XLFA 5E18F 1D0YA 3Q9VA 1R5GA 1HF0A 5DUIA 1IUYA 3A0BC 1SC7A 2NS0A 3PL8A 2OD5A 2NVTJ 5BPDA 2KP6A 2K3PA 2G0EA 1I1SA 1DP3A 4GFBA 4ZYDA 1X1BA 2X6WA 4X4IA 2H8RA 2HQNA 3BWGA 5D4RA 2A69F 3WTWC 1ZK8A 2PFBA 1TQIA 5JI6A 1N75A 2BE5F 3S15J 3LNQA 1HDDC 3WTYC 4FETA 2BY1A 3F51A 3WG7H 2KJBA 4IRIA 2M3AA 2XB0X 1MFQC 1PERL 2PJRB 3W2WA 4RGRA 1A6QA 4XICA 2O7OA 3T8RA 3H92A 3PIOF 2IJLA 4L9TA 1E2XA 3PIPF 3RKXA 3D5RC 3T5XA 4CA0A 5L3DA 2F5FA 2OC6A 4NC7A 4I76A 4EV0A 4OU0A 1XGOA 4A3FJ 2ZMEA 4QTRA 3OWTA 3G4SI 1ON1A 2ZO4A 4BEHA 1WJ5A 2LKSA 2H1LA 2DA5A 3H5NA 4MGRA 3S2HJ 1E0EA 2VB6A 3RYPA 1USTA 3WU1B 3LA2A 2O61A 1HDPA 1X58A 3HDDA 1YE9A 2QUFA 2LYCA 4NC6A 1G3SA 1ZELA 1VQ6I 1X2MA 2LMDA 4NB5A 1YW8A 2R7QA 1F9NA 4CCJA 5J8FA 2FQ4A 4PCQA 4AUXA 3CCSI 1K6OA 1Q1HA 2R0QC 2EFWA 2VQHA 2VONA 1QQBA 2K27A 3P9KA 3MEJA 3UWPA 2FOWA 4KJZA 3CECA 1XMXA 3G1LA 4Y4RA 3WU2C 4XQFA 2L01A 2BGCA 4KYWA 2GOXB 3IHUA 2O8XA 3EUHC 3G3ZA 4A3BJ 1IRGA 2O0YA 3CCVI 2GRLA 1GV5A 2JA2A 3F9KA 1UFMA 3RQIA 1LCCA 3I59B 1TLHB 2HQ5A 3QPLA 2J5OA 4YEJA 4C2UA 1IXCA 1D1CA 1OPCA 2XV4S 1UHWA 3JAMZ 2HINA 2HYFA 4U87A 1QP0A 1TWHJ 3ZMUA 4JP0A 4XRFA 3CESA 2LDUA 5K1YA 3M8FA 1ZHFA 1ETYA 1JT6A 2BY2A 1ZLKA 4KA4A 2ZNYA 2V3CC 2E5ZA 1G4DA 1K4SA 5E3NA 2X9DA 3BG3A 3FMQA 2FE3A 2FXAA 2HFHA 1Y56A 2R3SA 2XASA 1IJWC 2FD5A 3R1FA 2LNBA 3K9TA 3AG1H 4EEFG 5EJCA 4O5VA 1J9IA 2XXAA 4CHUA 5GPAA 2QA4I 2EIMH 5L3CA 1HKTA 2M45A 5HLHA 1VQ4I 2LY9A 3S93A 2VJJA 1U5TC 4YIIA 1BI1A 4PU4C 4A93J 3LA7A 3CP2A 2ZMEC 4HF1A 1Y0NA 3K1MA 2QZ8A 3K10A 4W1UA 1UTXA 2RAEA 4HAMA 1LE8B 3B6AA 2JZYA 2XAFA 4C30A 1BJAA 1HKSA 4HLXA 4XK4A 1FYKA 4X4HA 4BL0B 3DBLB 2O4AA 4DGWB 4UVAA 4KMUX 4HV6A 2WBMA 5F6FA 1FC3A 3ESWB 1K4TA 1SD7A 1IN6A 4UB8C 3ZP5A 1HW2A 1SD6A 5ICCA 1U6GA 3BPXA 3A02A 4P9FA 4I6UA 3UR3C 4OMZA 5EEHA 2LF8A 1DULA 2ZXIA 1IRXA 2OCCH 2VJ5A 3HSFA 3FXJA 2ACJA 1YG2A 2NOGA 2P6TA 4ZTJA 2AWIA 3BR2A 3ZPXA 2JUCA 2VXDA 1TWAJ 4JBAA 1BN5A 3ZXSA 2LKXA 4ESBA 2IU7A 3L00A 4LLLA 3ZGKA 1PUFB 3G73A 2M4HA 2XC7A 4PGGA 3ZQLA 2BV6A 2PI0A 1J0RA 3LQQA 2Z2SB 1ZRFA 1XGMA 5H20A 1P4WA 2E7XA 4PFOA 1ZZ8A 2CUEA 2P7CB 1YFHA 1LFUP 4XIDA 1R58A 2YU3A 1WJAA 3Q5FA 3Q0VA 4RA2A 2ZXJA 4AYBA 3JRIA 2V9PA 1FYMA 3ZOBA 2MG4A 4B8XA 3B7HA 3K4JA 2BHZA 3M1CA 4D0PA 5J4YA 4M74A 3TBIA 3I5UA 2PXKA 1ZG1A 1ETKA 4CCOA 2E35A 2PXBA 1RR7A 4KN7X 5BOXA 1T33A 3NROA 1MKMA 4IVNA 1Y1WJ 3I4MJ 3SEQA 3LFPA 1D3YA 5EYRA 3E5XA 5FROA 4CSWA 1T2KA 1RI7A 2FU4A 2L9RA 3BDNA 2GA1A 1FSHA 3SCFA 4RM2A 3CCEI 2K9MA 3A0HC 5TRDA 3MKZA 3WGHA 2EWTA 4FE4A 1XWRA 1DGWY 2RV8A 4RBOA 4IOAF 2R7FA 1SFKA 1ZTRA 3SZGA 4PU7A 4G7OF 5GPCA 1I6HJ 1ZS4A 3I58A 2EQRA 3GFMA 2DN0A 1R5ID 4HOBA 1FTZA 2JPCA 1ZG5A 1APLC 3VYRB 1PRVA 2BHYA 1RNLA 2DFEA 2ADUA 4M9ZA 3BZ6A 2DA3A 1WWXA 4HNVA 1EV7A 3EUSA 5LFAA 2L49A 2L5QA 2DMUA 2CV2A 1QB2A 3ZPLA 4A0ZA 4BXUA 5DEQA 2XAUA 1NERA 4M71A 3PJRA 2VXZA 4UUSA 2Q8KA 4E7ZA 1FIAA 5GAGi 2E2HJ 2HKXA 5ICEA 2XGEA 4ZZDA 3C7JA 1V3FA 2X85A 2V6CA 2XIUA 1RRJA 1ZUGA 4PZJA 2NVXJ 1REPC 3S17J 3E0JB 2QF7A 5M3MJ 1IV8A 2KEKA 4HEA2 4A3JJ 4V2FA 3NEUA 2XF5A 3HEFA 2PMZA 4P1WA 1ZPQA 1RESA 1TZLA 1OKRA 1JKRC 6PAXA 1KYWA 5L3GA 4KIGA 4AYBN 3GFIA 1N78A 4E7LA 2H6CA 2HTSA 2K9SA 2WAFA 4YIFA 1U2ZA 1XS9A 3FXRA 1OYIA 2V9VA 5E8IA 2PUAA 1PRAA 2HQRA 5JVTA 4EQZA 3GCMA 3CLCA 2YUSA 4I0BA 3SZTA 5IYCJ 2K4JA 1WGXA 2QQ8A 1RKWA 1VF9A 2A5WA 4OMYA 1G3YA 3FX3A 3D0SA 1ZARA 1WPKA 2PUCA 4J00A 1DUXC 2JT1A 1QZYA 2LRDA 3OYHA 3JRFA 3EPZA 1B1BA 3LSGA 4LOCA 3FISA 3FIWA 2IEKA 4A3EJ 1JFTA 4IWRA 4ABZA 2CW8A 4OIPF 1B0NA 5DTMA 3PM1A 2EZKA 2JWTA 4XLNF 4ER0A 2CO5A 1ETQA 2VKEA 2FUG2 2E5NA 2VN2A 1MIJA 2YPRA 2P6SA 1VQPI 1MSFC 5K7HA 2FFHA 3VODA 3UKGA 2DXIA 2Y2ZA 3PUFA 4HRAA 1T95A 5HDNA 3DLLF 4DBQA 2EK5A 3GTQJ 2LR8A 4MFEA 1VNDA 2R4GA 4C3IJ 3L2UA 2DA2A 3R4KA 1TW3A 3OL3A 1RUOA 2E71A 2PJPA 3DEUA 1GV2A 4YFNF 2OBPA 3HB9A 3K2ZA 1XPXA 4OB4A 2PUGA 4LG0A 1L3LA 3F21A 1R5HA 1GVDA 2HFZA 3VEPA 2R93J 1JWLA 2BY3A 3IL2A 4L5IA 5IOZA 2LYRA 1IZ1A 4BE1A 4RAGA 1M1EB 5FKKA 3KL4A 5DRYA 5EG0B 2QVOA 3R61A 3GBFA 1XCVA 1KQ9A 3QYEA 2JA5J 1VQMI 1ACIA 1MMGA 2E19A 3NWSA 4NQWA 1V54H 4MIMA 2JRTA 3OIQA 3Q0WA 3ZQHA 4HBLA 5H2FC 2LFBA 4U7DA 3HRMA 4YG2F 4AIJA 2VQLA 3RPUA 4KISA 2MSYA 3CMEI 2FSWA 3DKYA 2PMZN 1HQCA 2LSOA 1D5VA 1XDUA 1S9HA 2A07F 2L7MP 3A01B 2BEOA 3H36A 4RGXA 2KPJA 4Z2YA 1FOYA 2HWVA 2MH9A 2QYOA 5K7ZA 2JA8J 1EFAA 1K79A 2FEZA 4JQDA 2X6OA 3P7NA 1XMAA 4XRMA 2EV5A 2C6YA 1W5SA 2QBYB 5BPIA 4WVLA 3IAM2 2ELJA 5BS6A 2N8GA 3KX2A 4B47A 5E17F 4A2UA 3LOCA 2VKDA 5B3SH 3L2CA 3FM3A 1H8AC 1E17A 2XXPA 3F52A 5A7LA 3KP3A 3IKVA 3MEXA 4BACA 4I6RA 3FXOA 3HTSB 4QIWN 1R1VA 1WFXA 1W5TA 1XCBA 4XLPF 3OSGA 2GRMA 2LYJA 1HLVA 4IL6C 2DQLA 2NYXA 3HZJA 2JVHA 3O2PE 4E7HA 5HDGA 3LMMA 3ZMVA 3HPHA 1VQOI 2LYLA 1I6XA 2DPDA 3PFIA 2Y0MA 2JVGA 4KFCA 2BJCA 2G7HA 4XLHA 1KGSA 4Y7NJ 4BH9A 4MLOA 1W7PA 3JCUC 3SYTA 5TJJA 2RVCA 2V4JC 2HI3A 4BU2A 3SR4A 1Z3YA 5KAFC 3S3NA 1TNSA 2IAIA 1FOWA 2CG4A 2WUSR 3RPQA 2IP2A 2AUWA 3MZ8A 3DNVB 1I5ZA 3IVPA 1RC9A 1QA6A 2K02A 2DLLA 4KIBA 3S2DJ 5ILUA 3LSKA 2LY2A 1WJDA 3RPUD 1LLIA 2WY7Q 1I3QJ 3OL4A 3PNVA 4YELA 3MD2A 4A0XA 4MEXF 1ZVVA 1UB9A 5DV5A 2KJCA 1ZZBA 4XL9A 2KQRA 2MEZA 2O3FA 4X4FA 1BJZA 2LLVA 2JN6A 3CC7I 2F5CA 1ZG3A 4U0VA 5GAHJ 4A3IJ 2TDXA 3ZKCA 2PMUA 2HQAA 3M07A 1T0FA 4X4DA 1BOAA 1R36A 5CQEA 1FZPB 2A5YB 3U2RA 3NWTA 3QOPA 2L7FP 2WA0A 3LFKA 1SVMA 1TT0A 2EA4A 1B9MA 4FBIA 2VKVA 2GIZA 3QOWA 3G1MA 1OCZH 1B72B 3MAJA 3UNGC 3MCZA 4RB3C 3NXHA 3K70D 3MMYB 1IC8A 2BNMA 4OOIA 1MJ9A 3GTOJ 2KIQA 3OR2C 2BXZA 2GZUA 4PSXA 1XGNA 5EEGA 4E7IA 1YIJI 1MBEA 3KEQA 3K70C 2Y48A 2HCSA 2DO7A 3H9QA 3HXLA 1D0ZA 3BR0A 3ML6A 4XOPA 1EJ9A 1B72A 1W7PD 3CCYA 1S72I 3JRHA 2FNAA 3CO6C 4S04A 1PRUA 1HA8A 2DOAA 4BQOA 4CICA 1T39A 2NVUB 2FOKA 2COBA 4TV7A 1G3TA 4ASNA 1ETOA 4UY8I 4HDVA 3DFGA 3LSJA 1YHQI 3VOEA 2XUBA 3BG6A 3ZMDA 4L0YB 5EGOA 1D0XA 1I50J 1JE8A 1BR1A 2IVMA 4I98B 1UJ8A 1X1AA 5F08A 1MMDA 4M73A 2CUJA 2LG4A 3KEOA 4CZZA 4I8TA 2O9LA 1YLFA 4JCYA 2ZJPF 1J7KA 5F27A 3TOBA 1TC3C 1POGA 5JLWA 3F3XA 2LLWA 5J1RA 1OYYA 1S7OA 4M72A 3QF3A 3V42A 2PUBA 4EJWA 4CYCB 4IQJA 4EKGA 2PMHA 1H0MA 2HKOA 2IT0A 1NHAA 2UV1A 3LSIA 4L9JA 2E1CA 2J5PA 1RIOA 4FE7A 2WTEA 3DU5A 4BE0A 1A35A 2HXIA 3CMAI 4BXXJ 4MEYF 1FLIA 4OIRF 2HEOA 5AONA 3T1BA 1T0FC 5ED4A 4A5NA 4X4CA 3GTMJ 1AU7A 4WX9A 4S05A 1B8IA 4F91B 5ICGA 1KU3A 3IH4A 2R5YA 1U9OA 4CDGA 1JGSA 1FBUA 5ERIA 3J80K 4W97A 1I27A 3EQLF 1V55H 1W0TA 4Q5SF 4OIOF 2M0MA 4NBQA 3S1RJ 5FRNA 1SFUA 2KLOA 1EH7A 2K86A 3BDDA 3ZMTA 3GVAA 5FJ8J 3VYUB 3E1SA 3S3OA 1JFSA 1AHDP 2E1MC 1ENHA 2QSHX 4WXCA 2MD5A 1LDKB 2DYSH 2FRHA 3PQJA 4UVCA 3CDHA 1SFXA 3BQYA 3OYFA 1FIPA 2HR3A 3AFHA 2VE9A 2STTA 2NRAC 2HDCA 4FTHA 5KAIC 3CUQA 3K4MA 4LD5A 3TMOA 1OISA 4BQNA 2DJNA 4HX4A 1DPUA 4FX4A 3DPLC 2E2IJ 3S14J 1OLTA 2ELKA 1T6SA 2CQQA 2X48A 3R6SA 2MW8A 3GBGA 2RQPA 2VBZA 3FBIB 3TW7A 5HVQC 5C3EJ 1K61A 3ABLH 3OWQA 2DAOA 4HYEA 1VZ0A 5CYVA 3I3LA 1RPEL 3GFJA 2EIKH 1WH5A 5GTHC 1T38A 2QENA 1RIOH 5DTDA 4KT6A 3MKLA 4GHJA 4I6TA 3DCFA 3RI4A 2KL4A 3V8KA 2PXDA 3KFWX 1V4RA 5LRSA 2IBDA 3IWZA 4BBSJ 1ZGJA 5KNLA 3M9LA 1QPZA 2VIXA 3CLQA 3VB2A 1OJLA 2DFIA 2VOPA 2WAEA 3MVPA 3TKYA 3EUHA 4D9JA 3DM5A 1X3ZB 1BA5A 2R7OA 4Y17A 4ANJA 3JSPA 2B63J 4IRGA 1D8KA 3I54A 1ETXA 2W25A 3H0GJ 4XKVA 5DM7F 1C0WA 4AVPA 4XLAA 5DDGA 3LL7A 3GN5A 5K5QA 4I0AA 4WXDA 3M8EA 4XKBA 4L0ZB 3A9YA 1P6RA 1ETVA 3H9JA 3K4CA 4UV9A 4C9YA 2QEXI 4AIHA 3VWSA 4B4CA 1Y1VJ 3WTZA 2AW6A 4ZDOA 1YRNA 3GLXA 2NXNB 2WV0A 4OWRB 3CMYA 2ZMEB 4PJLA 5CVJA 4KT5C 2GLOA 1SAUA 3GZ6A 4BEHB 3RZDJ 2HZDA 1IUFA 1TWGJ 2OJED 1LB2A 2EB7A 3NARA 3OYAA 4HX7A 1D8JA 1OCPA 2VL8A 3ECOA 1Y39A 1QZEA 4BJ6C 1LEAA 2EFQA 3M3YJ 4AC0A 1YX3A 5LHIA 3CUQC 3ABMH 2IW5A 3FZVA 4BHPA 1U5TA 1X1CA 5J47A 3CCMI 2CGPA 2RDPA 2L9VA 2D2WA 2PLYA 5DS9A 3DKWA 1QRYA 1WI9A 4EJUA 3NAUA 3ZN1A 4F55A 4U7BA 3O6BB 1H88C 2VJ4A 1J09A 4Y52J 1YITI 3PE5A 5HDKA 5GTIC 4LFUA 5GP9A 1USSA 5E20A 2RNJA 2HU9A 1K78B 3VWBA 3IRQA 5DRTA 2CYYA 2KRFA 5FLVA 1FMVA 4BUPA 2GA2A 3JRBA 3CC4I 1ERDA 2LYKA 1WVRA 3HRTA 4ZYHA 3H3VK 4G6QA 3L2VA 3CF5F 2KKOA 1I1GA 4AM3A 2WC2A 1X4PA 4YRVA 5GAGJ 4Z6YA 1IN8A 2QM3A 3WTUC 3GTKJ 1XSVA 1X2NA 3ABUA 1BI0A 1WH7A 5D5XB 1IN4A 3NZLA 3GWZA 5B66C 1K78A 3FM5A 1YO5C 3K6GA 5FLXK 2Z5UA 1S29A 2VBXA 3OYJA 2K85A 3KCCA 4ZZLA 2EF8A 4Y13A 4M3EA 2P5KA 3OQOA 3QWGA 2F4OB 2JRMA 2OTLI 1BBYA 5TGTA 3VK0A 3SCGA 1MGTA 2XB5A 5JVGF 1LQ1A 3FYAA 1RKTA 3GTGJ 2DA7A 4GXOA 3GTPJ 4IX7A 2ZSIB 1WZ2A 4ER7A 4II2A 1S7EA 1SAXA 3P9CA 3OYGA 4X4EA 3HG9A 1WI3A 1BC8C 1HC8A 3QOXA 2QKMB 3KP4A 2H94A 1BM9A 3K4BA 1V5FA 2R7VA 2L54A 3EUKL 3ULQB 4EQQA 1S8NA 3PFYA 3H5RA 3COAC 1L1MA 1JKQC 1IV6A 3ASNH 3K4KA 5FD5A 4XOTA 2GZWA 3ZQ7A 1QVUA 1VPWA 3IUOA 4P96A 2FBIA 3BR6A 1SFEA 3KYLA 1XN7A 3V4GA 4EATA 4IHVA 5IT3A 2JCGA 2L3DA 5FRMA 2ISZA 4LIVA 3VSLA 3IWFA 1BDIA 2A61A 2W00A 2PUDA 3DLAA 1WH8A 4YG1A 2O6GE 4IJAA 2M8EA 4FT8A 2L7KA 3OYBA 2HXOA 1YJNI 2HYGD 1DDNA 2R7WA 1Z77A 4FCYA 1PNRA 1MDMB 4R1HA 3DXJF 3J7AY 3QQ6A 2A68F 3DBHB 4BE2A 3S1MJ 3BC8A 4ZJZA 3DPTA 2MH2A 4ETSA 4DE8A 2R92J 1ZREA 2K9NA 4IQ4A 3WTSC 1O3QA 1AWCA 3DTEA 1MNMC 4E4HA 3QYBA 4P9UA 2MABA 2R7DA 2Y0SA 4DYCA 3ELKA 4CYDA 3V7RA 4DE9A 4CO8A 1IXRC 4HSTA 4II3A 1BIAA 1FWZA 3H35A 3QPHA 3V7SA 2XSDC 3CCQI 4G7HF 4BJTA 4YFXF 2B0LA 2QLZA 4XSZF 1FX7A 1MDMA 4ENMA 3RCOA 1EH8A 2X4HA 4S0HB 5GADJ 3BT9A 2M7AA 3GZDC 2HZTA 2V6EA 2LNMA 3CCJI 3OYNA 3HOUJ 3EUAA 3BR1A 4XNFA 3G71I 2DMQA 5F1RA 4QLCU 1VQNI 3BTCA 5LEKA 3AG2H 2O03A 4IXAA 1MNDA 3OY9A 1MBGA 2OF7A 2ZCWA 3GUDA 1W36D 2WIUB 2M4KA 2VJIA 3VDXA 2KEJA 3CQZJ 5B5EC 4Q2JA 2B5AA 2R7UA 2MFZA 1YOVB 3TDUC 3G0TA 5BNGA 1EH6A 1ZKGA 3GLLA 5KHDA 1W36C 4I02A 4PDKA 4K2EA 5LBQA 3MLFA 3OYMA 1FSEA 5DCMA 2DT5A 3G2BA 1H89C 3LISA 2DPUA 2H09A 3DP7A 4G94A 4HG2A 5GAEJ 1WSUA 4HQEA 4GDFA 4UUSB 2O5RA 1XDSA 1IG7A 4ESJA 4L5JA 2PN6A 4EZIA 1HW1A 2BXYA 2XJ3A 2VT2A 5JFRA 1BL0A 2IA0A 4AU7A 4A69C 3KP7A 2A6HF 2LF7A 5J4VA 2AO9A 2IRFG 3TO6A 4Q47A 3HKZA 3KP5A 4X4BA 2DOFA 3M1EA 1LCDA 4QSHA 4XKWA 3FF5A 5D6EA 4KITB 2ID3A 1PUEE 3AAFA 4EJVA 5K7FA 2YX4A 2HNHA 1IRZA 3C18A 2WADA 2Z9OA 2VLAA 3OS2A 2E1OA 1R1TA 4ENNA 1FYLA 2JA6J 2PIJA 1LVKA 4LB6B 3TO9A 1TP4A 2E7WA 1DWKA 1OR7C 1RZSA 5L3EA 3K4NA 2DTRA 2Y0SN 5D5WB 4AWXB 1XB4A 2UUZA 3OV8A 4DYRA 3J81Z 3W6KB 4MTDA 3CF2A 3TQNA 3CROL 1D1BA 1R49A 2L4AA 2WAQA 3I56I 4RDUA 3JTHA 2K9LA 3QOEA 1ZZ6A 4CUGA 4BY1J 2CSOA 3D1NI 1QP4A 2ESHA 4ZDPA 3HOZJ 3TFLA 4B48A 1Y7YA 4NUBA 3CCRI 2OU2A 3H9GA 2XDVA 1YQAA 1JGGA 5E79C 1B9NA 2VPRA 2R7SA 2XKOA 2NOJB 2Y9ZA 2F4MB 3WHCA 2EA2A 2QKLB 4LJZF 5FFZA 2E34A 1YIOA 4YG7B 2JA7J 1NG6A 2W4SA 3FXUA 4AIDA 3I0TA 2D1VA 3H1CA 2O38A 1A04A 3CLOA 1FP2A 3L7WA 3RDIA 3P9IA 4N4NB 1OYWA 3ZMZA 4RAYA 4LG0B 4P5OA 2B7EA 4FISA 3HJEA 3G6EI 1FEXA 1R69A 2AXUA 3ROUA 3GZ5A 1Z91A 4E6KG 3J7YJ 2O8KA 3RZZA 1JI8A 2V26A 2L7ZA 1HCRA 2ISYA 3P5JA 3QAHA 5B1AH 4G12A 3HUGA 1JUMA 2PQ8A 4IHXA 3HOYJ 3R0AA 2LREA 2AHQA 4NQWB 4Z5HA 1O7FA 4IKFA 2YSRA 1V5EA 3CDLA 1HSJA 4GRIA 2WV1A 3HKZN 1R4NB 5BMZA 2EBYA 1P9QC 2PXEA 1B4AA 3ZQGA 1TTYA 2I5UA 1TW2A 2QQ9A 1GLNA 2DDAA 3ABTA 4MFDA 4XRSA 3OYLA 2FF4A 2HOTA 1WETA 5F04A 2GAUA 5JLXA 3F23A 1ZRDA 2EILH 2CFOA 1FMWA 2FMLA 2LYQA 4AVZA 3J80Z 4A3GJ 2HCNA 5DUKA 3ZHMA 4Q4ZF 3IV5A 1LDJA 2KDOA 2DDBA 3KEYA 3LSTA 2OCEA 2MYSA 3L2QA 3SCHA 3C2GA 2HVQA 2WAQN 3FK7A 3U9GA 2PXTA 4YG4A 2VPLA 3ME5A 3WGGA 2A6TA 3KETA 2DODA 2CW7A 2IS4A 1OCOH 4CCMA 1FPQA 1MBHA 3IAS2 4MCTA 4HDUA 2V7FA 2ZFWA 2GOMA 4Z5DA 3OR1C 3KZYA 3NRVA 3X2QH 3TW6A 2RREA 1XSDA 4HW0A 1Z9CA 2EZHA 2KIFA 3JTGA 1U8RA 1UXDA 3BTLA 3E5UA 2BYVE 5CPRB 2IUOA 2GWRA 3WG9A 1AOYA 1CJGA 3J7AO 5LHGA 1MW7A 1P7IA 1LPQA 2PEXA 5CJ9A 2M7BA 1W7PB 2CQXA 3BQZA 1QP7A 2DFFA 2CQ7A 4PU8A 1LNWA 2VC1A 5J6XA 2IGKA 4LIUA 3RYRA 2CROA 1FBSA 2FJ1A 4XN3A 3I71A 2CFXA 2G7UA 4M9XA 3AG4H 3NDBB 1OMIA 2YBDA 4PJJA 1R1UA 3F72A 2DMPA 1R00A 2H8WA 3DU6A 2XHKA 1L0OC 1Z6TA 1PP7U 2XXQA 2VT3A 3TRBA 4UNOA 1S3JA 3IKTA 4M3BA 4MO7A 3N4MA 3OIOA 2P4WA 4F7ZA 2QCOA 2AQEA 4A6DA 3LQXA 2FX0A 4BS9A 2Q1ZB 2XRLA 2W7NA 3S1QJ 1DP7P 3BS3A 2CW0F 5H6RA 1JKOC 3HSRA 2Z16A 1JXSA 3HGGA 3AG3H 5FLMJ 1S6LA 1SD4A 2PE5A 3REOA 4M6VA 2M87A 4JX5A 4A3KJ 5K5RA 4HX8A 2BW3A 5HLTA 2CSFA 2BNNA 4RLQA 3AL0C 3OKZA 2CS3A 4G8XA 2OFYA 1A6IA 5ILSA 2UZKA 2YR2A 3L09A 3QP5A 3GTLJ 4CXFA 2EH3A 2CWEA 2ZJ2A 3HOTA 3S16J 1QU3A 2XVCA 3VYSB 3U3WA 5DCFA 2ME0A 2TRTA 4H0EA 1FY7A 1XSXA 3DBRB 1TWCJ 2VOOA 2E1MB 5EF6A 3HPGA 2UXNA 2MD0A 1SQ8A 3DPUA 3TELA 4Y15A 4EK9A 3PQKA 2H27A 1IRFA 4RGSA 4U0YA 5IYBJ 2R5ZA 3KXAA 3BD1A 1JH9A 3BZCA 1CQTA 2L8NA 3G1OA 2ZJQF 3RSNA 1WHUA 2L9SA 3KZZA 4U88A 4OAYA 1MMAA 3J7ZI 1X4OA 5IT9K 3LQRA 2HDDA 4RMNA 1FOKA
chains in the Genus database with same CATH topology
2NOGA 4FN3A 2AWIA 3BR2A 2AXVA 5EGOB 1ETVA 3VPRA 1TWAJ 1NTCA 2LKXA 2YS9A 4JX4A 5EDNA 3S1NJ 2EBIA 1QVTA 1Y1VJ 4B4CA 2IU7A 2AW6A 1PUFB 1ITYA 1YRNA 3JXCL 3ZQLA 1HOMA 2AXZA 3CMYA 2XPUA 2XGDA 3B6CA 4F8DA 2GLOA 3O9XA 2NVYJ 1ZZ8A 3RZDJ 2HOSA 2CUEA 3JRGA 1FTTA 1LFUP 4XIDA 1IUFA 1TWGJ 1YSEA 3NARA 3Q0VA 1OCPA 4PU3C 3JRIA 3M3YJ 3ZOBA 1BDHA 2MG4A 4AC0A 3B7HA 1XG1A 5M5WJ 2DA1A 3JRAA 3HM5A 2KDZA 2CUFA 1GUUA 2HOAA 4BBRJ 5DS9A 1B8IB 1ETKA 1QRYA 5J1YA 3G7DA 3NAUA 1H88C 2R5YB 1MBJA 1RR7A 1TWFJ 1ZZ9A 3FYMA 3KZ3A 4Y52J 2LLKA 5GP9A 1T33A 3E7LA 4IEJA 5FLVA 1Y1WJ 3JRBA 3I4MJ 5IP9J 3BR3A 2LYKA 3LFPA 3H3VK 2ID6A 5EYRA 3FK6A 2EZLA 5EG0A 5FKLA 3OMTA 2L9RA 3Q3SA 2M2EA 3JR9A 3UFDA 3BDNA 3SCFA 1ETWA 1MH4A 4O8BA 2EWTA 4FE4A 2IVQA 3O8GA 1XWRA 3GTKJ 1X2NA 4RBOA 1WH7A 1NK2P 1ZTRA 5E3MA 4PU7A 2ECCA 4IHYA 5GPCA 1I6HJ 1ZS4A 2IVGA 2EQRA 3HOXJ 1JJ8C 2DN0A 5K98B 2VUMJ 1FTZA 4M3EA 2EF8A 3H5TA 1APLC 4JCXA 3OQOA 1PRVA 3QWGA 3A01A 3PXPA 3VK0A 3SCGA 2H1KA 1OCTC 3TP0A 2DA3A 2XB5A 4DYQA 4HNVA 3EUSA 5J3LA 3FYAA 2L49A 2DMUA 1RKTA 1BW6A 3GTGJ 2CRGA 2DA7A 2XPWA 3GTPJ 2M34A 5E3LA 1NERA 1WIZA 3LSRA 2R63A 4UUSA 1S7EA 2NS8A 3BTIA 1FIAA 4X4EA 3OQNA 1WI3A 2CU7A 2E2HJ 1LFBA 2XGEA 4B1RA 1OFCX 2XIUA 2W48A 1EF4A 3C2BA 1ZUGA 2DMTA 2NVXJ 3HOWJ 3S17J 5M3MJ 2QF7A 2KEKA 1L1MA 4A3JJ 1JKQC 4V2FA 3JRDA 1IV6A 3HEFA 1ZPQA 1RESA 1WCMJ 2R5ZB 1JKRC 4D7NA 1ORKA 1VPWA 3Q0UA 1QVUA 1ADRA 4AYBN 3BR6A 4A3LJ 2K9SA 4IHVA 1XS9A 3GN5B 2M9HA 3S8QA 2JCGA 2XCJA 4Y42A 2JK3A 4YBAA 2PUAA 9ANTA 4NDLA 1PRAA 4Z58A 1BDIA 3CLCA 2YUSA 3KJXA 2PUDA 5HODA 1WH8A 4YG1A 5IYCJ 1YRNB 1WGXA 1RKWA 1VF9A 1AKHA 2WB1N 1UHSA 1QPIA 4V2GA 1WPKA 2HXOA 3IH2A 4DZJA 4YARA 2PUCA 4IA8A 1Z77A 4FCYA 3JRFA 1T56A 3LSGA 4LOCA 1PNRA 3FISA 3FIWA 2IEKA 4A3EJ 3FMYA 3QQ6A 4ABZA 1B0NA 1JFTA 4IWRA 3PM1A 2EZKA 3S1MJ 2JWTA 2DMNA 3OOUA 1W0UA 1ETQA 2K9NA 2VKEA 1JKPC 1MNMC 1IGNA 4M3FA 5C44J 1MSFC 5K7HA 3SDGA 3UKGA 2HSGA 2Y2ZA 4DYCA 1POUA 2E2JJ 5J1UA 1RPWA 2LR8A 4MFEA 1VNDA 5FKMA 4C3IJ 2XSDC 1SFOJ 3GTQJ 2MQKA 2DA2A 2PUEA 4S0HB 1LQCA 1GV2A 3BT9A 3RZOJ 4X6AJ 3G5GA 2PUFA 4GQMA 2D5VA 4NDWA 3HB9A 2PUGA 4OB4A 3O8HA 2Y30A 3HOUJ 1GVDA 1U9NA 2R93J 1RZRD 3BR1A 1JWLA 2DMQA 3IH3A 3F0CA 5IOZA 5EEAA 2LYRA 1R9TJ 4L5EA 3BTCA 3LSPA 5FKKA 2R7ZJ 2R1JL 1JJ6C 5EG0B 2LYSA 1MBGA 2OF7A 3GBFA 2JA5J 2K40A 2ICTA 1K83J 2E19A 2WIUB 2LK2A 2IVBA 2IV1A 4MIMA 2KEJA 3CQZJ 3Q0WA 1NK3P 3ZQHA 2B5AA 2FJRA 2JVLA 4J1XA 2KZ8A 2LFBA 2VI6A 5BNGA 1ZKGA 3WHBA 1R63A 1DW9A 2MSYA 3OSFA 1VI0A 1IDYA 4M3DA 2JJ7A 1X2LA 2PMZN 3MN2A 3MLFA 2L7MP 3A01B 3QQAA 4J19A 3FKIJ 2KPJA 1H89C 1GT0C 3LISA 2JA8J 5K7ZA 1JTXA 1EFAA 3K7AJ 2I10A 4JQDA 2X6OA 4XRMA 2EZIA 2LTPA 2M0CA 3QPSA 4I6ZA 3M4OJ 4UUSB 2OPTA 1IG7A 2N8GA 2XJ3A 4B3AA 5IPAA 1DU0A 3BTJA 3LOCA 1ZR4A 1H8AC 1BL0A 2CJJA 1GDTA 3F52A 4A69C 5A7LA 2AO9A 2BNOA 1XC5A 4C2MJ 5M5XJ 4I6RA 3PO2J 3TP3A 2LCVA 4X4BA 4QIWN 1ZR2A 1LCDA 2R92J 4QSHA 3OSGA 2GRMA 2XPVA 5F0HA 4CYCA 1HLVA 2LYJA 2XI8A 2ID3A 1ZZ7A 5K7FA 3K2AA 2LYPA 1Y9QA 1IRZA 2XGCA 2E1OA 4JYKA 2JA6J 2PIJA 2LYLA 2BJCA 1DWKA 1RZSA 1DU6A 2MGQA 1MBKA 3DEWA 4Y7NJ 4MLOA 1RZRA 2Y0SN 3HOVJ 2LD5A 2GBYA 4C3HJ 1ZZCA 3RKQA 2K9QA 4DYRA 2DA6A 2HI3A 4A3DJ 2PPXA 3CROL 1ZGWA 3PO3J 4D7MA 2KEIA 4MCXA 4RDUA 2IAIA 3ZQCA 1ZZ6A 1AKHB 1WH6A 4BY1J 2WUSR 4M3GA 4X4GA 3D1NI 1QP4A 3HOZJ 2AUWA 3HZIB 2NVQJ 3DNVB 3HGYA 5IOYA 5FKNA 3HBLA 1Y7YA 3IVPA 2ECBA 2Y31A 5F0FA 1JGGA 3S2DJ 1ZQ3P 1LLIA 2P81A 1I3QJ 2VPRA 1JUSA 5EZHA 1ZVVA 2Y9ZA 3WHCA 2DTZA 1ZZBA 2MEZA 1MH3A 2M8GX 2TCTA 4YG7B 2JA7J 1UXCA 4X4FA 1BJZA 3QYXA 2JN6A 4XRSG 1E3OC 4A3IJ 3SFIA 3ZKCA 1JUPA 1F43A 1IDZA 1U78A 2O38A 4X4DA 1OSLA 2L7FP 4FBIA 2VKVA 4FISA 1FEXA 3G1MA 1B72B 4IVZA 1UG2A 1R69A 2AXUA 2O8KA 3JRCA 3RZZA 3I4NJ 2LVSA 2L7ZA 1HCRA 5IP7J 1IC8A 4G12A 2BNMA 3ZHIA 3GTOJ 2GZUA 1JUMA 5IYDJ 5C4JJ 4IHXA 5EZGA 3HOYJ 4J1WA 2AHQA 1MBEA 1U8BA 1LE8A 4Z5HA 3SJMA 1HF0A 3CDLA 3BR0A 2NVTJ 2O49A 2EBYA 2WV1A 2G0EA 3HKZN 2KT0A 1B72A 4GFBA 3CCYA 4X4IA 3JRHA 2DA4A 2H8RA 3ZQGA 1ZK8A 1PRUA 3L1PA 3S15J 4MFDA 4XRSA 2HOTA 1WETA 3LNQA 1HDDC 5F04A 5C4XJ 3OP9A 5JLXA 3JXBC 2COBA 3F51A 2XB0X 1ETOA 5F0CA 2A6CA 1PERL 2GM4A 3LSJA 3JREA 2LYQA 4A3GJ 3BG9A 4XICA 2O7OA 5EGOA 3ZHMA 1F36A 3IV5A 1I50J 3BG5A 2ME6A 3SCHA 5F08A 2OR1L 1PUFA 2WAQN 3FK7A 1JT0A 4YG4A 4I8TA 5E3OA 1X57A 2O9LA 4I76A 1FJLA 2JMWA 4JCYA 4A3FJ 5F27A 1ZAYA 1TC3C 1MBHA 1POGA 5JLWA 4QTRA 4MCTA 5J1RA 4IHWA 4Z5DA 3QF3A 1Z0XA 3S2HJ 2DA5A 2PUBA 4CYCB 3TW6A 2Y9YA 2ZB9A 2EZHA 1HDPA 1X58A 3HDDA 1UXDA 3BTLA 1RIOA 4FE7A 2IUOA 2HXIA 1CJGA 4BXXJ 1X2MA 1P7IA 5M5YJ 3TEDA 2FQ4A 3JXDL 4AUXA 2CQXA 3BQZA 4X4CA 1QP7A 3GTMJ 2R0QC 1AU7A 1QQBA 1B8IA 4PU8A 1RETA 2CROA 3CECA 3G1LA 3IH4A 2R5YA 1U9OA 2FJ1A 3GTJJ 5M3FJ 5IP6A 1MBFA 4W97A 4A3BJ 1W0TA 2GRLA 1GV5A 3S1RJ 1MSEC 3RQIA 1SANA 1Q1VA 2DMPA 4DZPA 2HQ5A 1O4XA 1LCCA 3TRBA 3QPLA 5FJ8J 4BKXA 3ZQFA 2HINA 2L0KA 1JFSA 4BY7J 1QP0A 1TWHJ 1AHDP 1ENHA 4JP0A 2LP0A 4M3BA 3OQMA 3A03A 4MO7A 3OIOA 2ICPA 5FKOA 1ETYA 1JT6A 2QCOA 4UUTA 2FX0A 3BQYA 1FIPA 2XRLA 3BS3A 3S1QJ 4A3MJ 4FTHA 3ZQIA 1JKOC 5E3NA 1A5JA 2X9DA 2DJNA 3BG3A 3HGGA 5FLMJ 1VFCA 2PE5A 2HYJA 1IJWC 3R1FA 2FD5A 4M6VA 4JX5A 4EEFG 4A3KJ 2E2IJ 4JX6A 3S14J 2ELKA 2CQQA 2CSFA 2BNNA 2X48A 3W6VA 2MW8A 3GBGA 2OFYA 5GPAA 1A6IA 3TW7A 5C3EJ 1K61A 4Z5CA 3GTLJ 2LY9A 2EH3A 1RPEL 4D5FA 1NEQA 1WH5A 4C3JJ 5DTDA 1JTYA 3S16J 3MKLA 1BW5A 4GHJA 4A93J 1G2HA 4I6TA 4PU4C 3DCFA 3U3WA 4Z59A 3BR5A 4W1UA 2ME0A 2TRTA 2NS7A 1UTXA 2RAEA 4D5CA 1LE8B 2YU9J 3B6AA 2IBDA 4BBSJ 1TWCJ 4XK4A 4X4HA 5EF6A 2O4AA 1D5YA 4A3CJ 1QQAA 4DW6A 1QPZA 1SQ8A 1OJLA 1UMQA 3MVPA 1P7JA 1LMB3 2R5ZA 5IYBJ 3KXAA 1JH9A 1BA5A 3BD1A 1CQTA 3A02A 3G1OA 2L8NA 4I6UA 2B63J 3F6WA 1ETXA 3H0GJ 4X1EA 3GN5A 5F1JA 2HDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NOG A;  4FN3 A;  2AWI A;  3BR2 A;  2AXV A;  5EGO B;  1ETV A;  3VPR A;  1TWA J;  1NTC A;  2LKX A;  2YS9 A;  4JX4 A;  5EDN A;  3S1N J;  2EBI A;  1QVT A;  1Y1V J;  4B4C A;  2IU7 A;  2AW6 A;  1PUF B;  1ITY A;  1YRN A;  3JXC L;  3ZQL A;  1HOM A;  2AXZ A;  3CMY A;  2XPU A;  2XGD A;  3B6C A;  4F8D A;  2GLO A;  3O9X A;  2NVY J;  1ZZ8 A;  3RZD J;  2HOS A;  2CUE A;  3JRG A;  1FTT A;  1LFU P;  4XID A;  1IUF A;  1TWG J;  1YSE A;  3NAR A;  3Q0V A;  1OCP A;  4PU3 C;  3JRI A;  3M3Y J;  3ZOB A;  1BDH A;  2MG4 A;  4AC0 A;  3B7H A;  1XG1 A;  5M5W J;  2DA1 A;  3JRA A;  3HM5 A;  2KDZ A;  2CUF A;  1GUU A;  2HOA A;  4BBR J;  5DS9 A;  1B8I B;  1ETK A;  1QRY A;  5J1Y A;  3G7D A;  3NAU A;  1H88 C;  2R5Y B;  1MBJ A;  1RR7 A;  1TWF J;  1ZZ9 A;  3FYM A;  3KZ3 A;  4Y52 J;  2LLK A;  5GP9 A;  1T33 A;  3E7L A;  4IEJ A;  5FLV A;  1Y1W J;  3JRB A;  3I4M J;  5IP9 J;  3BR3 A;  2LYK A;  3LFP A;  3H3V K;  2ID6 A;  5EYR A;  3FK6 A;  2EZL A;  5EG0 A;  5FKL A;  3OMT A;  2L9R A;  3Q3S A;  2M2E A;  3JR9 A;  3UFD A;  3BDN A;  3SCF A;  1ETW A;  1MH4 A;  4O8B A;  2EWT A;  4FE4 A;  2IVQ A;  3O8G A;  1XWR A;  3GTK J;  1X2N A;  4RBO A;  1WH7 A;  1NK2 P;  1ZTR A;  5E3M A;  4PU7 A;  2ECC A;  4IHY A;  5GPC A;  1I6H J;  1ZS4 A;  2IVG A;  2EQR A;  3HOX J;  1JJ8 C;  2DN0 A;  5K98 B;  2VUM J;  1FTZ A;  4M3E A;  2EF8 A;  3H5T A;  1APL C;  4JCX A;  3OQO A;  1PRV A;  3QWG A;  3A01 A;  3PXP A;  3VK0 A;  3SCG A;  2H1K A;  1OCT C;  3TP0 A;  2DA3 A;  2XB5 A;  4DYQ A;  4HNV A;  3EUS A;  5J3L A;  3FYA A;  2L49 A;  2DMU A;  1RKT A;  1BW6 A;  3GTG J;  2CRG A;  2DA7 A;  2XPW A;  3GTP J;  2M34 A;  5E3L A;  1NER A;  1WIZ A;  3LSR A;  2R63 A;  4UUS A;  1S7E A;  2NS8 A;  3BTI A;  1FIA A;  4X4E A;  3OQN A;  1WI3 A;  2CU7 A;  2E2H J;  1LFB A;  2XGE A;  4B1R A;  1OFC X;  2XIU A;  2W48 A;  1EF4 A;  3C2B A;  1ZUG A;  2DMT A;  2NVX J;  3HOW J;  3S17 J;  5M3M J;  2QF7 A;  2KEK A;  1L1M A;  4A3J J;  1JKQ C;  4V2F A;  3JRD A;  1IV6 A;  3HEF A;  1ZPQ A;  1RES A;  1WCM J;  2R5Z B;  1JKR C;  4D7N A;  1ORK A;  1VPW A;  3Q0U A;  1QVU A;  1ADR A;  4AYB N;  3BR6 A;  4A3L J;  2K9S A;  4IHV A;  1XS9 A;  3GN5 B;  2M9H A;  3S8Q A;  2JCG A;  2XCJ A;  4Y42 A;  2JK3 A;  4YBA A;  2PUA A;  9ANT A;  4NDL A;  1PRA A;  4Z58 A;  1BDI A;  3CLC A;  2YUS A;  3KJX A;  2PUD A;  5HOD A;  1WH8 A;  4YG1 A;  5IYC J;  1YRN B;  1WGX A;  1RKW A;  1VF9 A;  1AKH A;  2WB1 N;  1UHS A;  1QPI A;  4V2G A;  1WPK A;  2HXO A;  3IH2 A;  4DZJ A;  4YAR A;  2PUC A;  4IA8 A;  1Z77 A;  4FCY A;  3JRF A;  1T56 A;  3LSG A;  4LOC A;  1PNR A;  3FIS A;  3FIW A;  2IEK A;  4A3E J;  3FMY A;  3QQ6 A;  4ABZ A;  1B0N A;  1JFT A;  4IWR A;  3PM1 A;  2EZK A;  3S1M J;  2JWT A;  2DMN A;  3OOU A;  1W0U A;  1ETQ A;  2K9N A;  2VKE A;  1JKP C;  1MNM C;  1IGN A;  4M3F A;  5C44 J;  1MSF C;  5K7H A;  3SDG A;  3UKG A;  2HSG A;  2Y2Z A;  4DYC A;  1POU A;  2E2J J;  5J1U A;  1RPW A;  2LR8 A;  4MFE A;  1VND A;  5FKM A;  4C3I J;  2XSD C;  1SFO J;  3GTQ J;  2MQK A;  2DA2 A;  2PUE A;  4S0H B;  1LQC A;  1GV2 A;  3BT9 A;  3RZO J;  4X6A J;  3G5G A;  2PUF A;  4GQM A;  2D5V A;  4NDW A;  3HB9 A;  2PUG A;  4OB4 A;  3O8H A;  2Y30 A;  3HOU J;  1GVD A;  1U9N A;  2R93 J;  1RZR D;  3BR1 A;  1JWL A;  2DMQ A;  3IH3 A;  3F0C A;  5IOZ A;  5EEA A;  2LYR A;  1R9T J;  4L5E A;  3BTC A;  3LSP A;  5FKK A;  2R7Z J;  2R1J L;  1JJ6 C;  5EG0 B;  2LYS A;  1MBG A;  2OF7 A;  3GBF A;  2JA5 J;  2K40 A;  2ICT A;  1K83 J;  2E19 A;  2WIU B;  2LK2 A;  2IVB A;  2IV1 A;  4MIM A;  2KEJ A;  3CQZ J;  3Q0W A;  1NK3 P;  3ZQH A;  2B5A A;  2FJR A;  2JVL A;  4J1X A;  2KZ8 A;  2LFB A;  2VI6 A;  5BNG A;  1ZKG A;  3WHB A;  1R63 A;  1DW9 A;  2MSY A;  3OSF A;  1VI0 A;  1IDY A;  4M3D A;  2JJ7 A;  1X2L A;  2PMZ N;  3MN2 A;  3MLF A;  2L7M P;  3A01 B;  3QQA A;  4J19 A;  3FKI J;  2KPJ A;  1H89 C;  1GT0 C;  3LIS A;  2JA8 J;  5K7Z A;  1JTX A;  1EFA A;  3K7A J;  2I10 A;  4JQD A;  2X6O A;  4XRM A;  2EZI A;  2LTP A;  2M0C A;  3QPS A;  4I6Z A;  3M4O J;  4UUS B;  2OPT A;  1IG7 A;  2N8G A;  2XJ3 A;  4B3A A;  5IPA A;  1DU0 A;  3BTJ A;  3LOC A;  1ZR4 A;  1H8A C;  1BL0 A;  2CJJ A;  1GDT A;  3F52 A;  4A69 C;  5A7L A;  2AO9 A;  2BNO A;  1XC5 A;  4C2M J;  5M5X J;  4I6R A;  3PO2 J;  3TP3 A;  2LCV A;  4X4B A;  4QIW N;  1ZR2 A;  1LCD A;  2R92 J;  4QSH A;  3OSG A;  2GRM A;  2XPV A;  5F0H A;  4CYC A;  1HLV A;  2LYJ A;  2XI8 A;  2ID3 A;  1ZZ7 A;  5K7F A;  3K2A A;  2LYP A;  1Y9Q A;  1IRZ A;  2XGC A;  2E1O A;  4JYK A;  2JA6 J;  2PIJ A;  2LYL A;  2BJC A;  1DWK A;  1RZS A;  1DU6 A;  2MGQ A;  1MBK A;  3DEW A;  4Y7N J;  4MLO A;  1RZR A;  2Y0S N;  3HOV J;  2LD5 A;  2GBY A;  4C3H J;  1ZZC A;  3RKQ A;  2K9Q A;  4DYR A;  2DA6 A;  2HI3 A;  4A3D J;  2PPX A;  3CRO L;  1ZGW A;  3PO3 J;  4D7M A;  2KEI A;  4MCX A;  4RDU A;  2IAI A;  3ZQC A;  1ZZ6 A;  1AKH B;  1WH6 A;  4BY1 J;  2WUS R;  4M3G A;  4X4G A;  3D1N I;  1QP4 A;  3HOZ J;  2AUW A;  3HZI B;  2NVQ J;  3DNV B;  3HGY A;  5IOY A;  5FKN A;  3HBL A;  1Y7Y A;  3IVP A;  2ECB A;  2Y31 A;  5F0F A;  1JGG A;  3S2D J;  1ZQ3 P;  1LLI A;  2P81 A;  1I3Q J;  2VPR A;  1JUS A;  5EZH A;  1ZVV A;  2Y9Z A;  3WHC A;  2DTZ A;  1ZZB A;  2MEZ A;  1MH3 A;  2M8G X;  2TCT A;  4YG7 B;  2JA7 J;  1UXC A;  4X4F A;  1BJZ A;  3QYX A;  2JN6 A;  4XRS G;  1E3O C;  4A3I J;  3SFI A;  3ZKC A;  1JUP A;  1F43 A;  1IDZ A;  1U78 A;  2O38 A;  4X4D A;  1OSL A;  2L7F P;  4FBI A;  2VKV A;  4FIS A;  1FEX A;  3G1M A;  1B72 B;  4IVZ A;  1UG2 A;  1R69 A;  2AXU A;  2O8K A;  3JRC A;  3RZZ A;  3I4N J;  2LVS A;  2L7Z A;  1HCR A;  5IP7 J;  1IC8 A;  4G12 A;  2BNM A;  3ZHI A;  3GTO J;  2GZU A;  1JUM A;  5IYD J;  5C4J J;  4IHX A;  5EZG A;  3HOY J;  4J1W A;  2AHQ A;  1MBE A;  1U8B A;  1LE8 A;  4Z5H A;  3SJM A;  1HF0 A;  3CDL A;  3BR0 A;  2NVT J;  2O49 A;  2EBY A;  2WV1 A;  2G0E A;  3HKZ N;  2KT0 A;  1B72 A;  4GFB A;  3CCY A;  4X4I A;  3JRH A;  2DA4 A;  2H8R A;  3ZQG A;  1ZK8 A;  1PRU A;  3L1P A;  3S15 J;  4MFD A;  4XRS A;  2HOT A;  1WET A;  3LNQ A;  1HDD C;  5F04 A;  5C4X J;  3OP9 A;  5JLX A;  3JXB C;  2COB A;  3F51 A;  2XB0 X;  1ETO A;  5F0C A;  2A6C A;  1PER L;  2GM4 A;  3LSJ A;  3JRE A;  2LYQ A;  4A3G J;  3BG9 A;  4XIC A;  2O7O A;  5EGO A;  3ZHM A;  1F36 A;  3IV5 A;  1I50 J;  3BG5 A;  2ME6 A;  3SCH A;  5F08 A;  2OR1 L;  1PUF A;  2WAQ N;  3FK7 A;  1JT0 A;  4YG4 A;  4I8T A;  5E3O A;  1X57 A;  2O9L A;  4I76 A;  1FJL A;  2JMW A;  4JCY A;  4A3F J;  5F27 A;  1ZAY A;  1TC3 C;  1MBH A;  1POG A;  5JLW A;  4QTR A;  4MCT A;  5J1R A;  4IHW A;  4Z5D A;  3QF3 A;  1Z0X A;  3S2H J;  2DA5 A;  2PUB A;  4CYC B;  3TW6 A;  2Y9Y A;  2ZB9 A;  2EZH A;  1HDP A;  1X58 A;  3HDD A;  1UXD A;  3BTL A;  1RIO A;  4FE7 A;  2IUO A;  2HXI A;  1CJG A;  4BXX J;  1X2M A;  1P7I A;  5M5Y J;  3TED A;  2FQ4 A;  3JXD L;  4AUX A;  2CQX A;  3BQZ A;  4X4C A;  1QP7 A;  3GTM J;  2R0Q C;  1AU7 A;  1QQB A;  1B8I A;  4PU8 A;  1RET A;  2CRO A;  3CEC A;  3G1L A;  3IH4 A;  2R5Y A;  1U9O A;  2FJ1 A;  3GTJ J;  5M3F J;  5IP6 A;  1MBF A;  4W97 A;  4A3B J;  1W0T A;  2GRL A;  1GV5 A;  3S1R J;  1MSE C;  3RQI A;  1SAN A;  1Q1V A;  2DMP A;  4DZP A;  2HQ5 A;  1O4X A;  1LCC A;  3TRB A;  3QPL A;  5FJ8 J;  4BKX A;  3ZQF A;  2HIN A;  2L0K A;  1JFS A;  4BY7 J;  1QP0 A;  1TWH J;  1AHD P;  1ENH A;  4JP0 A;  2LP0 A;  4M3B A;  3OQM A;  3A03 A;  4MO7 A;  3OIO A;  2ICP A;  5FKO A;  1ETY A;  1JT6 A;  2QCO A;  4UUT A;  2FX0 A;  3BQY A;  1FIP A;  2XRL A;  3BS3 A;  3S1Q J;  4A3M J;  4FTH A;  3ZQI A;  1JKO C;  5E3N A;  1A5J A;  2X9D A;  2DJN A;  3BG3 A;  3HGG A;  5FLM J;  1VFC A;  2PE5 A;  2HYJ A;  1IJW C;  3R1F A;  2FD5 A;  4M6V A;  4JX5 A;  4EEF G;  4A3K J;  2E2I J;  4JX6 A;  3S14 J;  2ELK A;  2CQQ A;  2CSF A;  2BNN A;  2X48 A;  3W6V A;  2MW8 A;  3GBG A;  2OFY A;  5GPA A;  1A6I A;  3TW7 A;  5C3E J;  1K61 A;  4Z5C A;  3GTL J;  2LY9 A;  2EH3 A;  1RPE L;  4D5F A;  1NEQ A;  1WH5 A;  4C3J J;  5DTD A;  1JTY A;  3S16 J;  3MKL A;  1BW5 A;  4GHJ A;  4A93 J;  1G2H A;  4I6T A;  4PU4 C;  3DCF A;  3U3W A;  4Z59 A;  3BR5 A;  4W1U A;  2ME0 A;  2TRT A;  2NS7 A;  1UTX A;  2RAE A;  4D5C A;  1LE8 B;  2YU9 J;  3B6A A;  2IBD A;  4BBS J;  1TWC J;  4XK4 A;  4X4H A;  5EF6 A;  2O4A A;  1D5Y A;  4A3C J;  1QQA A;  4DW6 A;  1QPZ A;  1SQ8 A;  1OJL A;  1UMQ A;  3MVP A;  1P7J A;  1LMB 3;  2R5Z A;  5IYB J;  3KXA A;  1JH9 A;  1BA5 A;  3BD1 A;  1CQT A;  3A02 A;  3G1O A;  2L8N A;  4I6U A;  2B63 J;  3F6W A;  1ETX A;  3H0G J;  4X1E A;  3GN5 A;  5F1J A;  2HDD A; 
#chains in the Genus database with same CATH topology
 3DTK A;  2EFN A;  4FN3 A;  1IO2 A;  4BDZ A;  5EGO B;  5HLG A;  3VPR A;  1BR2 A;  1NTC A;  2E60 A;  3RTR A;  3LAP A;  3S1N J;  2EBI A;  5JHU A;  5JR3 A;  3FXQ A;  4PUS A;  4UXN A;  2V1X A;  1UEL B;  2EV0 A;  3JXC L;  1HOM A;  2AXZ A;  2D1H A;  2XPU A;  1O3T A;  2XAH A;  2FA5 A;  2F48 A;  2GIV A;  4B3X A;  1JHH A;  3B6C A;  5HNF A;  4F8D A;  4QWQ A;  2KIM A;  2NVY J;  2HOS A;  1FTT A;  4BHC A;  2M4G A;  1HQ1 A;  4UVB A;  3T8T A;  3S32 A;  2DW4 A;  2X51 A;  2FBK A;  5FLX Z;  1BDH A;  4LK0 F;  3R0J A;  1WJF A;  1XG1 A;  1Y8Q B;  5M5W J;  4EJT A;  3JRA A;  3HM5 A;  3BCA A;  2KDZ A;  1IXS B;  4EKI A;  1GUU A;  3A1Y A;  4BBR J;  1B8I B;  1YJ9 I;  5J1Y A;  4RS8 A;  4RAZ A;  4UB6 C;  2R5Y B;  1MBJ A;  2DI3 A;  3CO7 C;  1TWF J;  1ZZ9 A;  3H3Z A;  1TBX A;  2OZU A;  2ZBK A;  3FYM A;  3KZ3 A;  4WF2 A;  1N77 A;  1G8X A;  4ER3 A;  1HST A;  3E7L A;  4IEJ A;  1IF1 A;  2ESN A;  1UG0 A;  5IP9 J;  3BR3 A;  1DGR M;  2ID6 A;  1SMT A;  4MQ9 F;  4ZDL A;  3TGN A;  1W1W E;  3FK6 A;  2EZL A;  3OMT A;  2KRH A;  3I9V 2;  4ZH4 F;  2M2E A;  3JR9 A;  1P4X A;  3GXO A;  4FX0 A;  5JHF A;  1MH4 A;  3UFD A;  1WJE A;  3KYD B;  4O8B A;  2R7T A;  4G9Y A;  4UV8 A;  2IVQ A;  4BJ5 C;  2XKP A;  5E3M A;  3CUQ B;  4IHY A;  2ELH A;  5HS8 A;  4N9I A;  4PJ0 C;  1YTY A;  4EGY A;  4BQA A;  2J7W A;  5K98 B;  2VUM J;  3H5T A;  4JCX A;  2PXF A;  4HNU A;  3RKW A;  4XOR A;  3BRO A;  4MTE A;  2LBF A;  2H1K A;  5FD6 A;  3RJP A;  3TP0 A;  3BJO A;  1K7A A;  3HHG A;  3JW4 A;  1X1P A;  4J01 A;  2CRG A;  3O3K A;  4WK8 F;  1LJ9 A;  3E6M A;  4M9S A;  2M34 A;  5E3L A;  5J8C A;  3LSR A;  4EM1 A;  3N97 A;  2STW A;  2NS8 A;  3CP8 A;  2DYR H;  3OYC A;  3OQN A;  3PNY A;  2CU7 A;  1H9T A;  3E6C C;  4HF2 A;  5HLI A;  3GEZ A;  4B1R A;  1OFC X;  3LWF A;  4G6T B;  2W48 A;  1EF4 A;  3C2B A;  2BZT A;  2NNY A;  3HOW J;  4JQF A;  5AIP A;  4H4K C;  3CUO A;  3M7G A;  5A2Q K;  3SXY A;  3JRD A;  1F4K A;  2IA1 A;  3D5L A;  5DD4 A;  4LG3 A;  4O3M A;  4BAY A;  4R79 A;  3MZY A;  4PFP A;  3Q0U A;  2P7V B;  1XX5 A;  4A5M A;  1ADR A;  2E36 A;  1KON A;  3PNT A;  3WE2 A;  1KZH A;  4IPA A;  4KIF A;  4BYY A;  3GN5 B;  3S8Q A;  1WQ2 A;  2RKH A;  4YBA A;  1BC7 C;  9ANT A;  4NDL A;  1WJB A;  4EGZ A;  2LOO A;  1KA8 A;  2L9N A;  2Z3Y A;  3L9F A;  4AIK A;  4Z58 A;  1R71 A;  2ZC2 A;  5L3B A;  5HOD A;  2R7R A;  2Z1D A;  1PYV A;  1T98 A;  1YRN B;  2L2O A;  2KZV A;  2W1O A;  1AKH A;  1QPI A;  2KIS A;  2IA2 A;  4YAR A;  1QHH D;  2AXL A;  3ZR8 X;  1N25 A;  1YX5 A;  4DJA A;  4IA8 A;  3QYF A;  2OV7 A;  4N4O B;  1U0J A;  3OYE A;  3LSH A;  2ZXH A;  4IRH A;  4ZYA A;  2CV0 A;  2IGM A;  3OOU A;  3F8F A;  5D6F A;  1W0U A;  2BVL A;  2VEO A;  1JKP C;  1J59 A;  1IGN A;  5C44 J;  5IY5 H;  1KU7 A;  1U5T B;  1VTN C;  1POU A;  5J40 A;  1MMS A;  1LFP A;  3QWL A;  4BGD A;  2CH0 A;  5J1U A;  1QBJ A;  2RC4 A;  1ODD A;  2P5V A;  2FQ3 A;  4DOZ A;  2AXT C;  4X6A J;  4YFK F;  2PUF A;  1Z05 A;  2IS1 A;  3O8H A;  5GAH i;  2Y30 A;  1RZR D;  3NQO A;  4XN0 A;  1BI3 A;  1PJR A;  2G9W A;  3IH3 A;  5H6Q A;  1A31 A;  1B59 A;  4NHJ A;  3WE3 A;  3RKY A;  3LSP A;  1O57 A;  2R1J L;  3HHH A;  1JJ6 C;  3DQV C;  2AS5 F;  2K40 A;  2L4M A;  2ICT A;  1K83 J;  5ICF A;  2LK2 A;  2IVB A;  3TL4 X;  2M30 A;  4N9H A;  3OYI A;  2RGV A;  2JVL A;  5TIS C;  3MKY B;  1MMN A;  3MQ0 A;  3OSF A;  5D4S A;  1UZC A;  1Z67 A;  4M3D A;  3GZN B;  5DM6 F;  1X2L A;  5K5O A;  1P92 A;  3KLO A;  3E3V A;  4N0B A;  4ZC3 A;  3I53 A;  4J19 A;  5FO5 A;  2COM A;  4QPQ A;  1SVO A;  1JTX A;  1VQL I;  5DTR A;  2Z33 A;  2PJR A;  2W24 A;  3S2W A;  2EZI A;  3QPS A;  1GHC A;  3M4O J;  4LIT A;  5CVR A;  2OPT A;  1Z1D A;  4B3A A;  4CCK A;  5IPA A;  3BTJ A;  1ZR4 A;  4M6X A;  2CUZ A;  2DK8 A;  1Z21 A;  1GDT A;  1CGP A;  2HVR A;  1XC5 A;  4C2M J;  5M5X J;  3PO2 J;  3FMS A;  3TP3 A;  2AQF A;  5E8G A;  5BQT A;  2LCV A;  3FHN A;  3GZD A;  2W85 A;  1Y0U A;  4GO1 A;  1GXQ A;  2XI8 A;  3K2A A;  3QFI A;  1G3W A;  4KN4 X;  2V9K A;  4JYK A;  2X1D A;  3F8B A;  2GXB A;  3DEW A;  1MBK A;  5FFX A;  1DU6 A;  3CDI A;  1VQ9 I;  3HOV J;  4C3H J;  2EIN H;  3ASO H;  2F5E A;  2K9Q A;  2DOE A;  3C1D A;  2DA6 A;  4A3D J;  1U3E M;  3GO5 A;  1R7J A;  4D7M A;  1YS7 A;  2HGC A;  3F8C A;  1KYZ A;  3S8P A;  3HZI B;  1YW9 A;  2W82 A;  2NVQ J;  5IOY A;  1EKE A;  5FKN A;  3HBL A;  2RN7 A;  4XMY A;  5B1B H;  1OCC H;  3I59 A;  3I4P A;  4Y3O A;  1ZQ3 P;  2JTV A;  2P81 A;  5KCM A;  4ER6 A;  2IXS A;  3GYH X;  3M9A A;  2ZJR F;  2DTZ A;  1J75 A;  3VYT B;  1J5Y A;  2PG4 A;  1R4M B;  3W2A A;  4P55 A;  2ZXW H;  4EJO A;  3AKZ A;  4BDY A;  2H6B A;  2PXP A;  4MNU A;  4A12 A;  2QWW A;  4XRS G;  1IAW A;  3FHZ A;  2DFH A;  3SFI A;  1F43 A;  1IDZ A;  1RUN A;  4GCV A;  2XF7 A;  1OCR H;  2IPQ X;  1A36 A;  5DT2 A;  2CQK A;  4LLG F;  1FNN A;  4FAS D;  3I64 A;  2Y69 H;  1X1D A;  2VOD A;  4IO9 F;  5DD8 A;  1NW3 A;  2A6E F;  2LVS A;  3BP8 A;  2ZFU A;  4XLE A;  4AD9 A;  5IP7 J;  3CJN A;  3ZHI A;  5JUW A;  1OR7 A;  3KP2 A;  5IYD J;  5EZG A;  2GXG A;  4A0Y A;  4Q48 A;  2OUM A;  1U8B A;  1LE8 A;  2DT6 A;  4DNC A;  3SJM A;  3F22 A;  4A6E A;  2DQR A;  3GF2 A;  3CJR B;  1G59 A;  1LKX A;  2O49 A;  2KT0 A;  3WTT C;  1DQU A;  1ON2 A;  1Y6I A;  1VQ7 I;  2DA4 A;  2RQQ A;  1TL8 A;  3L1P A;  2KIU A;  1FOX A;  2PXV A;  5DCM B;  3OP9 A;  5C4X J;  3JXB C;  3BY6 A;  3F6V A;  3LA3 A;  5F0C A;  2A6C A;  2VBY A;  2K5C A;  4HZF A;  2GM4 A;  3JRE A;  3BG9 A;  4LK1 F;  1VQK I;  3ERM A;  2IGO A;  1BI2 A;  1F36 A;  3BG5 A;  2YX7 A;  2ME6 A;  3I55 I;  1MNE A;  2V1N A;  1PUF A;  2JSP A;  1BR4 A;  3WGI A;  2OR1 L;  1JT0 A;  4XM3 A;  5E3O A;  1X57 A;  4FQG A;  1FJL A;  4RGU A;  2JMW A;  1Z3X A;  3KIO A;  3ZCO A;  1ZAY A;  3WU0 A;  2IS2 A;  3K69 A;  2F2E A;  5LRR A;  2LY1 A;  3KPH A;  4IHW A;  4LLN A;  3VSK A;  1Z0X A;  4HNT A;  3FXL A;  2X6X A;  2W84 A;  1Z6R A;  2JUG A;  2VBW A;  2X1C A;  4I09 A;  5CVU A;  2Y9Y A;  2ZB9 A;  3QU6 A;  3CCL I;  3F6O A;  3C3W A;  4L9V A;  4RM3 A;  1J2X A;  4NNJ A;  2QQA A;  5E1X A;  5M5Y J;  3TED A;  2RNG A;  3BPV A;  4U0W A;  3JXD L;  5KVR A;  3ABK H;  3ONQ A;  5E1W A;  1Y8R B;  1RET A;  2EWN A;  1EA3 A;  4HPQ A;  3OS0 A;  3GTJ J;  3H0D A;  5M3F J;  5HNH A;  3V7C A;  5IP6 A;  1MBF A;  1CF7 B;  1FT9 A;  3SDB A;  2JSC A;  5LHH A;  4OBM A;  2P5L C;  5LGT A;  1MSE C;  1SAN A;  1Q1V A;  4DZP A;  2KFD A;  2DCE A;  1O4X A;  5L3F A;  2EIJ H;  2VAS A;  2OZ6 A;  3ZQF A;  4BKX A;  2L0K A;  4BY7 J;  1ONV A;  1YJW I;  5D8L B;  3OQM A;  2LP0 A;  4HSR A;  3A03 A;  4IZZ A;  1ZYR F;  2K4B A;  4G6D A;  1UCR A;  5FKO A;  2XAJ A;  2ICW G;  2ICP A;  4UUT A;  5FB2 A;  1SVL A;  3JSO A;  1CF7 A;  1F5T A;  4A3M J;  5D5V B;  1X19 A;  3ZQI A;  1A5J A;  5IT9 Z;  3BLY A;  5LEJ A;  1HKQ A;  1VFC A;  1GXP A;  1UAA A;  4X0G A;  2HYJ A;  4LMY A;  2R7X A;  1QGP A;  4JX6 A;  2XRO A;  2F6C A;  3W6V A;  1O3R A;  1DPR A;  2BVM A;  5HS9 A;  4Z5C A;  4C2T A;  2XRN A;  4D5F A;  1NEQ A;  3VFZ A;  4C3J J;  1JTY A;  3HUG B;  2NNN A;  1BW5 A;  1G2H A;  1I3A A;  1VQ5 I;  3OYD A;  4HLY A;  1KU9 A;  4Z59 A;  3BR5 A;  1T8I A;  2QSF X;  4NC8 A;  2NS7 A;  4M6Y A;  2YU9 J;  4D5C A;  4PJN A;  4ESF A;  1VQ8 I;  3PUB A;  1WKM A;  1JHF A;  1QPM A;  3RQ4 A;  3M8J A;  1IN5 A;  1QQI A;  1D5Y A;  3OS1 A;  4A3C J;  1QQA A;  4DW6 A;  3JAM K;  3IP4 B;  4XR6 A;  4ZTF A;  3HYI A;  1MZB A;  1UMQ A;  3KZI C;  2FNP A;  4XLC A;  2BBY A;  1P7J A;  4MHG A;  1LMB 3;  3CC2 I;  2KPM A;  2JQ7 A;  2OQG A;  2LC2 A;  4GYI A;  3K1P A;  2UWM A;  2HVS A;  2OA4 A;  3F6W A;  2NAZ A;  4KUM A;  5E1Z B;  4X1E A;  4WXH A;  2GXA A;  2W57 A;  5F1J A;  3LAJ A;  1R22 A;  3AL0 B;  4IF4 A;  4KNY A;  2AXV A;  1GVJ A;  2PBI A;  2YS9 A;  4JX4 A;  3CJT B;  5EDN A;  1QVT A;  4XON A;  1ZLJ A;  3RIR A;  1ITY A;  3PSI A;  5HS7 A;  2BOL A;  4XBF A;  3WTX C;  1G6N A;  2XGD A;  1MD0 A;  4EM0 B;  1LDD A;  2X1E A;  4I7H A;  4F92 B;  3FBN B;  4HV5 A;  1YI2 I;  2OTJ I;  3O9X A;  4E7J A;  2MXD A;  2V1D A;  3JRG A;  1BIB A;  2K3F A;  2HDW A;  1YSE A;  3A9X A;  4D1Q A;  3GFL A;  1TQP A;  4PU3 C;  3K0L A;  3CCU I;  3MKW B;  5F64 A;  3DTI A;  3ZN0 A;  4BHB A;  2Q2E B;  2CQN A;  2EFO A;  3PSF A;  4R8H A;  2X0L A;  3D5S C;  2EPF A;  2DA1 A;  3HRS A;  3R60 A;  4EVI A;  5DSX A;  2CUF A;  2JPB A;  2HOA A;  3W6J B;  1RR8 C;  3G7D A;  4ZYG A;  3FXK A;  2B9S A;  2QSG X;  2WB1 A;  3QP6 A;  1MJB A;  1QNT A;  3T0Y A;  2Y75 A;  3ZRG A;  3S3M A;  3ZMS A;  2LLK A;  3TOA A;  4V19 K;  4XSX F;  4HA8 A;  2F4I A;  3V8L A;  2Q2E A;  2F5V A;  2XIG A;  3CTA A;  5DYM A;  2MBF A;  1TQM A;  1AA7 A;  2L1P A;  5EG0 A;  5FKL A;  2V1U A;  4F3Q A;  5A2Q Z;  1QZX A;  3Q3S A;  1ETW A;  2XGX A;  1I39 A;  2MLG A;  3O8G A;  1NK2 P;  3OMY A;  4BXF A;  2ECC A;  4CGZ A;  3BCB A;  2IVG A;  3HOX J;  1JJ8 C;  2VKH A;  1IN7 A;  4I01 A;  3TDZ C;  1ZRC A;  1YS6 A;  4KMF A;  3TEP A;  3E6B A;  5CVI A;  3BG7 A;  3A01 A;  2HPM A;  4IHT A;  3PXP A;  2BW3 B;  1Z7U A;  4MQV A;  1OCT C;  2A3S A;  4DYQ A;  5J3L A;  3SZP A;  4OIN F;  1BW6 A;  3FXM A;  5ILV A;  2XPW A;  4ENK A;  1Z7L A;  2E1N A;  4WWC A;  3IRR A;  1WIZ A;  1RZ4 A;  2QBY A;  2R63 A;  5LGN A;  3BTI A;  1FP1 D;  3OIP A;  1LVA A;  4CZC A;  2HTJ A;  1LFB A;  3CJQ B;  4ON0 A;  4IOC F;  2BY0 A;  2DMT A;  2HOE A;  4GYG A;  4L18 B;  1V5G A;  3HRU A;  1ZAO A;  3EYI A;  2FMY A;  3SHF A;  3BJ6 A;  4UUV A;  1SMY F;  2KMU A;  1WCM J;  1YYV A;  2R5Z B;  2MQK A;  3HIF A;  1YW7 A;  4D7N A;  1ORK A;  3GZC A;  2DU9 A;  3QPT A;  2XF6 A;  4CCN A;  4A3L J;  2FBH A;  2DBB A;  2M9H A;  4HF0 A;  2XCJ A;  4Y42 A;  2JK3 A;  3Q9S A;  4O6J A;  4EMS A;  3H3U A;  4JOM A;  3A4C A;  5CKT A;  1LEB A;  2KZG A;  4QPO A;  2GQQ A;  4UHT A;  3KJX A;  2P8T A;  2XAQ A;  1TT5 B;  4F93 B;  1XTA A;  2F5D A;  3N05 A;  2XSJ C;  2DJI A;  3E6D A;  4FHT A;  4GGG A;  4ZYE A;  2DK5 A;  3DF8 A;  2WB1 N;  1UHS A;  4PSW A;  4V2G A;  3MZH A;  3IH2 A;  3U1D A;  4DZJ A;  3C2H A;  3A9Z A;  2P0W A;  2Z99 A;  3V8J A;  1T56 A;  2J7U A;  1HBX G;  3FMY A;  3GME A;  5LD2 C;  1PVE A;  4OAZ A;  4CCL A;  1PP8 F;  2DMN A;  2VQG A;  1PDN C;  2KRC A;  3HC7 A;  3J81 K;  2MLK A;  2VQC A;  4E70 A;  1STZ A;  3WOD F;  5D5U B;  2JQE A;  4M3F A;  1X3W B;  2Q0O A;  3SDG A;  2DT7 B;  2HSG A;  1B6A A;  3GX4 X;  2D45 A;  4KIC A;  2QGU A;  2E2J J;  3BOQ A;  4DBR A;  1RPW A;  5FKM A;  3FKJ A;  1SFO J;  2PUE A;  2ZNZ A;  3OOP A;  5LGU A;  1LQC A;  5CLS A;  3RZO J;  2ZSH B;  3G5G A;  3EDP A;  4GQM A;  2D5V A;  4NDW A;  3LSM A;  3A2K A;  4IHS A;  3FDY A;  1U9N A;  5AIQ A;  4PGH A;  1ZGA A;  3QRF F;  3F0C A;  1S5L C;  5EEA A;  2PXQ A;  1X3U A;  1HW5 A;  4E7K A;  1R9T J;  3H5A A;  2PXU A;  1H9G A;  3KLN A;  4L5E A;  3EYY A;  3ERE D;  2R7Z J;  2LYS A;  1FBQ A;  2M1B A;  1BOB A;  2HS5 A;  1OQY A;  4BNC A;  5KK1 A;  1IW7 F;  2ETH A;  2IV1 A;  1R6R A;  3CD6 I;  1WRJ A;  3L2R A;  2FJR A;  1NK3 P;  2PXL A;  2EFP A;  4J1X A;  2KZ8 A;  3MWM A;  2PX9 A;  2EJR A;  3MFK A;  2VI6 A;  1KQ8 A;  1D1A A;  3FWE A;  1E3P A;  3QOD A;  3WHB A;  3HTU A;  1R63 A;  1DW9 A;  2HPI A;  1VI0 A;  1IDY A;  3WTV C;  2JJ7 A;  3MN2 A;  5D8K B;  1LUJ B;  4B44 A;  4CH7 A;  2K7L A;  4EM2 A;  3W3C A;  3QQA A;  1ZN2 A;  3FKI J;  2LBF B;  3GW2 A;  1GT0 C;  4WCG A;  5CQG A;  3K7A J;  2I10 A;  2I8D A;  3EET A;  2LTP A;  1QO0 D;  2M0C A;  3B02 A;  3IC7 A;  4I6Z A;  2X6Y A;  2LH9 A;  1F1Z A;  3ISP A;  3KE2 A;  3R09 A;  4RB2 C;  2EV6 A;  4RB1 A;  1DU0 A;  1XGS A;  2CJJ A;  1TNT A;  3B73 A;  4RAF A;  2CMP A;  2BNO A;  3L2W A;  1K6Y A;  4KDP A;  4PK4 A;  5CVV A;  1ZR2 A;  1WJC A;  4I99 C;  3TO7 A;  1O3S A;  2XPV A;  5F0H A;  3FMR A;  4RB0 A;  4JK1 X;  4CYC A;  3HL2 A;  2MA3 A;  4ITV A;  1ZZ7 A;  2LYP A;  1Y9Q A;  2XGC A;  3DV8 A;  4BQQ A;  3SQN A;  2IS6 A;  4LB5 A;  3SFZ A;  4B09 A;  2MGQ A;  1UHM A;  3HOS A;  1RZR A;  1P4A A;  2MC3 A;  4E7S A;  2OAZ A;  4F52 A;  2WWY A;  2GBY A;  2LD5 A;  1ZZC A;  1HXD A;  3RKQ A;  3E5Q A;  1E3H A;  1O7L A;  3QU3 A;  4RLF A;  1P2F A;  2PPX A;  1ZGW A;  1KQ0 A;  3PO3 J;  2KEI A;  4MCX A;  1T08 B;  2L02 A;  2ZKZ A;  3ZQC A;  1QZZ A;  4Y33 A;  1AKH B;  1WH6 A;  1R23 A;  3BJA A;  4M3G A;  4X4G A;  3LFU A;  3U21 A;  1XD7 A;  3DKX A;  3HGY A;  1KU2 A;  2ECB A;  2Y31 A;  4B43 A;  3ECH A;  5F0F A;  3U1K A;  2VC0 A;  2LKP A;  3F8M A;  2UXX A;  1S7A A;  1JUS A;  3W2V A;  5EZH A;  3CMM A;  2A05 A;  4ENJ A;  2IGN A;  4DIQ A;  4HRI A;  4HQM A;  1MH3 A;  3OYK A;  3SX0 A;  3DWL E;  2M8G X;  3K4L A;  3KP6 A;  1MJA A;  2TCT A;  1ULY A;  2XAG A;  2V79 A;  4I2O A;  1UXC A;  5HOO A;  5LLQ A;  3QYX A;  4YIR X;  2KHM A;  3HSE A;  3CZ6 A;  1E3O C;  3GUU A;  4XKC A;  3SEZ A;  1JUP A;  1SEU A;  1U78 A;  1NH3 A;  2QQB A;  1OSL A;  2OQR A;  5FGM A;  2WY8 Q;  1NG7 A;  2M5W A;  1ZH5 A;  3E97 A;  2MC4 A;  3BZK A;  3DEE A;  4L9N A;  4LGW A;  1QHG A;  1W5C C;  3KYC B;  5DTQ A;  3F8N A;  4IVZ A;  1UG2 A;  4G7Z F;  2ODR D;  3K1N A;  3JRC A;  3I4N J;  4OIQ F;  4ER5 A;  4PJM A;  4DQ2 A;  3ZQQ A;  1U2W A;  1SD5 A;  2VE8 A;  5C4J J;  4J1W A;  1W4M A;  2CV1 A;  1XMK A;  4XLF A;  5E18 F;  1D0Y A;  3Q9V A;  1R5G A;  1HF0 A;  5DUI A;  1IUY A;  3A0B C;  1SC7 A;  2NS0 A;  3PL8 A;  2OD5 A;  2NVT J;  5BPD A;  2KP6 A;  2K3P A;  2G0E A;  1I1S A;  1DP3 A;  4GFB A;  4ZYD A;  1X1B A;  2X6W A;  4X4I A;  2H8R A;  2HQN A;  3BWG A;  5D4R A;  2A69 F;  3WTW C;  1ZK8 A;  2PFB A;  1TQI A;  5JI6 A;  1N75 A;  2BE5 F;  3S15 J;  3LNQ A;  1HDD C;  3WTY C;  4FET A;  2BY1 A;  3F51 A;  3WG7 H;  2KJB A;  4IRI A;  2M3A A;  2XB0 X;  1MFQ C;  1PER L;  2PJR B;  3W2W A;  4RGR A;  1A6Q A;  4XIC A;  2O7O A;  3T8R A;  3H92 A;  3PIO F;  2IJL A;  4L9T A;  1E2X A;  3PIP F;  3RKX A;  3D5R C;  3T5X A;  4CA0 A;  5L3D A;  2F5F A;  2OC6 A;  4NC7 A;  4I76 A;  4EV0 A;  4OU0 A;  1XGO A;  4A3F J;  2ZME A;  4QTR A;  3OWT A;  3G4S I;  1ON1 A;  2ZO4 A;  4BEH A;  1WJ5 A;  2LKS A;  2H1L A;  2DA5 A;  3H5N A;  4MGR A;  3S2H J;  1E0E A;  2VB6 A;  3RYP A;  1UST A;  3WU1 B;  3LA2 A;  2O61 A;  1HDP A;  1X58 A;  3HDD A;  1YE9 A;  2QUF A;  2LYC A;  4NC6 A;  1G3S A;  1ZEL A;  1VQ6 I;  1X2M A;  2LMD A;  4NB5 A;  1YW8 A;  2R7Q A;  1F9N A;  4CCJ A;  5J8F A;  2FQ4 A;  4PCQ A;  4AUX A;  3CCS I;  1K6O A;  1Q1H A;  2R0Q C;  2EFW A;  2VQH A;  2VON A;  1QQB A;  2K27 A;  3P9K A;  3MEJ A;  3UWP A;  2FOW A;  4KJZ A;  3CEC A;  1XMX A;  3G1L A;  4Y4R A;  3WU2 C;  4XQF A;  2L01 A;  2BGC A;  4KYW A;  2GOX B;  3IHU A;  2O8X A;  3EUH C;  3G3Z A;  4A3B J;  1IRG A;  2O0Y A;  3CCV I;  2GRL A;  1GV5 A;  2JA2 A;  3F9K A;  1UFM A;  3RQI A;  1LCC A;  3I59 B;  1TLH B;  2HQ5 A;  3QPL A;  2J5O A;  4YEJ A;  4C2U A;  1IXC A;  1D1C A;  1OPC A;  2XV4 S;  1UHW A;  3JAM Z;  2HIN A;  2HYF A;  4U87 A;  1QP0 A;  1TWH J;  3ZMU A;  4JP0 A;  4XRF A;  3CES A;  2LDU A;  5K1Y A;  3M8F A;  1ZHF A;  1ETY A;  1JT6 A;  2BY2 A;  1ZLK A;  4KA4 A;  2ZNY A;  2V3C C;  2E5Z A;  1G4D A;  1K4S A;  5E3N A;  2X9D A;  3BG3 A;  3FMQ A;  2FE3 A;  2FXA A;  2HFH A;  1Y56 A;  2R3S A;  2XAS A;  1IJW C;  2FD5 A;  3R1F A;  2LNB A;  3K9T A;  3AG1 H;  4EEF G;  5EJC A;  4O5V A;  1J9I A;  2XXA A;  4CHU A;  5GPA A;  2QA4 I;  2EIM H;  5L3C A;  1HKT A;  2M45 A;  5HLH A;  1VQ4 I;  2LY9 A;  3S93 A;  2VJJ A;  1U5T C;  4YII A;  1BI1 A;  4PU4 C;  4A93 J;  3LA7 A;  3CP2 A;  2ZME C;  4HF1 A;  1Y0N A;  3K1M A;  2QZ8 A;  3K10 A;  4W1U A;  1UTX A;  2RAE A;  4HAM A;  1LE8 B;  3B6A A;  2JZY A;  2XAF A;  4C30 A;  1BJA A;  1HKS A;  4HLX A;  4XK4 A;  1FYK A;  4X4H A;  4BL0 B;  3DBL B;  2O4A A;  4DGW B;  4UVA A;  4KMU X;  4HV6 A;  2WBM A;  5F6F A;  1FC3 A;  3ESW B;  1K4T A;  1SD7 A;  1IN6 A;  4UB8 C;  3ZP5 A;  1HW2 A;  1SD6 A;  5ICC A;  1U6G A;  3BPX A;  3A02 A;  4P9F A;  4I6U A;  3UR3 C;  4OMZ A;  5EEH A;  2LF8 A;  1DUL A;  2ZXI A;  1IRX A;  2OCC H;  2VJ5 A;  3HSF A;  3FXJ A;  2ACJ A;  1YG2 A;  2NOG A;  2P6T A;  4ZTJ A;  2AWI A;  3BR2 A;  3ZPX A;  2JUC A;  2VXD A;  1TWA J;  4JBA A;  1BN5 A;  3ZXS A;  2LKX A;  4ESB A;  2IU7 A;  3L00 A;  4LLL A;  3ZGK A;  1PUF B;  3G73 A;  2M4H A;  2XC7 A;  4PGG A;  3ZQL A;  2BV6 A;  2PI0 A;  1J0R A;  3LQQ A;  2Z2S B;  1ZRF A;  1XGM A;  5H20 A;  1P4W A;  2E7X A;  4PFO A;  1ZZ8 A;  2CUE A;  2P7C B;  1YFH A;  1LFU P;  4XID A;  1R58 A;  2YU3 A;  1WJA A;  3Q5F A;  3Q0V A;  4RA2 A;  2ZXJ A;  4AYB A;  3JRI A;  2V9P A;  1FYM A;  3ZOB A;  2MG4 A;  4B8X A;  3B7H A;  3K4J A;  2BHZ A;  3M1C A;  4D0P A;  5J4Y A;  4M74 A;  3TBI A;  3I5U A;  2PXK A;  1ZG1 A;  1ETK A;  4CCO A;  2E35 A;  2PXB A;  1RR7 A;  4KN7 X;  5BOX A;  1T33 A;  3NRO A;  1MKM A;  4IVN A;  1Y1W J;  3I4M J;  3SEQ A;  3LFP A;  1D3Y A;  5EYR A;  3E5X A;  5FRO A;  4CSW A;  1T2K A;  1RI7 A;  2FU4 A;  2L9R A;  3BDN A;  2GA1 A;  1FSH A;  3SCF A;  4RM2 A;  3CCE I;  2K9M A;  3A0H C;  5TRD A;  3MKZ A;  3WGH A;  2EWT A;  4FE4 A;  1XWR A;  1DGW Y;  2RV8 A;  4RBO A;  4IOA F;  2R7F A;  1SFK A;  1ZTR A;  3SZG A;  4PU7 A;  4G7O F;  5GPC A;  1I6H J;  1ZS4 A;  3I58 A;  2EQR A;  3GFM A;  2DN0 A;  1R5I D;  4HOB A;  1FTZ A;  2JPC A;  1ZG5 A;  1APL C;  3VYR B;  1PRV A;  2BHY A;  1RNL A;  2DFE A;  2ADU A;  4M9Z A;  3BZ6 A;  2DA3 A;  1WWX A;  4HNV A;  1EV7 A;  3EUS A;  5LFA A;  2L49 A;  2L5Q A;  2DMU A;  2CV2 A;  1QB2 A;  3ZPL A;  4A0Z A;  4BXU A;  5DEQ A;  2XAU A;  1NER A;  4M71 A;  3PJR A;  2VXZ A;  4UUS A;  2Q8K A;  4E7Z A;  1FIA A;  5GAG i;  2E2H J;  2HKX A;  5ICE A;  2XGE A;  4ZZD A;  3C7J A;  1V3F A;  2X85 A;  2V6C A;  2XIU A;  1RRJ A;  1ZUG A;  4PZJ A;  2NVX J;  1REP C;  3S17 J;  3E0J B;  2QF7 A;  5M3M J;  1IV8 A;  2KEK A;  4HEA 2;  4A3J J;  4V2F A;  3NEU A;  2XF5 A;  3HEF A;  2PMZ A;  4P1W A;  1ZPQ A;  1RES A;  1TZL A;  1OKR A;  1JKR C;  6PAX A;  1KYW A;  5L3G A;  4KIG A;  4AYB N;  3GFI A;  1N78 A;  4E7L A;  2H6C A;  2HTS A;  2K9S A;  2WAF A;  4YIF A;  1U2Z A;  1XS9 A;  3FXR A;  1OYI A;  2V9V A;  5E8I A;  2PUA A;  1PRA A;  2HQR A;  5JVT A;  4EQZ A;  3GCM A;  3CLC A;  2YUS A;  4I0B A;  3SZT A;  5IYC J;  2K4J A;  1WGX A;  2QQ8 A;  1RKW A;  1VF9 A;  2A5W A;  4OMY A;  1G3Y A;  3FX3 A;  3D0S A;  1ZAR A;  1WPK A;  2PUC A;  4J00 A;  1DUX C;  2JT1 A;  1QZY A;  2LRD A;  3OYH A;  3JRF A;  3EPZ A;  1B1B A;  3LSG A;  4LOC A;  3FIS A;  3FIW A;  2IEK A;  4A3E J;  1JFT A;  4IWR A;  4ABZ A;  2CW8 A;  4OIP F;  1B0N A;  5DTM A;  3PM1 A;  2EZK A;  2JWT A;  4XLN F;  4ER0 A;  2CO5 A;  1ETQ A;  2VKE A;  2FUG 2;  2E5N A;  2VN2 A;  1MIJ A;  2YPR A;  2P6S A;  1VQP I;  1MSF C;  5K7H A;  2FFH A;  3VOD A;  3UKG A;  2DXI A;  2Y2Z A;  3PUF A;  4HRA A;  1T95 A;  5HDN A;  3DLL F;  4DBQ A;  2EK5 A;  3GTQ J;  2LR8 A;  4MFE A;  1VND A;  2R4G A;  4C3I J;  3L2U A;  2DA2 A;  3R4K A;  1TW3 A;  3OL3 A;  1RUO A;  2E71 A;  2PJP A;  3DEU A;  1GV2 A;  4YFN F;  2OBP A;  3HB9 A;  3K2Z A;  1XPX A;  4OB4 A;  2PUG A;  4LG0 A;  1L3L A;  3F21 A;  1R5H A;  1GVD A;  2HFZ A;  3VEP A;  2R93 J;  1JWL A;  2BY3 A;  3IL2 A;  4L5I A;  5IOZ A;  2LYR A;  1IZ1 A;  4BE1 A;  4RAG A;  1M1E B;  5FKK A;  3KL4 A;  5DRY A;  5EG0 B;  2QVO A;  3R61 A;  3GBF A;  1XCV A;  1KQ9 A;  3QYE A;  2JA5 J;  1VQM I;  1ACI A;  1MMG A;  2E19 A;  3NWS A;  4NQW A;  1V54 H;  4MIM A;  2JRT A;  3OIQ A;  3Q0W A;  3ZQH A;  4HBL A;  5H2F C;  2LFB A;  4U7D A;  3HRM A;  4YG2 F;  4AIJ A;  2VQL A;  3RPU A;  4KIS A;  2MSY A;  3CME I;  2FSW A;  3DKY A;  2PMZ N;  1HQC A;  2LSO A;  1D5V A;  1XDU A;  1S9H A;  2A07 F;  2L7M P;  3A01 B;  2BEO A;  3H36 A;  4RGX A;  2KPJ A;  4Z2Y A;  1FOY A;  2HWV A;  2MH9 A;  2QYO A;  5K7Z A;  2JA8 J;  1EFA A;  1K79 A;  2FEZ A;  4JQD A;  2X6O A;  3P7N A;  1XMA A;  4XRM A;  2EV5 A;  2C6Y A;  1W5S A;  2QBY B;  5BPI A;  4WVL A;  3IAM 2;  2ELJ A;  5BS6 A;  2N8G A;  3KX2 A;  4B47 A;  5E17 F;  4A2U A;  3LOC A;  2VKD A;  5B3S H;  3L2C A;  3FM3 A;  1H8A C;  1E17 A;  2XXP A;  3F52 A;  5A7L A;  3KP3 A;  3IKV A;  3MEX A;  4BAC A;  4I6R A;  3FXO A;  3HTS B;  4QIW N;  1R1V A;  1WFX A;  1W5T A;  1XCB A;  4XLP F;  3OSG A;  2GRM A;  2LYJ A;  1HLV A;  4IL6 C;  2DQL A;  2NYX A;  3HZJ A;  2JVH A;  3O2P E;  4E7H A;  5HDG A;  3LMM A;  3ZMV A;  3HPH A;  1VQO I;  2LYL A;  1I6X A;  2DPD A;  3PFI A;  2Y0M A;  2JVG A;  4KFC A;  2BJC A;  2G7H A;  4XLH A;  1KGS A;  4Y7N J;  4BH9 A;  4MLO A;  1W7P A;  3JCU C;  3SYT A;  5TJJ A;  2RVC A;  2V4J C;  2HI3 A;  4BU2 A;  3SR4 A;  1Z3Y A;  5KAF C;  3S3N A;  1TNS A;  2IAI A;  1FOW A;  2CG4 A;  2WUS R;  3RPQ A;  2IP2 A;  2AUW A;  3MZ8 A;  3DNV B;  1I5Z A;  3IVP A;  1RC9 A;  1QA6 A;  2K02 A;  2DLL A;  4KIB A;  3S2D J;  5ILU A;  3LSK A;  2LY2 A;  1WJD A;  3RPU D;  1LLI A;  2WY7 Q;  1I3Q J;  3OL4 A;  3PNV A;  4YEL A;  3MD2 A;  4A0X A;  4MEX F;  1ZVV A;  1UB9 A;  5DV5 A;  2KJC A;  1ZZB A;  4XL9 A;  2KQR A;  2MEZ A;  2O3F A;  4X4F A;  1BJZ A;  2LLV A;  2JN6 A;  3CC7 I;  2F5C A;  1ZG3 A;  4U0V A;  5GAH J;  4A3I J;  2TDX A;  3ZKC A;  2PMU A;  2HQA A;  3M07 A;  1T0F A;  4X4D A;  1BOA A;  1R36 A;  5CQE A;  1FZP B;  2A5Y B;  3U2R A;  3NWT A;  3QOP A;  2L7F P;  2WA0 A;  3LFK A;  1SVM A;  1TT0 A;  2EA4 A;  1B9M A;  4FBI A;  2VKV A;  2GIZ A;  3QOW A;  3G1M A;  1OCZ H;  1B72 B;  3MAJ A;  3UNG C;  3MCZ A;  4RB3 C;  3NXH A;  3K70 D;  3MMY B;  1IC8 A;  2BNM A;  4OOI A;  1MJ9 A;  3GTO J;  2KIQ A;  3OR2 C;  2BXZ A;  2GZU A;  4PSX A;  1XGN A;  5EEG A;  4E7I A;  1YIJ I;  1MBE A;  3KEQ A;  3K70 C;  2Y48 A;  2HCS A;  2DO7 A;  3H9Q A;  3HXL A;  1D0Z A;  3BR0 A;  3ML6 A;  4XOP A;  1EJ9 A;  1B72 A;  1W7P D;  3CCY A;  1S72 I;  3JRH A;  2FNA A;  3CO6 C;  4S04 A;  1PRU A;  1HA8 A;  2DOA A;  4BQO A;  4CIC A;  1T39 A;  2NVU B;  2FOK A;  2COB A;  4TV7 A;  1G3T A;  4ASN A;  1ETO A;  4UY8 I;  4HDV A;  3DFG A;  3LSJ A;  1YHQ I;  3VOE A;  2XUB A;  3BG6 A;  3ZMD A;  4L0Y B;  5EGO A;  1D0X A;  1I50 J;  1JE8 A;  1BR1 A;  2IVM A;  4I98 B;  1UJ8 A;  1X1A A;  5F08 A;  1MMD A;  4M73 A;  2CUJ A;  2LG4 A;  3KEO A;  4CZZ A;  4I8T A;  2O9L A;  1YLF A;  4JCY A;  2ZJP F;  1J7K A;  5F27 A;  3TOB A;  1TC3 C;  1POG A;  5JLW A;  3F3X A;  2LLW A;  5J1R A;  1OYY A;  1S7O A;  4M72 A;  3QF3 A;  3V42 A;  2PUB A;  4EJW A;  4CYC B;  4IQJ A;  4EKG A;  2PMH A;  1H0M A;  2HKO A;  2IT0 A;  1NHA A;  2UV1 A;  3LSI A;  4L9J A;  2E1C A;  2J5P A;  1RIO A;  4FE7 A;  2WTE A;  3DU5 A;  4BE0 A;  1A35 A;  2HXI A;  3CMA I;  4BXX J;  4MEY F;  1FLI A;  4OIR F;  2HEO A;  5AON A;  3T1B A;  1T0F C;  5ED4 A;  4A5N A;  4X4C A;  3GTM J;  1AU7 A;  4WX9 A;  4S05 A;  1B8I A;  4F91 B;  5ICG A;  1KU3 A;  3IH4 A;  2R5Y A;  1U9O A;  4CDG A;  1JGS A;  1FBU A;  5ERI A;  3J80 K;  4W97 A;  1I27 A;  3EQL F;  1V55 H;  1W0T A;  4Q5S F;  4OIO F;  2M0M A;  4NBQ A;  3S1R J;  5FRN A;  1SFU A;  2KLO A;  1EH7 A;  2K86 A;  3BDD A;  3ZMT A;  3GVA A;  5FJ8 J;  3VYU B;  3E1S A;  3S3O A;  1JFS A;  1AHD P;  2E1M C;  1ENH A;  2QSH X;  4WXC A;  2MD5 A;  1LDK B;  2DYS H;  2FRH A;  3PQJ A;  4UVC A;  3CDH A;  1SFX A;  3BQY A;  3OYF A;  1FIP A;  2HR3 A;  3AFH A;  2VE9 A;  2STT A;  2NRA C;  2HDC A;  4FTH A;  5KAI C;  3CUQ A;  3K4M A;  4LD5 A;  3TMO A;  1OIS A;  4BQN A;  2DJN A;  4HX4 A;  1DPU A;  4FX4 A;  3DPL C;  2E2I J;  3S14 J;  1OLT A;  2ELK A;  1T6S A;  2CQQ A;  2X48 A;  3R6S A;  2MW8 A;  3GBG A;  2RQP A;  2VBZ A;  3FBI B;  3TW7 A;  5HVQ C;  5C3E J;  1K61 A;  3ABL H;  3OWQ A;  2DAO A;  4HYE A;  1VZ0 A;  5CYV A;  3I3L A;  1RPE L;  3GFJ A;  2EIK H;  1WH5 A;  5GTH C;  1T38 A;  2QEN A;  1RIO H;  5DTD A;  4KT6 A;  3MKL A;  4GHJ A;  4I6T A;  3DCF A;  3RI4 A;  2KL4 A;  3V8K A;  2PXD A;  3KFW X;  1V4R A;  5LRS A;  2IBD A;  3IWZ A;  4BBS J;  1ZGJ A;  5KNL A;  3M9L A;  1QPZ A;  2VIX A;  3CLQ A;  3VB2 A;  1OJL A;  2DFI A;  2VOP A;  2WAE A;  3MVP A;  3TKY A;  3EUH A;  4D9J A;  3DM5 A;  1X3Z B;  1BA5 A;  2R7O A;  4Y17 A;  4ANJ A;  3JSP A;  2B63 J;  4IRG A;  1D8K A;  3I54 A;  1ETX A;  2W25 A;  3H0G J;  4XKV A;  5DM7 F;  1C0W A;  4AVP A;  4XLA A;  5DDG A;  3LL7 A;  3GN5 A;  5K5Q A;  4I0A A;  4WXD A;  3M8E A;  4XKB A;  4L0Z B;  3A9Y A;  1P6R A;  1ETV A;  3H9J A;  3K4C A;  4UV9 A;  4C9Y A;  2QEX I;  4AIH A;  3VWS A;  4B4C A;  1Y1V J;  3WTZ A;  2AW6 A;  4ZDO A;  1YRN A;  3GLX A;  2NXN B;  2WV0 A;  4OWR B;  3CMY A;  2ZME B;  4PJL A;  5CVJ A;  4KT5 C;  2GLO A;  1SAU A;  3GZ6 A;  4BEH B;  3RZD J;  2HZD A;  1IUF A;  1TWG J;  2OJE D;  1LB2 A;  2EB7 A;  3NAR A;  3OYA A;  4HX7 A;  1D8J A;  1OCP A;  2VL8 A;  3ECO A;  1Y39 A;  1QZE A;  4BJ6 C;  1LEA A;  2EFQ A;  3M3Y J;  4AC0 A;  1YX3 A;  5LHI A;  3CUQ C;  3ABM H;  2IW5 A;  3FZV A;  4BHP A;  1U5T A;  1X1C A;  5J47 A;  3CCM I;  2CGP A;  2RDP A;  2L9V A;  2D2W A;  2PLY A;  5DS9 A;  3DKW A;  1QRY A;  1WI9 A;  4EJU A;  3NAU A;  3ZN1 A;  4F55 A;  4U7B A;  3O6B B;  1H88 C;  2VJ4 A;  1J09 A;  4Y52 J;  1YIT I;  3PE5 A;  5HDK A;  5GTI C;  4LFU A;  5GP9 A;  1USS A;  5E20 A;  2RNJ A;  2HU9 A;  1K78 B;  3VWB A;  3IRQ A;  5DRT A;  2CYY A;  2KRF A;  5FLV A;  1FMV A;  4BUP A;  2GA2 A;  3JRB A;  3CC4 I;  1ERD A;  2LYK A;  1WVR A;  3HRT A;  4ZYH A;  3H3V K;  4G6Q A;  3L2V A;  3CF5 F;  2KKO A;  1I1G A;  4AM3 A;  2WC2 A;  1X4P A;  4YRV A;  5GAG J;  4Z6Y A;  1IN8 A;  2QM3 A;  3WTU C;  3GTK J;  1XSV A;  1X2N A;  3ABU A;  1BI0 A;  1WH7 A;  5D5X B;  1IN4 A;  3NZL A;  3GWZ A;  5B66 C;  1K78 A;  3FM5 A;  1YO5 C;  3K6G A;  5FLX K;  2Z5U A;  1S29 A;  2VBX A;  3OYJ A;  2K85 A;  3KCC A;  4ZZL A;  2EF8 A;  4Y13 A;  4M3E A;  2P5K A;  3OQO A;  3QWG A;  2F4O B;  2JRM A;  2OTL I;  1BBY A;  5TGT A;  3VK0 A;  3SCG A;  1MGT A;  2XB5 A;  5JVG F;  1LQ1 A;  3FYA A;  1RKT A;  3GTG J;  2DA7 A;  4GXO A;  3GTP J;  4IX7 A;  2ZSI B;  1WZ2 A;  4ER7 A;  4II2 A;  1S7E A;  1SAX A;  3P9C A;  3OYG A;  4X4E A;  3HG9 A;  1WI3 A;  1BC8 C;  1HC8 A;  3QOX A;  2QKM B;  3KP4 A;  2H94 A;  1BM9 A;  3K4B A;  1V5F A;  2R7V A;  2L54 A;  3EUK L;  3ULQ B;  4EQQ A;  1S8N A;  3PFY A;  3H5R A;  3COA C;  1L1M A;  1JKQ C;  1IV6 A;  3ASN H;  3K4K A;  5FD5 A;  4XOT A;  2GZW A;  3ZQ7 A;  1QVU A;  1VPW A;  3IUO A;  4P96 A;  2FBI A;  3BR6 A;  1SFE A;  3KYL A;  1XN7 A;  3V4G A;  4EAT A;  4IHV A;  5IT3 A;  2JCG A;  2L3D A;  5FRM A;  2ISZ A;  4LIV A;  3VSL A;  3IWF A;  1BDI A;  2A61 A;  2W00 A;  2PUD A;  3DLA A;  1WH8 A;  4YG1 A;  2O6G E;  4IJA A;  2M8E A;  4FT8 A;  2L7K A;  3OYB A;  2HXO A;  1YJN I;  2HYG D;  1DDN A;  2R7W A;  1Z77 A;  4FCY A;  1PNR A;  1MDM B;  4R1H A;  3DXJ F;  3J7A Y;  3QQ6 A;  2A68 F;  3DBH B;  4BE2 A;  3S1M J;  3BC8 A;  4ZJZ A;  3DPT A;  2MH2 A;  4ETS A;  4DE8 A;  2R92 J;  1ZRE A;  2K9N A;  4IQ4 A;  3WTS C;  1O3Q A;  1AWC A;  3DTE A;  1MNM C;  4E4H A;  3QYB A;  4P9U A;  2MAB A;  2R7D A;  2Y0S A;  4DYC A;  3ELK A;  4CYD A;  3V7R A;  4DE9 A;  4CO8 A;  1IXR C;  4HST A;  4II3 A;  1BIA A;  1FWZ A;  3H35 A;  3QPH A;  3V7S A;  2XSD C;  3CCQ I;  4G7H F;  4BJT A;  4YFX F;  2B0L A;  2QLZ A;  4XSZ F;  1FX7 A;  1MDM A;  4ENM A;  3RCO A;  1EH8 A;  2X4H A;  4S0H B;  5GAD J;  3BT9 A;  2M7A A;  3GZD C;  2HZT A;  2V6E A;  2LNM A;  3CCJ I;  3OYN A;  3HOU J;  3EUA A;  3BR1 A;  4XNF A;  3G71 I;  2DMQ A;  5F1R A;  4QLC U;  1VQN I;  3BTC A;  5LEK A;  3AG2 H;  2O03 A;  4IXA A;  1MND A;  3OY9 A;  1MBG A;  2OF7 A;  2ZCW A;  3GUD A;  1W36 D;  2WIU B;  2M4K A;  2VJI A;  3VDX A;  2KEJ A;  3CQZ J;  5B5E C;  4Q2J A;  2B5A A;  2R7U A;  2MFZ A;  1YOV B;  3TDU C;  3G0T A;  5BNG A;  1EH6 A;  1ZKG A;  3GLL A;  5KHD A;  1W36 C;  4I02 A;  4PDK A;  4K2E A;  5LBQ A;  3MLF A;  3OYM A;  1FSE A;  5DCM A;  2DT5 A;  3G2B A;  1H89 C;  3LIS A;  2DPU A;  2H09 A;  3DP7 A;  4G94 A;  4HG2 A;  5GAE J;  1WSU A;  4HQE A;  4GDF A;  4UUS B;  2O5R A;  1XDS A;  1IG7 A;  4ESJ A;  4L5J A;  2PN6 A;  4EZI A;  1HW1 A;  2BXY A;  2XJ3 A;  2VT2 A;  5JFR A;  1BL0 A;  2IA0 A;  4AU7 A;  4A69 C;  3KP7 A;  2A6H F;  2LF7 A;  5J4V A;  2AO9 A;  2IRF G;  3TO6 A;  4Q47 A;  3HKZ A;  3KP5 A;  4X4B A;  2DOF A;  3M1E A;  1LCD A;  4QSH A;  4XKW A;  3FF5 A;  5D6E A;  4KIT B;  2ID3 A;  1PUE E;  3AAF A;  4EJV A;  5K7F A;  2YX4 A;  2HNH A;  1IRZ A;  3C18 A;  2WAD A;  2Z9O A;  2VLA A;  3OS2 A;  2E1O A;  1R1T A;  4ENN A;  1FYL A;  2JA6 J;  2PIJ A;  1LVK A;  4LB6 B;  3TO9 A;  1TP4 A;  2E7W A;  1DWK A;  1OR7 C;  1RZS A;  5L3E A;  3K4N A;  2DTR A;  2Y0S N;  5D5W B;  4AWX B;  1XB4 A;  2UUZ A;  3OV8 A;  4DYR A;  3J81 Z;  3W6K B;  4MTD A;  3CF2 A;  3TQN A;  3CRO L;  1D1B A;  1R49 A;  2L4A A;  2WAQ A;  3I56 I;  4RDU A;  3JTH A;  2K9L A;  3QOE A;  1ZZ6 A;  4CUG A;  4BY1 J;  2CSO A;  3D1N I;  1QP4 A;  2ESH A;  4ZDP A;  3HOZ J;  3TFL A;  4B48 A;  1Y7Y A;  4NUB A;  3CCR I;  2OU2 A;  3H9G A;  2XDV A;  1YQA A;  1JGG A;  5E79 C;  1B9N A;  2VPR A;  2R7S A;  2XKO A;  2NOJ B;  2Y9Z A;  2F4M B;  3WHC A;  2EA2 A;  2QKL B;  4LJZ F;  5FFZ A;  2E34 A;  1YIO A;  4YG7 B;  2JA7 J;  1NG6 A;  2W4S A;  3FXU A;  4AID A;  3I0T A;  2D1V A;  3H1C A;  2O38 A;  1A04 A;  3CLO A;  1FP2 A;  3L7W A;  3RDI A;  3P9I A;  4N4N B;  1OYW A;  3ZMZ A;  4RAY A;  4LG0 B;  4P5O A;  2B7E A;  4FIS A;  3HJE A;  3G6E I;  1FEX A;  1R69 A;  2AXU A;  3ROU A;  3GZ5 A;  1Z91 A;  4E6K G;  3J7Y J;  2O8K A;  3RZZ A;  1JI8 A;  2V26 A;  2L7Z A;  1HCR A;  2ISY A;  3P5J A;  3QAH A;  5B1A H;  4G12 A;  3HUG A;  1JUM A;  2PQ8 A;  4IHX A;  3HOY J;  3R0A A;  2LRE A;  2AHQ A;  4NQW B;  4Z5H A;  1O7F A;  4IKF A;  2YSR A;  1V5E A;  3CDL A;  1HSJ A;  4GRI A;  2WV1 A;  3HKZ N;  1R4N B;  5BMZ A;  2EBY A;  1P9Q C;  2PXE A;  1B4A A;  3ZQG A;  1TTY A;  2I5U A;  1TW2 A;  2QQ9 A;  1GLN A;  2DDA A;  3ABT A;  4MFD A;  4XRS A;  3OYL A;  2FF4 A;  2HOT A;  1WET A;  5F04 A;  2GAU A;  5JLX A;  3F23 A;  1ZRD A;  2EIL H;  2CFO A;  1FMW A;  2FML A;  2LYQ A;  4AVZ A;  3J80 Z;  4A3G J;  2HCN A;  5DUK A;  3ZHM A;  4Q4Z F;  3IV5 A;  1LDJ A;  2KDO A;  2DDB A;  3KEY A;  3LST A;  2OCE A;  2MYS A;  3L2Q A;  3SCH A;  3C2G A;  2HVQ A;  2WAQ N;  3FK7 A;  3U9G A;  2PXT A;  4YG4 A;  2VPL A;  3ME5 A;  3WGG A;  2A6T A;  3KET A;  2DOD A;  2CW7 A;  2IS4 A;  1OCO H;  4CCM A;  1FPQ A;  1MBH A;  3IAS 2;  4MCT A;  4HDU A;  2V7F A;  2ZFW A;  2GOM A;  4Z5D A;  3OR1 C;  3KZY A;  3NRV A;  3X2Q H;  3TW6 A;  2RRE A;  1XSD A;  4HW0 A;  1Z9C A;  2EZH A;  2KIF A;  3JTG A;  1U8R A;  1UXD A;  3BTL A;  3E5U A;  2BYV E;  5CPR B;  2IUO A;  2GWR A;  3WG9 A;  1AOY A;  1CJG A;  3J7A O;  5LHG A;  1MW7 A;  1P7I A;  1LPQ A;  2PEX A;  5CJ9 A;  2M7B A;  1W7P B;  2CQX A;  3BQZ A;  1QP7 A;  2DFF A;  2CQ7 A;  4PU8 A;  1LNW A;  2VC1 A;  5J6X A;  2IGK A;  4LIU A;  3RYR A;  2CRO A;  1FBS A;  2FJ1 A;  4XN3 A;  3I71 A;  2CFX A;  2G7U A;  4M9X A;  3AG4 H;  3NDB B;  1OMI A;  2YBD A;  4PJJ A;  1R1U A;  3F72 A;  2DMP A;  1R00 A;  2H8W A;  3DU6 A;  2XHK A;  1L0O C;  1Z6T A;  1PP7 U;  2XXQ A;  2VT3 A;  3TRB A;  4UNO A;  1S3J A;  3IKT A;  4M3B A;  4MO7 A;  3N4M A;  3OIO A;  2P4W A;  4F7Z A;  2QCO A;  2AQE A;  4A6D A;  3LQX A;  2FX0 A;  4BS9 A;  2Q1Z B;  2XRL A;  2W7N A;  3S1Q J;  1DP7 P;  3BS3 A;  2CW0 F;  5H6R A;  1JKO C;  3HSR A;  2Z16 A;  1JXS A;  3HGG A;  3AG3 H;  5FLM J;  1S6L A;  1SD4 A;  2PE5 A;  3REO A;  4M6V A;  2M87 A;  4JX5 A;  4A3K J;  5K5R A;  4HX8 A;  2BW3 A;  5HLT A;  2CSF A;  2BNN A;  4RLQ A;  3AL0 C;  3OKZ A;  2CS3 A;  4G8X A;  2OFY A;  1A6I A;  5ILS A;  2UZK A;  2YR2 A;  3L09 A;  3QP5 A;  3GTL J;  4CXF A;  2EH3 A;  2CWE A;  2ZJ2 A;  3HOT A;  3S16 J;  1QU3 A;  2XVC A;  3VYS B;  3U3W A;  5DCF A;  2ME0 A;  2TRT A;  4H0E A;  1FY7 A;  1XSX A;  3DBR B;  1TWC J;  2VOO A;  2E1M B;  5EF6 A;  3HPG A;  2UXN A;  2MD0 A;  1SQ8 A;  3DPU A;  3TEL A;  4Y15 A;  4EK9 A;  3PQK A;  2H27 A;  1IRF A;  4RGS A;  4U0Y A;  5IYB J;  2R5Z A;  3KXA A;  3BD1 A;  1JH9 A;  3BZC A;  1CQT A;  2L8N A;  3G1O A;  2ZJQ F;  3RSN A;  1WHU A;  2L9S A;  3KZZ A;  4U88 A;  4OAY A;  1MMA A;  3J7Z I;  1X4O A;  5IT9 K;  3LQR A;  2HDD A;  4RMN A;  1FOK A; 
#chains in the Genus database with same CATH homology
 2NOG A;  4FN3 A;  2AWI A;  3BR2 A;  2AXV A;  5EGO B;  1ETV A;  3VPR A;  1TWA J;  1NTC A;  2LKX A;  2YS9 A;  4JX4 A;  5EDN A;  3S1N J;  2EBI A;  1QVT A;  1Y1V J;  4B4C A;  2IU7 A;  2AW6 A;  1PUF B;  1ITY A;  1YRN A;  3JXC L;  3ZQL A;  1HOM A;  2AXZ A;  3CMY A;  2XPU A;  2XGD A;  3B6C A;  4F8D A;  2GLO A;  3O9X A;  2NVY J;  1ZZ8 A;  3RZD J;  2HOS A;  2CUE A;  3JRG A;  1FTT A;  1LFU P;  4XID A;  1IUF A;  1TWG J;  1YSE A;  3NAR A;  3Q0V A;  1OCP A;  4PU3 C;  3JRI A;  3M3Y J;  3ZOB A;  1BDH A;  2MG4 A;  4AC0 A;  3B7H A;  1XG1 A;  5M5W J;  2DA1 A;  3JRA A;  3HM5 A;  2KDZ A;  2CUF A;  1GUU A;  2HOA A;  4BBR J;  5DS9 A;  1B8I B;  1ETK A;  1QRY A;  5J1Y A;  3G7D A;  3NAU A;  1H88 C;  2R5Y B;  1MBJ A;  1RR7 A;  1TWF J;  1ZZ9 A;  3FYM A;  3KZ3 A;  4Y52 J;  2LLK A;  5GP9 A;  1T33 A;  3E7L A;  4IEJ A;  5FLV A;  1Y1W J;  3JRB A;  3I4M J;  5IP9 J;  3BR3 A;  2LYK A;  3LFP A;  3H3V K;  2ID6 A;  5EYR A;  3FK6 A;  2EZL A;  5EG0 A;  5FKL A;  3OMT A;  2L9R A;  3Q3S A;  2M2E A;  3JR9 A;  3UFD A;  3BDN A;  3SCF A;  1ETW A;  1MH4 A;  4O8B A;  2EWT A;  4FE4 A;  2IVQ A;  3O8G A;  1XWR A;  3GTK J;  1X2N A;  4RBO A;  1WH7 A;  1NK2 P;  1ZTR A;  5E3M A;  4PU7 A;  2ECC A;  4IHY A;  5GPC A;  1I6H J;  1ZS4 A;  2IVG A;  2EQR A;  3HOX J;  1JJ8 C;  2DN0 A;  5K98 B;  2VUM J;  1FTZ A;  4M3E A;  2EF8 A;  3H5T A;  1APL C;  4JCX A;  3OQO A;  1PRV A;  3QWG A;  3A01 A;  3PXP A;  3VK0 A;  3SCG A;  2H1K A;  1OCT C;  3TP0 A;  2DA3 A;  2XB5 A;  4DYQ A;  4HNV A;  3EUS A;  5J3L A;  3FYA A;  2L49 A;  2DMU A;  1RKT A;  1BW6 A;  3GTG J;  2CRG A;  2DA7 A;  2XPW A;  3GTP J;  2M34 A;  5E3L A;  1NER A;  1WIZ A;  3LSR A;  2R63 A;  4UUS A;  1S7E A;  2NS8 A;  3BTI A;  1FIA A;  4X4E A;  3OQN A;  1WI3 A;  2CU7 A;  2E2H J;  1LFB A;  2XGE A;  4B1R A;  1OFC X;  2XIU A;  2W48 A;  1EF4 A;  3C2B A;  1ZUG A;  2DMT A;  2NVX J;  3HOW J;  3S17 J;  5M3M J;  2QF7 A;  2KEK A;  1L1M A;  4A3J J;  1JKQ C;  4V2F A;  3JRD A;  1IV6 A;  3HEF A;  1ZPQ A;  1RES A;  1WCM J;  2R5Z B;  1JKR C;  4D7N A;  1ORK A;  1VPW A;  3Q0U A;  1QVU A;  1ADR A;  4AYB N;  3BR6 A;  4A3L J;  2K9S A;  4IHV A;  1XS9 A;  3GN5 B;  2M9H A;  3S8Q A;  2JCG A;  2XCJ A;  4Y42 A;  2JK3 A;  4YBA A;  2PUA A;  9ANT A;  4NDL A;  1PRA A;  4Z58 A;  1BDI A;  3CLC A;  2YUS A;  3KJX A;  2PUD A;  5HOD A;  1WH8 A;  4YG1 A;  5IYC J;  1YRN B;  1WGX A;  1RKW A;  1VF9 A;  1AKH A;  2WB1 N;  1UHS A;  1QPI A;  4V2G A;  1WPK A;  2HXO A;  3IH2 A;  4DZJ A;  4YAR A;  2PUC A;  4IA8 A;  1Z77 A;  4FCY A;  3JRF A;  1T56 A;  3LSG A;  4LOC A;  1PNR A;  3FIS A;  3FIW A;  2IEK A;  4A3E J;  3FMY A;  3QQ6 A;  4ABZ A;  1B0N A;  1JFT A;  4IWR A;  3PM1 A;  2EZK A;  3S1M J;  2JWT A;  2DMN A;  3OOU A;  1W0U A;  1ETQ A;  2K9N A;  2VKE A;  1JKP C;  1MNM C;  1IGN A;  4M3F A;  5C44 J;  1MSF C;  5K7H A;  3SDG A;  3UKG A;  2HSG A;  2Y2Z A;  4DYC A;  1POU A;  2E2J J;  5J1U A;  1RPW A;  2LR8 A;  4MFE A;  1VND A;  5FKM A;  4C3I J;  2XSD C;  1SFO J;  3GTQ J;  2MQK A;  2DA2 A;  2PUE A;  4S0H B;  1LQC A;  1GV2 A;  3BT9 A;  3RZO J;  4X6A J;  3G5G A;  2PUF A;  4GQM A;  2D5V A;  4NDW A;  3HB9 A;  2PUG A;  4OB4 A;  3O8H A;  2Y30 A;  3HOU J;  1GVD A;  1U9N A;  2R93 J;  1RZR D;  3BR1 A;  1JWL A;  2DMQ A;  3IH3 A;  3F0C A;  5IOZ A;  5EEA A;  2LYR A;  1R9T J;  4L5E A;  3BTC A;  3LSP A;  5FKK A;  2R7Z J;  2R1J L;  1JJ6 C;  5EG0 B;  2LYS A;  1MBG A;  2OF7 A;  3GBF A;  2JA5 J;  2K40 A;  2ICT A;  1K83 J;  2E19 A;  2WIU B;  2LK2 A;  2IVB A;  2IV1 A;  4MIM A;  2KEJ A;  3CQZ J;  3Q0W A;  1NK3 P;  3ZQH A;  2B5A A;  2FJR A;  2JVL A;  4J1X A;  2KZ8 A;  2LFB A;  2VI6 A;  5BNG A;  1ZKG A;  3WHB A;  1R63 A;  1DW9 A;  2MSY A;  3OSF A;  1VI0 A;  1IDY A;  4M3D A;  2JJ7 A;  1X2L A;  2PMZ N;  3MN2 A;  3MLF A;  2L7M P;  3A01 B;  3QQA A;  4J19 A;  3FKI J;  2KPJ A;  1H89 C;  1GT0 C;  3LIS A;  2JA8 J;  5K7Z A;  1JTX A;  1EFA A;  3K7A J;  2I10 A;  4JQD A;  2X6O A;  4XRM A;  2EZI A;  2LTP A;  2M0C A;  3QPS A;  4I6Z A;  3M4O J;  4UUS B;  2OPT A;  1IG7 A;  2N8G A;  2XJ3 A;  4B3A A;  5IPA A;  1DU0 A;  3BTJ A;  3LOC A;  1ZR4 A;  1H8A C;  1BL0 A;  2CJJ A;  1GDT A;  3F52 A;  4A69 C;  5A7L A;  2AO9 A;  2BNO A;  1XC5 A;  4C2M J;  5M5X J;  4I6R A;  3PO2 J;  3TP3 A;  2LCV A;  4X4B A;  4QIW N;  1ZR2 A;  1LCD A;  2R92 J;  4QSH A;  3OSG A;  2GRM A;  2XPV A;  5F0H A;  4CYC A;  1HLV A;  2LYJ A;  2XI8 A;  2ID3 A;  1ZZ7 A;  5K7F A;  3K2A A;  2LYP A;  1Y9Q A;  1IRZ A;  2XGC A;  2E1O A;  4JYK A;  2JA6 J;  2PIJ A;  2LYL A;  2BJC A;  1DWK A;  1RZS A;  1DU6 A;  2MGQ A;  1MBK A;  3DEW A;  4Y7N J;  4MLO A;  1RZR A;  2Y0S N;  3HOV J;  2LD5 A;  2GBY A;  4C3H J;  1ZZC A;  3RKQ A;  2K9Q A;  4DYR A;  2DA6 A;  2HI3 A;  4A3D J;  2PPX A;  3CRO L;  1ZGW A;  3PO3 J;  4D7M A;  2KEI A;  4MCX A;  4RDU A;  2IAI A;  3ZQC A;  1ZZ6 A;  1AKH B;  1WH6 A;  4BY1 J;  2WUS R;  4M3G A;  4X4G A;  3D1N I;  1QP4 A;  3HOZ J;  2AUW A;  3HZI B;  2NVQ J;  3DNV B;  3HGY A;  5IOY A;  5FKN A;  3HBL A;  1Y7Y A;  3IVP A;  2ECB A;  2Y31 A;  5F0F A;  1JGG A;  3S2D J;  1ZQ3 P;  1LLI A;  2P81 A;  1I3Q J;  2VPR A;  1JUS A;  5EZH A;  1ZVV A;  2Y9Z A;  3WHC A;  2DTZ A;  1ZZB A;  2MEZ A;  1MH3 A;  2M8G X;  2TCT A;  4YG7 B;  2JA7 J;  1UXC A;  4X4F A;  1BJZ A;  3QYX A;  2JN6 A;  4XRS G;  1E3O C;  4A3I J;  3SFI A;  3ZKC A;  1JUP A;  1F43 A;  1IDZ A;  1U78 A;  2O38 A;  4X4D A;  1OSL A;  2L7F P;  4FBI A;  2VKV A;  4FIS A;  1FEX A;  3G1M A;  1B72 B;  4IVZ A;  1UG2 A;  1R69 A;  2AXU A;  2O8K A;  3JRC A;  3RZZ A;  3I4N J;  2LVS A;  2L7Z A;  1HCR A;  5IP7 J;  1IC8 A;  4G12 A;  2BNM A;  3ZHI A;  3GTO J;  2GZU A;  1JUM A;  5IYD J;  5C4J J;  4IHX A;  5EZG A;  3HOY J;  4J1W A;  2AHQ A;  1MBE A;  1U8B A;  1LE8 A;  4Z5H A;  3SJM A;  1HF0 A;  3CDL A;  3BR0 A;  2NVT J;  2O49 A;  2EBY A;  2WV1 A;  2G0E A;  3HKZ N;  2KT0 A;  1B72 A;  4GFB A;  3CCY A;  4X4I A;  3JRH A;  2DA4 A;  2H8R A;  3ZQG A;  1ZK8 A;  1PRU A;  3L1P A;  3S15 J;  4MFD A;  4XRS A;  2HOT A;  1WET A;  3LNQ A;  1HDD C;  5F04 A;  5C4X J;  3OP9 A;  5JLX A;  3JXB C;  2COB A;  3F51 A;  2XB0 X;  1ETO A;  5F0C A;  2A6C A;  1PER L;  2GM4 A;  3LSJ A;  3JRE A;  2LYQ A;  4A3G J;  3BG9 A;  4XIC A;  2O7O A;  5EGO A;  3ZHM A;  1F36 A;  3IV5 A;  1I50 J;  3BG5 A;  2ME6 A;  3SCH A;  5F08 A;  2OR1 L;  1PUF A;  2WAQ N;  3FK7 A;  1JT0 A;  4YG4 A;  4I8T A;  5E3O A;  1X57 A;  2O9L A;  4I76 A;  1FJL A;  2JMW A;  4JCY A;  4A3F J;  5F27 A;  1ZAY A;  1TC3 C;  1MBH A;  1POG A;  5JLW A;  4QTR A;  4MCT A;  5J1R A;  4IHW A;  4Z5D A;  3QF3 A;  1Z0X A;  3S2H J;  2DA5 A;  2PUB A;  4CYC B;  3TW6 A;  2Y9Y A;  2ZB9 A;  2EZH A;  1HDP A;  1X58 A;  3HDD A;  1UXD A;  3BTL A;  1RIO A;  4FE7 A;  2IUO A;  2HXI A;  1CJG A;  4BXX J;  1X2M A;  1P7I A;  5M5Y J;  3TED A;  2FQ4 A;  3JXD L;  4AUX A;  2CQX A;  3BQZ A;  4X4C A;  1QP7 A;  3GTM J;  2R0Q C;  1AU7 A;  1QQB A;  1B8I A;  4PU8 A;  1RET A;  2CRO A;  3CEC A;  3G1L A;  3IH4 A;  2R5Y A;  1U9O A;  2FJ1 A;  3GTJ J;  5M3F J;  5IP6 A;  1MBF A;  4W97 A;  4A3B J;  1W0T A;  2GRL A;  1GV5 A;  3S1R J;  1MSE C;  3RQI A;  1SAN A;  1Q1V A;  2DMP A;  4DZP A;  2HQ5 A;  1O4X A;  1LCC A;  3TRB A;  3QPL A;  5FJ8 J;  4BKX A;  3ZQF A;  2HIN A;  2L0K A;  1JFS A;  4BY7 J;  1QP0 A;  1TWH J;  1AHD P;  1ENH A;  4JP0 A;  2LP0 A;  4M3B A;  3OQM A;  3A03 A;  4MO7 A;  3OIO A;  2ICP A;  5FKO A;  1ETY A;  1JT6 A;  2QCO A;  4UUT A;  2FX0 A;  3BQY A;  1FIP A;  2XRL A;  3BS3 A;  3S1Q J;  4A3M J;  4FTH A;  3ZQI A;  1JKO C;  5E3N A;  1A5J A;  2X9D A;  2DJN A;  3BG3 A;  3HGG A;  5FLM J;  1VFC A;  2PE5 A;  2HYJ A;  1IJW C;  3R1F A;  2FD5 A;  4M6V A;  4JX5 A;  4EEF G;  4A3K J;  2E2I J;  4JX6 A;  3S14 J;  2ELK A;  2CQQ A;  2CSF A;  2BNN A;  2X48 A;  3W6V A;  2MW8 A;  3GBG A;  2OFY A;  5GPA A;  1A6I A;  3TW7 A;  5C3E J;  1K61 A;  4Z5C A;  3GTL J;  2LY9 A;  2EH3 A;  1RPE L;  4D5F A;  1NEQ A;  1WH5 A;  4C3J J;  5DTD A;  1JTY A;  3S16 J;  3MKL A;  1BW5 A;  4GHJ A;  4A93 J;  1G2H A;  4I6T A;  4PU4 C;  3DCF A;  3U3W A;  4Z59 A;  3BR5 A;  4W1U A;  2ME0 A;  2TRT A;  2NS7 A;  1UTX A;  2RAE A;  4D5C A;  1LE8 B;  2YU9 J;  3B6A A;  2IBD A;  4BBS J;  1TWC J;  4XK4 A;  4X4H A;  5EF6 A;  2O4A A;  1D5Y A;  4A3C J;  1QQA A;  4DW6 A;  1QPZ A;  1SQ8 A;  1OJL A;  1UMQ A;  3MVP A;  1P7J A;  1LMB 3;  2R5Z A;  5IYB J;  3KXA A;  1JH9 A;  1BA5 A;  3BD1 A;  1CQT A;  3A02 A;  3G1O A;  2L8N A;  4I6U A;  2B63 J;  3F6W A;  1ETX A;  3H0G J;  4X1E A;  3GN5 A;  5F1J A;  2HDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...