1E3OC

Crystal structure of oct-1 pou dimer bound to more
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
160
structure length
132
Chain Sequence
EEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMSKLKPLLEKWLNDAEKRTSIETNIRVALEKSFMENQKPTSEDITLIAEQLNMEKEVIRVWFSNRRQKEKRIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Differential Dimer Activities of the Transcription Factor Oct-1 by DNA-Induced Interface Swapping
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords 5'-D(*AP*TP*GP*CP*AP*TP*GP*AP*GP*GP*A)-3'
total genus 44
structure length 132
sequence length 160
ec nomenclature
pdb deposition date 2000-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00046 Homeodomain Homeodomain
C PF00157 Pou Pou domain - N-terminal to homeobox domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1e3oC02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1e3oC01
3H3VK 3HOVJ 5J1YA 1PRAA 1E3OC 2LYSA 1Y9QA 3F0CA 1JTXA 2ELKA 3CQZJ 1JJ6C 4UUSA 2DMNA 3H5TA 4YG1A 3ZQHA 2LCVA 2O38A 3HOZJ 2HI3A 4D5FA 4M3EA 2LYLA 1U9NA 2LR8A 3GTKJ 4GHJA 1O4XA 2CQXA 3Q3SA 4M3FA 2O9LA 3S14J 4AC0A 1ORKA 4A3EJ 1GT0C 4JP0A 2K9NA 4XRMA 3LISA 1GV2A 4X4FA 4Y7NJ 1T33A 2XCJA 2WB1N 3RKQA 4LOCA 1CQTA 1DWKA 1VF9A 4MO7A 4C3HJ 5M3MJ 2R5ZB 3FKIJ 2L7FP 2O7OA 4M6VA 5F1JA 3G1MA 3CECA 3BR3A 3SFIA 5IYCJ 5F0CA 2AUWA 3HGYA 2PPXA 2Y9YA 1D5YA 5M5XJ 4X4DA 3K2AA 1NK3P 3LFPA 3OOUA 4JX5A 3H0GJ 2IU7A 5IP9J 4EEFG 2LYPA 3G5GA 1ADRA 2PUDA 4JX4A 2L7MP 2Y30A 2CU7A 5FKNA 2DN0A 3ZQFA 3ZHMA 3CDLA 1Y7YA 3WHBA 4C3JJ 4PU8A 1FIPA 1R69A 1GV5A 5EEAA 3EUSA 3RZZA 3SCFA 4MCTA 3O8GA 3BG3A 4B3AA 2Y2ZA 4X4EA 2B5AA 2R92J 4A3IJ 4D5CA 2EBIA 1RESA 1AKHA 3C2BA 2X48A 1WPKA 4IA8A 1MH3A 1RPEL 3M3YJ 5A7LA 1RPWA 2IUOA 2EBYA 3HOXJ 1PNRA 2L7ZA 2JN6A 2WAQN 2NS8A 2PUGA 2DJNA 1R9TJ 1K83J 2CUEA 4YARA 4UUSB 2HDDA 1TWAJ 3G1LA 5E3OA 2YU9J 2CSFA 1QPIA 3GTGJ 2TRTA 2ZB9A 2BNOA 3B6CA 2GM4A 4JCYA 4G12A 4DW6A 3BTIA 2MW8A 4GFBA 4Z5CA 1RZSA 1X57A 2EZIA 2E2IJ 1LE8B 3GTLJ 5EZGA 2ME0A 2YUSA 5K7ZA 3TRBA 2HOSA 3OIOA 5IYBJ 1HOMA 2IVBA 4NDLA 2PE5A 3CLCA 1FIAA 2OPTA 2AHQA 3LOCA 3ZQCA 3KZ3A 4Z5HA 5FKOA 3GTQJ 3VK0A 3S1QJ 3FYAA 2L0KA 1BDIA 2EZKA 2I10A 3LSJA 1MBFA 1P7IA 3O8HA 1ZZ8A 4RDUA 4A93J 3G1OA 1JTYA 2G0EA 3GN5B 2P81A 3FMYA 2IVQA 1IV6A 2KEIA 1VI0A 1DU0A 1BDHA 4X4CA 1W0UA 4W97A 4IHXA 3GTPJ 1LCDA 4O8BA 2M2EA 4C3IJ 3DCFA 1UXDA 5IP6A 1MBKA 3E7LA 2M34A 1YRNA 1ZKGA 3BG5A 3A01A 4D7NA 1B72B 3S1MJ 4MFDA 3RQIA 1ZZ6A 2IVGA 4A3KJ 2PUCA 1B0NA 3F51A 4QSHA 2K9QA 1I6HJ 4FE4A 2DA3A 3BTJA 2LK2A 5IPAA 1WI3A 2HXIA 1WH8A 4PU3C 3JXBC 1QP0A 2LP0A 3HEFA 4FISA 4S0HB 1CJGA 2M8GX 4ABZA 1U8BA 2HSGA 3BT9A 4Y42A 3ZQGA 5J1RA 3S15J 4DYRA 3GTMJ 3JXCL 1POGA 3JRAA 1K61A 4M3DA 3BQZA 4QTRA 3HOYJ 5M3FJ 4B1RA 3IV5A 1MBHA 4D7MA 1ZPQA 2CRGA 3HOUJ 4XK4A 2LD5A 4CYCA 4BY7J 2QF7A 2AXVA 3F52A 1MH4A 1OCPA 2M9HA 3JRCA 5F08A 1A5JA 2NOGA 1HCRA 2RAEA 2GBYA 3BG9A 3A01B 3BR2A 1ETXA 1QRYA 5FLVA 2ICPA 1G2HA 1H8AC 2YS9A 4XIDA 2HXOA 1BA5A 4YG7B 1A6IA 1I3QJ 4X4BA 1U9OA 1ZZCA 3B7HA 2JJ7A 4XRSA 4X1EA 2NVQJ 3W6VA 4I76A 3S16J 2MQKA 2PMZN 1ZZ7A 1LLIA 1QVTA 3CMYA 3HM5A 1PRVA 2DMPA 2DTZA 3JRIA 1Q1VA 5IOZA 4I6ZA 5GPCA 1TC3C 3MKLA 1FEXA 1FTZA 3OQNA 1UG2A 4A3GJ 4Z5DA 1YSEA 2OFYA 1OCTC 2WV1A 4NDWA 2XJ3A 2PUAA 3HGGA 2EF8A 1BJZA 3FK7A 1B8IA 2XSDC 3S17J 3BS3A 1VNDA 2O4AA 1RETA 2W48A 4MIMA 1JUPA 2E2HJ 4JCXA 4XRSG 1ZR2A 2EZHA 2FJ1A 2AWIA 1GUUA 2XPWA 2KZ8A 2MEZA 3DNVB 4X4GA 9ANTA 3F6WA 4J19A 1H89C 3ZKCA 5JLXA 2IBDA 3QF3A 3TP0A 2COBA 3ZQLA 1I50J 4A3MJ 2KT0A 2LYKA 2X9DA 5E3LA 5EZHA 1IUFA 2QCOA 4QIWN 5EG0A 2FX0A 5GPAA 3LNQA 5DTDA 3IH2A 3TEDA 1JT0A 2WIUB 1W0TA 3BTCA 4JX6A 5EGOA 5IP7J 3PXPA 5DS9A 1ETKA 3DEWA 1AKHB 4A3CJ 3FK6A 4JQDA 1JUMA 3Q0UA 2E2JJ 1WETA 2L49A 2MG4A 3HDDA 4PU7A 1RIOA 1UMQA 1BL0A 2VKEA 5K7HA 1ZR4A 2XPVA 2GLOA 1JT6A 3GBGA 3PO2J 2R1JL 1VFCA 2HOAA 3Q0VA 1SFOJ 2JCGA 2D5VA 3HZIB 1LCCA 1H88C 1LE8A 4X4IA 1LMB3 5EDNA 4FTHA 4X6AJ 3BR5A 1ZGWA 3OQOA 4Y52J 2ICTA 4YBAA 2JWTA 2R93J 1SQ8A 3LSGA 2ECCA 5E3NA 2KPJA 2E1OA 3JRBA 3U3WA 2LKXA 2N8GA 4IHYA 3KXAA 3QPSA 2AW6A 4A3FJ 2K40A 4I6TA 1LFBA 3MLFA 3MN2A 2EZLA 3Q0WA 2JA8J 1X2NA 5IOYA 4HNVA 5EYRA 1JKOC 4MCXA 1ZZBA 5EF6A 5FKLA 1IC8A 5C4JJ 3FYMA 4IVZA 3CCYA 3JRHA 1X2LA 1POUA 4L5EA 4FBIA 2XGDA 3QQ6A 1TWCJ 2DA5A 4BBRJ 1LFUP 2GRLA 3QYXA 1MBJA 3R1FA 2XRLA 2Y31A 3HOWJ 3UKGA 2HQ5A 4M3BA 5HODA 2R7ZJ 1ETWA 2L9RA 3BDNA 3S8QA 2HINA 2JA5J 1S7EA 1WH5A 2CJJA 3VPRA 3LSPA 2XB5A 1FTTA 3PM1A 4DYQA 5FJ8J 1EFAA 4RBOA 2LFBA 4A3DJ 2OF7A 1TWFJ 4BXXJ 2ID6A 1IGNA 2O8KA 4YG4A 5F0FA 4W1UA 2VI6A 1T56A 2KDZA 1OSLA 1U78A 2LYQA 4MFEA 2DA1A 1JWLA 4A69C 5IYDJ 1ETOA 2E19A 1Y1WJ 2AO9A 2IV1A 3UFDA 3JXDL 2VUMJ 1IRZA 2AXUA 2PUFA 1HLVA 2JMWA 1YRNB 2MGQA 3GTOJ 3O9XA 2DA7A 2FQ4A 2HOTA 3SDGA 1F36A 1JFTA 2M0CA 2GRMA 3OSGA 1AHDP 4CYCB 1QVUA 1WH6A 2L8NA 2Y0SN 3IVPA 4X4HA 4FCYA 3NAUA 4A3LJ 2CUFA 3M4OJ 1WGXA 2EQRA 3ZOBA 2IEKA 1IDZA 1DW9A 1QP4A 5C4XJ 5FKMA 5K7FA 5BNGA 2NS7A 4XICA 2XI8A 1HF0A 4A3BJ 4V2GA 3OQMA 1UHSA 4C2MJ 2R5ZA 4OB4A 2R5YA 2LLKA 4JYKA 1L1MA 3BTLA 1ETQA 4IHVA 4I6UA 2O49A 2XGEA 3S2DJ 1RZRA 4V2FA 3IH4A 1XS9A 1RR7A 3TW6A 3HB9A 2VPRA 3G7DA 2XPUA 1JGGA 2IAIA 1NK2P 1GVDA 4BBSJ 1ENHA 3D1NI 1BW5A 1DU6A 5FKKA 1MNMC 1JKRC 2LY9A 1PRUA 4F8DA 3GTJJ 1FJLA 3HBLA 2JA6J 1JJ8C 3S2HJ 4IWRA 4B4CA 1ZZ9A 2WUSR 2ME6A 4J1WA 1ZQ3P 4IHWA 3BR6A 3I4MJ 2CROA 2DMQA 3QQAA 1JUSA 5M5WJ 1JKQC 1ETVA 3OMTA 1TWGJ 3OP9A 2R63A 1MBGA 4J1XA 1JFSA 2DMTA 3GN5A 3QPLA 1OJLA 3SCGA 4M3GA 5E3MA 1RKTA 5J1UA 3RZDJ 2TCTA 1X2MA 2VKVA 2R5YB 3KJXA 4BY1J 5FLMJ 1B8IB 2DA4A 4GQMA 3JRGA 1ZTRA 2A6CA 2DA2A 3A02A 5JLWA 3JR9A 1P7JA 1WCMJ 5EG0B 3PO3J 3ZHIA 4Z59A 1AU7A 4DZPA 1WIZA 3BR1A 4I8TA 5EGOB 1XC5A 1PUFA 3ZQIA 2X6OA 3FIWA 2DA6A 1ZUGA 5C44J 4UUTA 2B63J 2PIJA 4I6RA 1HDDC 4DZJA 1OFCX 3IH3A 2FJRA 1NTCA 2GZUA 1LQCA 1ITYA 1HDPA 4FN3A 1ZAYA 5C3EJ 3TW7A 1RZRD 1IJWC 2HYJA 2ECBA 1MSEC 1Y1VJ 1ZK8A 3JRFA 5F0HA 5M5YJ 1UXCA 3GBFA 2NVXJ 1QP7A 1QQBA 3HKZN 5K98B 3A03A 1IG7A 2KEKA 3FISA 2JK3A 1MBEA 3S1RJ 3I4NJ 3RZOJ 1F43A 5GP9A 1RKWA 1JKPC 3BD1A 2FD5A 3QWGA 1Z77A 1B72A 4FE7A 1IDYA 2LTPA 1XWRA 3B6AA 1QQAA 1Z0XA 1APLC 2ID3A 2BNMA 3K7AJ 1SANA 1ETYA 3MVPA 4AYBN 1JH9A 1PUFB 3SCHA 3WHCA 2OR1L 1MSFC 1EF4A 3TP3A 3CROL 4BKXA 2DMUA 2K9SA 1NERA 4Z58A 4IEJA 2LYRA 3L1PA 1WH7A 3LSRA 3JRDA 2XIUA 2CQQA 4DYCA 2KEJA 2PUEA 3BQYA 1VPWA 3SJMA 2XGCA 2LYJA 2EWTA 2EH3A 1GDTA 4MLOA 2BJCA 2PUBA 1TWHJ 1XG1A 2JVLA 2MSYA 2R0QC 3BR0A 4AUXA 4A3JJ 4PU4C 2XB0X 1BW6A 1PERL 3OSFA 1QPZA 2NVTJ 2H8RA 5F04A 1UTXA 1X58A 5F27A 2H1KA 1R63A 1ZS4A 2AXZA 5J3LA 1ZVVA 3JREA 3S1NJ 2BNNA 2NVYJ 1NEQA 2LVSA 2Y9ZA 3NARA 2JA7J
chains in the Genus database with same CATH superfamily
3H3VK 5J1YA 1SMYF 3GUUA 3WG7H 4G6DA 2PFBA 3CQZJ 2PLYA 3V42A 3DM5A 1BN5A 2O38A 2DFIA 3CF5F 1YJ9I 2HI3A 4D9JA 2LYLA 1QO0D 3CESA 3GTKJ 4RLQA 2X85A 4GHJA 2CQXA 3E5UA 3S14J 3BC8A 4AC0A 1ORKA 3LISA 4JP0A 1G6NA 3H3ZA 4Y4RA 2L54A 1B9MA 1T33A 3GMEA 4HQMA 5D6FA 5IT3A 3WTSC 1DWKA 4G7ZF 3QAHA 5HLIA 3GWZA 4C3HJ 2R5ZB 3BY6A 1IUYA 3KYCB 1EH8A 2O7OA 4LG3A 3LWFA 3G1MA 3DWLE 1I27A 2LYCA 3BR3A 4PJ0C 2GIZA 4EGZA 1ZRFA 4IZZA 4L0YB 2XAUA 1SEUA 2XGXA 2G9WA 2QEXI 2QSHX 3ZXSA 3AL0B 3WGGA 4UV8A 5LRRA 2DAOA 1SFXA 3M07A 3PE5A 2Y30A 2CU7A 1Z05A 5HDGA 3W3CA 5FKNA 1Y7YA 2W24A 4C3JJ 1K6YA 3K4JA 2FMYA 1V5GA 5CVIA 4MCTA 3BG3A 4CGZA 4YELA 4FX0A 2B5AA 2R92J 1XX5A 2EBIA 4ZYEA 4FT8A 1EKEA 3C2BA 3WTUC 5JI6A 1WPKA 1W36C 1MH3A 5HVQC 5GTHC 1V5EA 3CUQA 3SFZA 3F8CA 1BI0A 3MZYA 3HOXJ 4EJUA 4QPOA 3GLLA 4BGDA 3CCMI 2JTVA 2QZ8A 4UUSB 1IXCA 2XAJA 2TRTA 3KEOA 1FZPB 1XN7A 2GM4A 4JCYA 2MH9A 3DBLB 1WI9A 2ADUA 4UXNA 3MD2A 1VQOI 1S6LA 4O5VA 1K78B 3PFYA 1QZXA 3MAJA 4GO1A 2YUSA 3O2PE 5E20A 1FOKA 2HOSA 3OIOA 4KJZA 3CZ6A 3HSEA 2BY3A 4Q5SF 3HUGB 4Z5HA 5F64A 2QQ8A 5FD6A 3GTQJ 1XGOA 2EIKH 2L0KA 1B9NA 1CF7B 2DFHA 2MFZA 1BDIA 2I10A 1MBFA 3W2WA 3CC2I 3PSFA 2KDOA 3KP5A 1ZZ8A 3G1OA 2K27A 4NQWB 3OYMA 1HSJA 2Z16A 3KX2A 4GGGA 5KHDA 3GN5B 3IKVA 2MH2A 4PUSA 1BDHA 3H5AA 2GQQA 1G3YA 4X4CA 1W0UA 3OL3A 4IHXA 1WSUA 3GTPJ 1ACIA 1DGRM 3SZGA 4XKVA 3FHZA 2M2EA 3K1MA 2A05A 5IP6A 4ER5A 1XTAA 1Y0UA 2OCCH 3CCLI 4A2UA 2DFFA 1Y6IA 1ZELA 4NC7A 2A61A 2V7FA 1ZZ6A 3ONQA 2PUCA 1I3AA 2DBBA 4II2A 1Z1DA 2XXAA 1I6HJ 4GYIA 3N97A 2DDAA 2NVUB 3KYDB 3EYYA 3BTJA 3M7GA 2A5WA 2HXIA 3JXBC 2A3SA 2LLWA 2LSOA 3QP6A 1OCOH 4OMYA 1U8BA 2KJCA 2XAGA 3OR1C 1I6XA 1MJBA 2WB1A 3TQNA 5LGTA 3BT9A 3DTIA 4PK4A 1PYVA 5D5WB 1ZHFA 4RLFA 1POGA 1S3JA 3OYIA 1K61A 4G7OF 2WAFA 3IV5A 4KFCA 3FXRA 2OQRA 5DUIA 2KRFA 2IRFG 4BQQA 3IRQA 2LNBA 2KRCA 1XCVA 2M9HA 3JRCA 5F08A 3HRUA 4ZTJA 3HJEA 1HCRA 2RAEA 1D0ZA 3OIQA 3BG9A 3K4LA 3BR2A 3A01B 4E7HA 2DOAA 3TOAA 4H4KC 5IT9Z 2ICPA 4RM3A 2ZXHA 4BU2A 5LGNA 2K3FA 2QUFA 1XGNA 2L2OA 1B59A 2CQNA 2MA3A 2O61A 4XRSA 5LEKA 4I76A 4ENNA 1ZZ7A 1LLIA 1QVTA 1BM9A 3HM5A 2BYVE 1YHQI 3JRIA 2MD5A 3QOWA 3K4BA 3P5JA 3WTYC 4HG2A 3LSKA 5BQTA 1LNWA 3RPUD 5LD2C 4Z5DA 4XKBA 1A6QA 5DTQA 2XJ3A 3HGGA 1T0FA 3OS1A 1B8IA 2P6SA 5DTMA 1XMAA 1I39A 2EFOA 2R7WA 4O6JA 1MZBA 2CYYA 3RI4A 4JCXA 2E2HJ 1W5TA 3CP2A 4XRSG 1IN5A 3OWTA 2Z2SB 3P9CA 2KZ8A 2Y48A 4RB1A 3B73A 4RS8A 5JLXA 5JR3A 5EJCA 4IOCF 3LA2A 2QWWA 2ESNA 2OZ6A 5EZHA 2HZDA 5L3BA 1FOYA 1IUFA 2EA2A 5HS9A 2FX0A 1XPXA 2VQLA 2F4MB 5DTDA 3TEDA 3J80Z 2QM3A 5EGOA 5DS9A 5LLQA 3DPLC 3DEWA 3T8TA 2KZVA 3ZN1A 2K7LA 3ZGKA 3AG3H 1AKHB 5HLGA 4JQDA 3Q0UA 4ZZLA 4XBFA 4YRVA 2PX9A 3L00A 3KCCA 4U87A 1RUOA 2PN6A 2XPVA 5DCMB 2HQRA 3F9KA 2A07F 1QZEA 2LY1A 4OBMA 1G8XA 1XSDA 2FXAA 2HQNA 2HOAA 1VFCA 5D4RA 2VJ4A 3V8LA 2W4SA 3OIPA 5EDNA 5DEQA 3BR5A 2HKXA 3QODA 4BEHB 1ODDA 3K70C 5IT9K 2R93J 2DXIA 1SQ8A 3CC4I 4IQJA 1XDUA 1J9IA 4U7DA 2NRAC 1R6RA 4OIRF 5J6XA 3U3WA 1J0RA 5B3SH 1SC7A 2KZGA 4A3FJ 2K40A 2ZXWH 4I6TA 1LFBA 1F4KA 2BY0A 4RAFA 5IOYA 5EF6A 1UHWA 3TOBA 3S3MA 1EH6A 5D5UB 3HSFA 2YU3A 1NW3A 2K02A 1BR4A 2VQGA 3JRHA 1IZ1A 3CCVI 3QQ6A 2DA5A 2DU9A 1LFUP 2GRLA 3ZQQA 4LD5A 2HVQA 5HODA 2BEOA 2R7ZJ 1T6SA 3WTZA 5HLHA 2JA5J 1S7EA 3HSRA 1WH5A 2KJBA 3GW2A 2XB5A 2XXQA 3KZYA 1J5YA 5FJ8J 1EFAA 2OF7A 5ILSA 2M45A 4EMSA 1D3YA 1YG2A 2NNYA 4HF0A 2Y69H 2ZJRF 2M4GA 1U78A 4LK0F 2DA1A 4A69C 1REPC 4AM3A 2FBIA 5HS8A 4AYBA 4XQFA 1Y1WJ 3UFDA 1KA8A 2DCEA 3O9XA 2JMWA 1VQ4I 2KMUA 4ER3A 3GZDC 2FQ4A 4MQ9F 3ABTA 1TP4A 2HOTA 1F36A 4HRAA 5H6RA 4CYCB 2F5CA 1R36A 4HNUA 5LRSA 4X4HA 2JPCA 2BXYA 2OUMA 2CUFA 2Z33A 5ICCA 2M1BA 1YTYA 1DW9A 1FMWA 1W7PD 5K7FA 3F22A 2NS7A 5E17F 4F3QA 2MABA 4NBQA 2LOOA 4V2GA 3RKYA 4BDZA 3OQMA 1UHSA 2R5ZA 4OB4A 3ISPA 2R5YA 3L7WA 1L1MA 4F52A 3BTLA 2PMZA 1XMKA 4GRIA 1LEAA 1TQIA 1HXDA 3IH4A 1XS9A 3ZCOA 4IVNA 1RR7A 3TW6A 2KIQA 3HB9A 1HBXG 3J7AY 2LKSA 1D0YA 1GVDA 2OAZA 1SD6A 1SD5A 1VQ6I 5FKKA 1JKRC 1PRUA 2E1MB 1AOYA 4BL0B 4M9SA 4BXFA 4ENKA 2H6CA 2JZYA 4IWRA 4KITB 2GIVA 2ME6A 2VT2A 3I4MJ 2CROA 3CTAA 1BR1A 3TO9A 3OYAA 5M5WJ 3CJNA 4YG2F 4WCGA 1TWGJ 1LVAA 5DM7F 4AVPA 5JHUA 1X1AA 2DMTA 4BQOA 3QPLA 1OJLA 3HRTA 2HDWA 5E3MA 4CO8A 5J1UA 1T8IA 1J59A 5GADJ 2TCTA 3G6EI 1T0FC 5JHFA 2R5YB 2E36A 3LSHA 1NG7A 2K4BA 3FXQA 4BY1J 1B8IB 4GQMA 3ERMA 2K86A 5JLWA 3JR9A 4BAYA 3H5RA 4WK8F 2RREA 5D8LB 4EQQA 1BJAA 2LNMA 4BXUA 4L0ZB 3IAS2 4I8TA 2X6OA 1I1SA 4XSXF 5DT2A 2DA6A 1PVEA 5CPRB 1LDDA 4X0GA 4DZJA 5KAIC 4CCJA 1I5ZA 2VC1A 1ZAYA 3HXLA 4F91B 4LIVA 2HYFA 2HYJA 4D1QA 2DK5A 5M5YJ 1UXCA 2QQAA 3NWTA 3HKZN 2KEKA 4E7KA 3BPVA 2PBIA 4XONA 3OY9A 1YLFA 5FRNA 2MYSA 1X1CA 2OU2A 2DODA 1JKPC 2XF5A 1R7JA 2ZC2A 5TJJA 3BD1A 3RTRA 3QWGA 2PXFA 4FE7A 1VTNC 1XWRA 1S29A 4HX8A 1APLC 3JAMK 2VJJA 5LFAA 2WWYA 1ZRCA 1F9NA 2QSFX 1SANA 2IGNA 2M87A 3QU6A 3I3LA 1YW7A 4Q4ZF 3SCHA 2FRHA 2UUZA 3OL4A 3I64A 2IVMA 3CMEI 3WTTC 1DPRA 1R5HA 4M6YA 1EF4A 3CROL 1BI2A 1X3WB 4BJ5C 4BEHA 2XIUA 1VPWA 2CFXA 2EWTA 2EH3A 1GDTA 2IT0A 2PUBA 1H0MA 1TWHJ 2ZJ2A 1XG1A 1EH7A 2MSYA 1R49A 1LQ1A 2CQ7A 3U2RA 2VC0A 4PU4C 2X1DA 2F2EA 3VOEA 4B09A 1QPZA 1VQ5I 3G3ZA 2LBFB 5F27A 2ISYA 2AXZA 4AD9A 1FBUA 2UXNA 3RKXA 3S1NJ 1R23A 3PNVA 2PXDA 2IS1A 3H3UA 1ZGJA 1E0EA 3ECOA 4PJLA 2P5LC 4FQGA 3V8KA 1PRAA 2HVSA 1HW2A 2LYSA 2MD0A 1G3SA 5CJ9A 5FFXA 4BJTA 4Y15A 2ZNYA 2ELKA 2P8TA 3L09A 2DMNA 3ZQHA 4A12A 4D5FA 3RCOA 2LR8A 2W00A 3Q3SA 1IRFA 2GOXB 2C6YA 2WAEA 5FD5A 2K9NA 3KZIC 1GV2A 4PDKA 1YJNI 4X4FA 1U3EM 3KP7A 2XCJA 1ZYRF 2WB1N 3I4PA 2DOEA 5FFZA 3RKQA 3T8RA 4LJZF 3OKZA 1OCZH 2DDBA 4AWXB 5M3MJ 1JHHA 3BCBA 3LMMA 1QB2A 3SFIA 4JBAA 3A1YA 4RGUA 3HGYA 4PGGA 4G6TB 5M5XJ 5BPDA 2VE8A 3CF2A 4MGRA 3GCMA 3WE3A 1K4SA 2A68F 3VODA 3G71I 2COMA 2FOKA 2JUCA 3D0SA 5IP9J 3ABKH 3HKZA 2IA0A 2LYPA 4IPAA 4RB3C 2QBYB 2PUDA 5DTRA 1ZARA 3ZQFA 3WE2A 3WHBA 1R69A 4N9HA 5EEAA 4WF2A 2OCEA 3RZZA 4HDVA 3SCFA 3O8GA 4PJJA 3CCJI 3RPQA 1X19A 2BZTA 3ZMTA 3F8MA 2PXVA 4XLPF 2E7WA 4CXFA 1G4DA 3GFJA 1WVRA 2XIGA 5TRDA 3SX0A 2VBYA 1HW5A 1DGWY 3M9AA 1IN6A 2G7UA 3DPUA 2EBYA 2K9LA 4E6KG 2W85A 4YARA 4NB5A 2CSFA 1P4WA 2HPMA 5LEJA 4EJOA 2BNOA 1ZREA 4G12A 4DW6A 1R71A 3BTIA 2MW8A 4Z5CA 2DOFA 1FP2A 5JVTA 1RZSA 4PCQA 5FO5A 5EZGA 2ME0A 5K7ZA 3GTLJ 3TRBA 5AIPA 3BZCA 4AIHA 2OZUA 1RZ4A 2L4AA 3CJQB 4UVAA 2CMPA 3S93A 1PP7U 2VONA 4Z6YA 4F7ZA 3H9JA 3HHHA 2OPTA 4ZYHA 3KZ3A 2BV6A 2A6HF 2L9NA 5E1XA 5FKOA 4KNYA 2XAFA 5B5EC 2EZKA 3L2WA 4RDUA 3LQQA 2LMDA 4L9JA 4CCMA 4PGHA 4W97A 4B8XA 1R4NB 4KIFA 4CUGA 2DW4A 1J7KA 3DCFA 2RNJA 2M34A 4ESBA 1ZGAA 4XLCA 2EA4A 3VB2A 1R22A 3RQIA 4KMUX 2J7UA 3CDIA 4A3KJ 4C2UA 2QGUA 4XKCA 2VASA 3IUOA 4QSHA 2K9QA 3UWPA 3SR4A 4IL6C 3GZ5A 4HSRA 2LK2A 4R1HA 5IPAA 1WI3A 2F6CA 3KETA 2LP0A 3VYSB 3ERED 3IWZA 3MCZA 3SZTA 3OR2C 4OAYA 1HQ1A 4CH7A 4Y42A 4IRHA 3ZQGA 2BE5F 2E71A 2M30A 2E35A 2O03A 3J81K 3JRAA 2BVLA 3OYKA 3HOYJ 5M3FJ 4B1RA 4MTEA 4MEYF 4RMNA 1ZPQA 4KN4X 3HOUJ 4XK4A 2LD5A 4P1WA 4Y3OA 2PG4A 2WC2A 3HUGA 2NOJB 4LIUA 1DQUA 1KYWA 4P55A 4RAZA 1MD0A 2QVOA 2GBYA 3CJTB 4IKFA 1FNNA 1ETXA 1QRYA 5FLVA 3OWQA 4HEA2 3FKJA 5LBQA 2BHYA 2HXOA 1SFUA 3LSTA 4RAYA 1U9OA 1ZZCA 3B7HA 3S16J 2MQKA 3QFIA 2XHKA 5LHGA 5BPIA 1YI2I 2DMPA 4OOIA 5GAHJ 1TC3C 2KIMA 3FXKA 1FTZA 5K5QA 3OQNA 1RC9A 1JE8A 2AXTC 1PJRA 4IJAA 2BOLA 4BHCA 2EF8A 2VKDA 4O3MA 3CMMA 1GLNA 2Y75A 3PNTA 4EKGA 3BLYA 4ER0A 2XSDC 2F5FA 3J7ZI 2HCNA 3BS3A 2V3CC 4XLNF 2O4AA 1VQ7I 3D5RC 2HDCA 1SFKA 2EZHA 2FJ1A 2MEZA 2XV4S 2XPWA 2STWA 4KMFA 9ANTA 3F6WA 3BROA 2PXTA 3R61A 2V6CA 3ZKCA 2RNGA 1VQLI 4LITA 3MKZA 2VOOA 3QF3A 3M8EA 4ZDLA 3O3KA 1I50J 2RDPA 1ZG1A 2LYKA 2X9DA 4YIIA 5E3LA 4E7JA 4XN3A 4HOBA 1P4XA 3HRSA 3G2BA 1JT0A 5GPAA 3DV8A 2R7RA 1HSTA 3IH2A 3D5SC 3QP5A 4RGXA 4LG0B 2X4HA 3ABMH 2M8EA 2DLLA 4A3CJ 1Z7UA 1JGSA 2BGCA 1WETA 2QKMB 4G6QA 3SQNA 1IRGA 3SEQA 3I58A 2ZJQF 2L49A 2MG4A 3HDDA 5K5OA 1RIOA 1RUNA 2GZWA 1BL0A 2KIFA 3TGNA 3OYBA 2DPDA 2GLOA 3PO2J 2R1JL 1O3SA 3KP2A 3Q0VA 3RPUA 3SHFA 1K78A 1LEBA 2PXBA 3E5XA 2F4IA 3I5UA 1LMB3 4QPQA 1ZN2A 4EK9A 1FY7A 4X6AJ 2MXDA 3OQOA 2E1MC 3IP4B 2JWTA 3KPHA 1W1WE 3P7NA 4E7IA 5L3EA 1MJ9A 5E3NA 1SD7A 2STTA 4OIOF 3CUQB 4Y13A 4I99C 2N8GA 4Q2JA 3UNGC 3G0TA 3J7AO 2E5NA 3BG6A 3FM3A 4NQWA 3Q0WA 3K4KA 1E3PA 1K79A 2JA8J 5KNLA 1KQ9A 2RGVA 2V9PA 5EYRA 1ZZBA 2QKLB 4I01A 4RA2A 4S05A 1SVMA 5GAEJ 2R3SA 3CLQA 1BOAA 3CCYA 3VEPA 4L5JA 1S7AA 1TWCJ 2R7FA 4NC8A 3MKYB 1MBJA 2WY8Q 3KP3A 5L3GA 2I5UA 2Y31A 3HOTA 3HOWJ 2ZJPF 2KIUA 4M3BA 3V7SA 5J8FA 3P9KA 2HINA 2L9VA 3IWFA 3AG1H 2HWVA 5L3CA 3HIFA 4RBOA 3CCQI 3ZQ7A 2F48A 2V6EA 2NAZA 2ID6A 3JCUC 2O8KA 2QA4I 5K5RA 3DF8A 1KU2A 3IKTA 4HX7A 5KCMA 4Y33A 1OSLA 4QWQA 1USTA 1Y39A 1GXQA 4MFEA 3W6KB 4ZYGA 1JWLA 2MBFA 5IYDJ 1WJ5A 4HZFA 2E19A 4M9ZA 3H35A 3R4KA 4HLXA 3N4MA 4RGRA 1X1PA 1P4AA 2V1DA 1XD7A 2WV0A 2V9KA 1HLVA 3GTOJ 1HKTA 2V26A 3U1DA 3K4CA 2RQQA 3ZP5A 3SDGA 2V1UA 2DTRA 3OSGA 2CWEA 1FYLA 3HYIA 1GXPA 2CG4A 2FNAA 4A3LJ 3EUHA 4S04A 1K6OA 3M4OJ 2EQRA 1G3WA 2R7QA 5CQGA 5AIQA 3Q9VA 5E79C 5FKMA 4ZDPA 3CC7I 2PI0A 2P5KA 4HBLA 1VQKI 4YEJA 1HF0A 4A3BJ 3KEYA 2Z5UA 3HTUA 2LLKA 3QOPA 3PQJA 1MKMA 4JYKA 2ZKZA 4I6UA 4XOTA 1RZRA 4C9YA 4ZJZA 3WU2C 2VPRA 3CP8A 3ZMSA 3E6CC 1JGGA 1NK2P 4ER7A 4OIPF 1ENHA 1EV7A 3EUHC 3HG9A 3OYEA 4F8DA 3DLLF 1U0JA 1FJLA 3H36A 4XKWA 3GFLA 1B6AA 1JJ8C 3S2HJ 1FT9A 4P9FA 4HF1A 3R6SA 4J1WA 1FWZA 4J00A 3QQAA 3TL4X 1JKQC 3M1CA 4F92B 1X1DA 4IOAF 3JW4A 4IRGA 1MBGA 2V1XA 4Q48A 4J1XA 3DKYA 2Q0OA 3PIOF 5GAGi 5BMZA 3E1SA 5E1ZB 1RKTA 3RKWA 3LAPA 1MDMB 3RZDJ 2R7UA 2DI3A 3QWLA 5FLMJ 3D5LA 5D6EA 3JRGA 1PP8F 2E1CA 1ZTRA 5IY5H 2A6CA 2XXPA 1P7JA 1WCMJ 4ENMA 5DSXA 1AU7A 3OYLA 1MJAA 4GCVA 4XNFA 3BR1A 4II3A 3HOSA 5EGOB 3ZQIA 3VDXA 2EV0A 4YFNF 1ZUGA 3C2GA 3BG7A 2GOMA 1VZ0A 3FZVA 2JRTA 2XUBA 2B63J 2PIJA 3H9GA 3ECHA 4EM0B 4HV6A 1OFCX 2FJRA 1NTCA 2UXXA 3Q9SA 1ITYA 3P9IA 1HDPA 3U9GA 1FYKA 4FN3A 3TW7A 5DD4A 3DU5A 1SD4A 2ECBA 1OPCA 1ZK8A 1NHAA 2R4GA 3F8NA 5ICFA 4BJ6C 3GBFA 1KU9A 1JXSA 1IG7A 2RV8A 3I59B 2JK3A 1V5FA 3I4NJ 4PSWA 3OV8A 5GP9A 1RKWA 3OOPA 4PJNA 5TGTA 1QHHD 1Z77A 1B72A 3K6GA 2L01A 3LFUA 4YFXF 1N75A 4P9UA 2VXDA 2BNMA 3K7AJ 4HW0A 1TLHB 1EA3A 2KISA 2CGPA 4AYBN 4UVBA 1Y8RB 5HDKA 1K4TA 1NERA 1LKXA 4IEJA 3L1PA 1Z6TA 4ZZDA 2CQQA 2KEJA 3BQYA 2IGOA 3SJMA 2LYJA 3ZPLA 2WTEA 3GO5A 4MLOA 3JTGA 1YYVA 4BACA 4A3JJ 4AUXA 1BIAA 1FMVA 1PERL 1O3QA 3U21A 1KU3A 3I59A 4CCKA 4KA4A 2F5VA 2KKOA 3AG4H 3AKZA 1QHGA 3LA3A 5E8GA 2HVRA 4CCNA 2LG4A 3E6BA 5D5VB 1SMTA 1QBJA 3JREA 2F5DA 1STZA 3LA7A 5J8CA 3T5XA 4CA0A 5F1RA 3SEZA 1GHCA 4FETA 1WZ2A 2NVYJ 2W57A 3LL7A 4HF2A 3HC7A 4GYGA 4M74A 3JTHA 2HFZA 2Y9ZA 3LFKA 2M4HA 3SYTA 3TMOA 3V7CA 1A31A 2KPMA 4B44A 1E3OC 5ICEA 2A6TA 1JTXA 1JJ6C 4KYWA 4LB6B 2VB6A 3H5TA 3B02A 4YG1A 4HDUA 2PMHA 2FE3A 3HOZJ 2YBDA 2E34A 1HW1A 4BYYA 1MNDA 2D2WA 3H1CA 5LHIA 2QSGX 4M3FA 5K1YA 2O9LA 1BR2A 2V1NA 3CCSI 4XRMA 2KLOA 1LVKA 2ZMEA 4XLEA 4Y7NJ 3AG2H 2CW7A 3KZZA 2AS5F 4WVLA 2VQCA 2GXAA 1R1TA 3DTKA 1Z9CA 3PJRA 3FKIJ 4IXAA 2L7FP 2A69F 4M6VA 5F1JA 2PJRA 2OBPA 4KISA 5F0CA 2AUWA 1M1EB 3GFIA 3DKWA 3KL4A 2DYSH 2CW8A 2FBKA 2VT3A 1GVJA 1D5YA 3VSLA 1S72I 4JX5A 3H9QA 3LFPA 3GUDA 2M5WA 2BBYA 3TDZC 3QRFF 4HQEA 2Z99A 3A9YA 2HPIA 4EEFG 1ADRA 1YX5A 2GWRA 3K1NA 1O3RA 3FXUA 3I56I 3GZDA 2OTJI 2HQAA 2DN0A 3CDLA 3GX4X 2ICWG 4KIBA 1UZCA 1TQPA 1FIPA 2LBFA 3EUSA 3MQ0A 4B3AA 4NHJA 2Y2ZA 4X4EA 3K70D 1FYMA 4A3IJ 2E60A 1LJ9A 4I02A 2R7OA 2X48A 2EFPA 1RPEL 3M3YJ 3CD6I 1YOVB 1V3FA 5A7LA 1RPWA 2IUOA 3CCRI 2L7ZA 2JN6A 2PUGA 1OR7C 4LG0A 5HS7A 1K83J 2CUEA 2YSRA 1R9TJ 2HDDA 1N25A 1IAWA 3CUOA 2YU9J 3GTGJ 3PNYA 2ZB9A 4ZYAA 3DPTA 1ZH5A 3C3WA 2VBWA 3FMQA 5FGMA 1AWCA 4GFBA 2FOWA 1X57A 2H8WA 2E2IJ 4IHTA 4RAGA 1LE8B 3WTWC 2B7EA 2IVBA 1U2WA 5CLSA 2PE5A 3L9FA 3MKWB 3A9ZA 1H9GA 3CLCA 4U0WA 4LB5A 1FIAA 3ZMUA 1MMDA 2AHQA 3LOCA 3ZQCA 2JT1A 1J75A 1MDMA 2PXKA 2IGMA 3DTEA 3LSJA 4MTDA 1P7IA 3O8HA 4ZH4F 2UWMA 4A93J 1LB2A 1L0OC 2G0EA 2BY1A 4I0AA 2P81A 3FMYA 2KEIA 1VI0A 1OCRH 1A36A 1LCDA 1VQ8I 4CICA 1D8JA 4UUVA 2MC4A 2AXLA 1UXDA 4LFUA 3FXMA 1MBKA 5CVUA 3E7LA 4HNTA 5J4YA 1KGSA 1YRNA 1ZKGA 3A01A 1LFPA 2E7XA 4ENJA 3S1MJ 1Z3XA 2TDXA 2IVGA 3R0AA 1B0NA 3F51A 1P9QC 1FPQA 2D45A 4CZCA 4FE4A 1U5TA 1X3ZB 2DA3A 2HR3A 1D8KA 1N78A 4PU3C 1QP0A 1WH8A 2BW3B 3K1PA 4FISA 3HEFA 4AIKA 2IS2A 4R8HA 4NC6A 5DRYA 2M8GX 1FOWA 2VQHA 3KP6A 4L9TA 1U8RA 1OMIA 4ESJA 4HRIA 2EV6A 2X1CA 2HSGA 3PUFA 3S15J 1D1CA 2YX4A 2L4MA 2OQGA 3HHGA 3VYUB 3BQZA 1T39A 3F8BA 3V4GA 2O6GE 1F1ZA 3OYJA 2DT5A 4EV0A 2CRGA 3OMYA 1YQAA 2B0LA 4XLAA 3CCUI 4BY7J 1MH4A 2JA2A 5DV5A 1FSEA 1A5JA 2A6EF 2NOGA 2DT7B 3I54A 2KP6A 1MGTA 2EIJH 3TDUC 1HKSA 2CUZA 1KU7A 1G2HA 1J2XA 5CVRA 4G7HF 2H1LA 4YG7B 1A6IA 1I3QJ 2JJ7A 4X1EA 2NVQJ 2W25A 1P2FA 3FXLA 1RR8C 2PMZN 1VQ9I 1IXRC 4MNUA 3W6VA 1HC8A 3GZ6A 1IF1A 1PRVA 5ICGA 1Q1VA 3X2QH 5IOZA 1MMSA 3ULQB 2ZFUA 3MKLA 1FEXA 5DD8A 4D0PA 4PSXA 1UG2A 4FX4A 1YSEA 4KICA 4DBQA 1SAXA 5DCMA 2OD5A 2WV1A 2H27A 2PUAA 1IV8A 2R7SA 3FK7A 2W84A 3BJAA 2LY2A 4A6EA 2IPQX 1IO2A 1RETA 2W48A 3L2UA 3RJPA 1YFHA 1ZR2A 2DYRH 3I71A 4I98B 4X4GA 5CVVA 5JFRA 2FMLA 3J80K 4XMYA 2DT6A 2G7HA 1NG6A 2MLKA 4P96A 4BS9A 4EVIA 2X6WA 2FQ3A 2M3AA 3A0HC 4KUMA 4F55A 1FLIA 2K4JA 3W6JB 2DQLA 5ED4A 4A3MJ 1BC7C 2QCOA 1ZLKA 4QIWN 3RIRA 5EG0A 3LNQA 3VYTB 1TW3A 3BTCA 3PXPA 2XKPA 3FK6A 4U0VA 1KZHA 1JUMA 3BZKA 1D0XA 1YIJI 2LF8A 1E3HA 3TKYA 1UMQA 2VKEA 3MMYB 2IGKA 3DBHB 5GAGJ 1TNTA 5TISC 5GAHi 2M7AA 1USSA 1UCRA 2D5VA 4ITVA 4I09A 2BVMA 2Q2EB 3KP4A 3IRRA 4YBAA 1X3UA 1H9TA 2F4OB 2L3DA 2J7WA 3GF2A 5HNHA 2KPJA 1UG0A 4LMYA 5CKTA 3JRBA 2VL8A 4IHYA 3KXAA 3QPSA 2AW6A 4UV9A 4G8XA 3MN2A 3EETA 3G4SI 3GEZA 4KT6A 1X2NA 1XCBA 3ESWB 3KE2A 4HNVA 4C30A 5HLTA 1V55H 2OTLI 2FFHA 5FKLA 3DXJF 3E6MA 1IC8A 1SVOA 3DEEA 2EFNA 4EM1A 1R4MB 1YX3A 4ZYDA 5C4JJ 1T38A 2BXZA 2L1PA 3MFKA 2VJIA 1X2LA 4LLLA 3R0JA 4FBIA 3IHUA 2PUFA 4BHPA 2NXNB 3CO7C 3I9V2 3QYXA 4LLGF 1SFEA 3J7YJ 2UV1A 1BC8C 4A0ZA 2CV1A 3S8QA 1DUXC 2FU4A 2NNNA 3LQXA 3C7JA 2CJJA 2KL4A 3S3OA 4MHGA 3R09A 3PM1A 4DYQA 1QNTA 3KLOA 4A3DJ 2XF7A 3NEUA 4G9YA 4EATA 1IGNA 4YG4A 3RQ4A 3ZMZA 2VI6A 2I8DA 1MMAA 2KDZA 2PMUA 5DM6F 4KT5C 1WJBA 1U6GA 1O3TA 1ETOA 4XM3A 1S9HA 1A35A 2VUMJ 2ELJA 4IRIA 4OWRB 2ZCWA 4WXHA 2DA7A 3N05A 1ZAOA 2MLGA 2XVCA 3GZCA 2VIXA 4E4HA 3PFIA 2W7NA 2FF4A 5DYMA 4YFKF 1AHDP 4RB2C 3CO6C 1TT5B 1QVUA 1WH6A 1IXSB 2WA0A 3WGIA 2L8NA 3NAUA 1U2ZA 2DJIA 1SAUA 2ESHA 1IDZA 1QP4A 1RI7A 3FHNA 1XDSA 1CGPA 5BNGA 3KFWX 4XN0A 3W2AA 2CQKA 4OAZA 5KVRA 4DQ2A 6PAXA 1BI3A 5CQEA 3T0YA 4LK1F 2VBXA 3Q5FA 2VOPA 1IW7F 1R5GA 2IP2A 1D1BA 5ERIA 4IHVA 4CDGA 1T2KA 2WY7Q 1O57A 2PXUA 4A6DA 2XPUA 3HRMA 1UELB 4BBSJ 3D1NI 1XSVA 1VQPI 2D1HA 1BW5A 1DU6A 1MNMC 2LY9A 5FROA 3GTJJ 5JUWA 1R1VA 2IA1A 1TNSA 2ZSIB 3CLOA 3H92A 4BE1A 1MNEA 1YE9A 4B3XA 2JA6J 2DO7A 2QYOA 4XSZF 2IS6A 4A0XA 1ZG3A 1ZQ3P 3BR6A 4DIQA 4YIFA 1OLTA 3RSNA 1XGSA 3F8FA 1CF7A 1ETVA 3OP9A 2ELHA 3RYPA 1JFSA 1A04A 1F5TA 1QZYA 4BUPA 3GN5A 3GFMA 1X2MA 2VBZA 2IA2A 2DA4A 3HZJA 2W82A 3SDBA 2DA2A 3A02A 3ZHIA 4Z59A 1KYZA 1QU3A 3HTSB 4Z2YA 4DZPA 4CYDA 2HTSA 1FOXA 1XSXA 2O5RA 1OYWA 1XC5A 1PUFA 1SVLA 3FIWA 2EILH 3MZHA 5A2QZ 5C44J 3FWEA 2RC4A 2EIMH 1T08B 3V7RA 1HDDC 1XGMA 3IH3A 3QPTA 1ONVA 2LKPA 5C3EJ 3AL0C 1RZRD 2HYGD 3BCAA 1MSEC 1WKMA 4UHTA 1WWXA 2NVXJ 2HFHA 1QP7A 5HNFA 5K98B 3A03A 1QQBA 5FLXZ 3FF5A 4WWCA 3FISA 5D8KB 3BWGA 1Z7LA 1MBEA 3GZNB 1BOBA 4MEXF 3KYLA 3E3VA 1F43A 3S8PA 2FD5A 3ROUA 1TTYA 1R1UA 3COAC 1IDYA 2L5QA 3B6AA 3FM5A 1TZLA 3R60A 5L3FA 2XC7A 2A5YB 3CMAI 3MZ8A 1ULYA 2XSJC 2OC6A 3FBIB 1JH9A 1PUFB 3WHCA 2OR1L 2VN2A 4E7LA 3M9LA 3LSRA 3CJRB 4ESFA 3JRDA 2P0WA 4BE2A 2JVGA 1IN8A 3QYEA 2BJCA 1DULA 2OV7A 5D5XB 2DK8A 3IL2A 2MC3A 2Z1DA 3BR0A 2M4KA 3K9TA 1BW6A 2ZFWA 2NVTJ 4XORA 3K4MA 2J5PA 3A0BC 4P5OA 2EFQA 2H8RA 2H09A 1R63A 1ZS4A 2FA5A 1ZVVA 2FEZA 2HZTA 2QENA 1WRJA 3TELA 2EK5A 1LDKB 3ZMVA 4A5NA 1YITI 1PDNC 1NEQA 2YX7A 2JA7J 3HOVJ 1Y9QA 3OYDA 3F0CA 2P4WA 2CSOA 3WU0A 4UUSA 4RGSA 2KHMA 2HS5A 3VWSA 3BJOA 1UHMA 3NDBB 3REOA 2LCVA 2UZKA 3WTVC 2WADA 4LLNA 3WODF 4M3EA 2Y0MA 1U9NA 4E7ZA 1Y0NA 2JRMA 2XAQA 4DGWB 1O4XA 3A2KA 3H0DA 1HKQA 1P92A 1R58A 4A3EJ 1Z3YA 1GT0C 1W5CC 3G73A 2QQBA 1U5TC 2ZXJA 4FASD 1AA7A 2HOEA 3QOXA 1W5SA 2RN7A 3DKXA 3QYBA 4LOCA 3ABUA 1CQTA 2LC2A 1VF9A 1Z6RA 1MFQC 4MO7A 2P5VA 1ERDA 2IXSA 1WFXA 3CECA 5DRTA 5IYCJ 1Y8QB 3ASOH 1T95A 4KDPA 2Y9YA 1WQ2A 4BDYA 2PPXA 1S7OA 4I7HA 3L2CA 3K2AA 4EQZA 4X4DA 3S2WA 2Z3YA 1NK3P 4ETSA 3OOUA 3H0GJ 4ASNA 2H6BA 2IU7A 1WHUA 4IQ4A 5LHHA 3G5GA 4JX4A 3IAM2 2L7MP 2VODA 1RRJA 3ZHMA 4PU8A 1OCCH 1GV5A 1U5TB 2XKOA 4J01A 1MMNA 2K85A 2FUG2 3L2VA 3FX3A 1IN7A 1J09A 4D5CA 1RESA 2DPUA 1FBQA 3E97A 3L2RA 1AKHA 3W2VA 4IA8A 2P6TA 4UB8C 4Y17A 3ZN0A 2CUJA 3BP8A 3NWSA 1PNRA 2WAQN 3LQRA 1UFMA 2NS8A 3PUBA 5D4SA 2DJNA 5FLXK 3ME5A 2JQ7A 1TWAJ 3G1LA 4Q47A 5E3OA 1QPIA 2X51A 3B6CA 3GXOA 3ELKA 4XRFA 2GA1A 3BZ6A 4U0YA 4HLYA 1RIOH 4AVZA 3GVAA 2EZIA 3BOQA 2CFOA 2DQRA 2WBMA 1BBYA 5IYBJ 1HOMA 4NDLA 2CV0A 2ZMEC 2R7VA 2ZMEB 3BPXA 2EJRA 4IHSA 1DP3A 1E2XA 3F3XA 3RDIA 2Q8KA 3J81Z 2Z9OA 3VK0A 4G94A 3S1QJ 3FYAA 1MMGA 4DBRA 1S5LC 1ON2A 4WX9A 1QPMA 1JTYA 2EB7A 3VWBA 1C0WA 3O6BB 2IVQA 1IV6A 1DU0A 2GAUA 1TT0A 4B47A 4O8BA 4L9NA 2PXLA 4HA8A 4LGWA 4C3IJ 1LPQA 5AONA 3DQVC 4BNCA 1UJ8A 1Z21A 3MEXA 4UVCA 3BG5A 1B72B 4D7NA 2XAHA 2JVHA 4MFDA 4GXOA 4JQFA 3NROA 2L7KA 4OU0A 2O8XA 3I0TA 2PXEA 1IN4A 3K2ZA 5ILVA 3NXHA 4WXCA 2OJED 2CW0F 3M8FA 3NRVA 4L5IA 5B66C 3FBNB 2JPBA 5H2FC 3JSOA 4S0HB 3NQOA 2EV5A 1CJGA 1WJEA 4ABZA 2H94A 1FBSA 3KLNA 1WJDA 4MQVA 4DE9A 2K3PA 1UAAA 1TQMA 2HTJA 4CZZA 3V8JA 1LDJA 3WG9A 5J1RA 4DYRA 3GTMJ 2O3FA 3JXCL 4HPQA 4M3DA 4QTRA 2J5OA 4EJWA 1MBHA 4D7MA 5E8IA 1YW9A 1O7LA 1QQIA 4CYCA 4NUBA 2ETHA 3FDYA 2QF7A 1JHFA 3S3NA 2AXVA 3F52A 1OCPA 3T1BA 3OYFA 3GYHX 3FMRA 1L3LA 1MW7A 3L2QA 1KONA 2P7VB 2K9MA 1YS7A 5E1WA 2R7XA 4DOZA 4EM2A 2WAQA 4I2OA 1S8NA 2NYXA 3LSMA 3VFZA 1X4OA 1H8AC 2YS9A 4BHBA 4E70A 4XIDA 3C1DA 3QYFA 2Q2EA 1BA5A 3FMSA 4X4BA 3E6DA 1WJAA 2JSCA 4I0BA 3CMYA 4EJVA 3PSIA 2DTZA 2CV2A 2VKHA 4I6ZA 2D1VA 5GPCA 2LDUA 3DBRB 2IJLA 1UB9A 4A3GJ 2OFYA 2XRNA 3TFLA 1OYIA 1OCTC 4PJMA 4NDWA 4HX4A 2V79A 1BJZA 3EPZA 3BJ6A 3S17J 1VNDA 1X1BA 4JOMA 4MIMA 3OYGA 3F72A 3A9XA 1JUPA 1B4AA 4OINF 3DNVB 2AWIA 2L02A 1GUUA 2YR2A 2VE9A 1QA6A 1V4RA 1FSHA 2LREA 3HPHA 5KAFC 4J19A 1H89C 2IBDA 3TP0A 2PQ8A 3RYRA 5FB2A 2LLVA 4ER6A 4AU7A 2COBA 3ZQLA 5A2QK 4CCLA 4B43A 2KT0A 4M73A 3K4NA 1JI8A 1XB4A 2FBHA 5DDGA 2LF7A 3ZPXA 2WIUB 1KQ0A 3CCEI 1W0TA 4JX6A 2PJRB 5IP7J 4JK1X 1ETKA 1D1AA 4WXDA 4AIDA 2X6XA 2GXGA 2E2JJ 5E18F 2VLAA 1W7PB 2Q1ZB 3QPHA 1YO5C 5H6QA 2HU9A 4PU7A 3AFHA 3IC7A 4ON0A 2K5CA 5K7HA 4L18B 1P6RA 1ZR4A 3VSKA 3PIPF 1JT6A 3GBGA 2PEXA 3ZMDA 2L9SA 2BY2A 2VEOA 2AQFA 2JCGA 1SFOJ 4B48A 3HZIB 4CSWA 1LCCA 4ZC3A 1OKRA 4HSTA 1H88C 2JUGA 4FTHA 1LE8A 4X4IA 4IF4A 5J40A 3FXJA 1ZGWA 4R79A 2ISZA 4Y52J 2ICTA 1LUJB 3LSGA 5B1AH 2ECCA 2VJ5A 3K10A 2E1OA 1PUEE 2R7DA 5CYVA 4CHUA 1IRXA 2LKXA 4EJTA 3OYCA 1XMXA 5J47A 2HKOA 3MLFA 1Z91A 3JSPA 2EZLA 2JSPA 3TO7A 3OS2A 3NZLA 3DP7A 1JKOC 4MCXA 4OIQF 5CVJA 4EKIA 2P7CB 3FYMA 2Y0SA 3ABLH 3VYRB 1TBXA 4IVZA 1POUA 4L5EA 5HOOA 3LAJA 2XGDA 4IX7A 3HL2A 4BBRJ 4HYEA 1HQCA 3R1FA 2XRLA 4XLHA 2ZNZA 4H0EA 2HQ5A 4RB0A 2KFDA 3WU1B 1ETWA 2GA2A 2L9RA 3U1KA 3UKGA 1ZRDA 3BDNA 5DCFA 1FTTA 2V4JC 3VPRA 1RNLA 3LSPA 1DP7P 1X4PA 2M7BA 2LFBA 1TWFJ 1FC3A 2LH9A 1NH3A 4BXXJ 1DPUA 4IO9F 5F0FA 1R00A 2KRHA 4W1UA 3S32A 2M0MA 1T56A 2F5EA 4U88A 3GLXA 1DDNA 2AQEA 3SXYA 2LYQA 4OMZA 4XL9A 4BQAA 2W1OA 1VQNI 4DJAA 4DNCA 3OS0A 2AO9A 4L9VA 4XOPA 2IV1A 3JXDL 1IRZA 2PXQA 4AIJA 2NS0A 1Q1HA 3EUAA 2CH0A 2AXUA 1YRNB 1ZLJA 4F93B 2MGQA 1YS6A 1G59A 2E5ZA 1WJCA 2EFWA 2QBYA 1OISA 1N77A 1JFTA 2M0CA 2GRMA 3H5NA 4NNJA 3AAFA 2Y0SN 3IVPA 1VQMI 4FCYA 4PFPA 1WGXA 4A5MA 2R7TA 4GDFA 3ZOBA 2IEKA 2BW3A 5C4XJ 4BE0A 3MEJA 1T98A 1YW8A 2RVCA 2X0LA 3PQKA 3EQLF 4XICA 2XI8A 1OR7A 4CCOA 3WTXC 3C2HA 3BDDA 2X1EA 4C2MJ 2ZO4A 2ODRD 4E7SA 1OQYA 5LGUA 1ETQA 2O49A 3TBIA 2XGEA 4KN7X 3S2DJ 4XR6A 2QLZA 5BOXA 4V2FA 5DUKA 2RQPA 4ANJA 4C2TA 3M1EA 1E17A 4DE8A 5JVGF 3G7DA 3PL8A 1Z67A 2IAIA 2DFEA 4A0YA 1TW2A 3E0JB 2XF6A 2RKHA 5BS6A 4ZTFA 5EEGA 3ML6A 4EGYA 3HBLA 4YIRX 3F23A 2OA4A 2PXPA 5HDNA 4B4CA 1BIBA 1ZZ9A 4UY8I 1D5VA 2WUSR 4FHTA 4IHWA 2HGCA 3TEPA 4UB6C 1V54H 2KQRA 2DMQA 3QOEA 1JUSA 2GXBA 2ACJA 4V19K 3OMTA 2ZXIA 3DFGA 4N9IA 3DU6A 2R63A 1YIOA 1G3TA 3SCGA 3DLAA 4M3GA 2B9SA 1ZG5A 2BHZA 1HA8A 2IS4A 2YPRA 2VKVA 3KJXA 2XDVA 3CDHA 3M8JA 2EWNA 4PFOA 1QZZA 5EEHA 5KK1A 4K2EA 4U7BA 5EG0B 3PO3J 1WJFA 3A4CA 1WIZA 3SZPA 1Y56A 2LRDA 3K69A 1W36D 2HEOA 4EZIA 3F6OA 2EPFA 4UUTA 4BH9A 4M71A 4I6RA 4HAMA 1OYYA 1BI1A 2GZUA 1LQCA 1R5ID 5FRMA 2V9VA 1MIJA 2HNHA 3CUQC 4N0BA 5H20A 1TL8A 1IJWC 2VXZA 1Y1VJ 2ZBKA 4N4OB 3JRFA 5F0HA 3EYIA 2FNPA 4QLCU 3QU3A 3ZR8X 3JAMZ 3DEUA 3S1RJ 3RZOJ 1W7PA 2QQ9A 5F6FA 5ILUA 3ZRGA 4KIGA 4UNOA 2X6YA 2PJPA 3MWMA 3TO6A 2LTPA 1QQAA 4ZDOA 1Z0XA 4PZJA 2O0YA 2ID3A 5L3DA 2VPLA 1FX7A 3WGHA 3KEQA 2XROA 3K0LA 4HV5A 1ETYA 2E1NA 3MVPA 3F21A 2FSWA 3HPGA 3LSIA 4XLFA 1MSFC 4TV7A 2IW5A 3TP3A 4BKXA 2DMUA 2K9SA 4M72A 3C18A 4Z58A 1O7FA 2LYRA 1WH7A 4M9XA 1B1BA 3KIOA 3I55I 4DYCA 2PUEA 1QGPA 1YJWI 3OYNA 3E5QA 2XGCA 2JQEA 2CS3A 3EUKL 5J4VA 2JVLA 2R0QC 2XB0X 3OSFA 1KQ8A 3OYHA 1I1GA 3EDPA 3ASNH 3F6VA 1K7AA 2XASA 5F04A 1UTXA 1X58A 2H1KA 4RM2A 2HCSA 1EJ9A 4BQNA 1ON1A 5J3LA 4N4NB 5GTIC 5B1BH 3FXOA 3I53A 2BNNA 2EINH 1FP1D 1W4MA 2CO5A 2LVSA 4M6XA 3UR3C 3NARA 2ZSHB
chains in the Genus database with same CATH topology
3H3VK 3HOVJ 5J1YA 1PRAA 1E3OC 2LYSA 1Y9QA 3F0CA 1JTXA 2ELKA 3CQZJ 1JJ6C 4UUSA 2DMNA 3H5TA 4YG1A 3ZQHA 2LCVA 2O38A 3HOZJ 2HI3A 4D5FA 4M3EA 2LYLA 1U9NA 2LR8A 3GTKJ 4GHJA 1O4XA 2CQXA 3Q3SA 4M3FA 2O9LA 3S14J 4AC0A 1ORKA 4A3EJ 1GT0C 4JP0A 2K9NA 4XRMA 3LISA 1GV2A 4X4FA 4Y7NJ 1T33A 2XCJA 2WB1N 3RKQA 4LOCA 1CQTA 1DWKA 1VF9A 4MO7A 4C3HJ 5M3MJ 2R5ZB 3FKIJ 2L7FP 2O7OA 4M6VA 5F1JA 3G1MA 3CECA 3BR3A 3SFIA 5IYCJ 5F0CA 2AUWA 3HGYA 2PPXA 2Y9YA 1D5YA 5M5XJ 4X4DA 3K2AA 1NK3P 3LFPA 3OOUA 4JX5A 3H0GJ 2IU7A 5IP9J 4EEFG 2LYPA 3G5GA 1ADRA 2PUDA 4JX4A 2L7MP 2Y30A 2CU7A 5FKNA 2DN0A 3ZQFA 3ZHMA 3CDLA 1Y7YA 3WHBA 4C3JJ 4PU8A 1FIPA 1R69A 1GV5A 5EEAA 3EUSA 3RZZA 3SCFA 4MCTA 3O8GA 3BG3A 4B3AA 2Y2ZA 4X4EA 2B5AA 2R92J 4A3IJ 4D5CA 2EBIA 1RESA 1AKHA 3C2BA 2X48A 1WPKA 4IA8A 1MH3A 1RPEL 3M3YJ 5A7LA 1RPWA 2IUOA 2EBYA 3HOXJ 1PNRA 2L7ZA 2JN6A 2WAQN 2NS8A 2PUGA 2DJNA 1R9TJ 1K83J 2CUEA 4YARA 4UUSB 2HDDA 1TWAJ 3G1LA 5E3OA 2YU9J 2CSFA 1QPIA 3GTGJ 2TRTA 2ZB9A 2BNOA 3B6CA 2GM4A 4JCYA 4G12A 4DW6A 3BTIA 2MW8A 4GFBA 4Z5CA 1RZSA 1X57A 2EZIA 2E2IJ 1LE8B 3GTLJ 5EZGA 2ME0A 2YUSA 5K7ZA 3TRBA 2HOSA 3OIOA 5IYBJ 1HOMA 2IVBA 4NDLA 2PE5A 3CLCA 1FIAA 2OPTA 2AHQA 3LOCA 3ZQCA 3KZ3A 4Z5HA 5FKOA 3GTQJ 3VK0A 3S1QJ 3FYAA 2L0KA 1BDIA 2EZKA 2I10A 3LSJA 1MBFA 1P7IA 3O8HA 1ZZ8A 4RDUA 4A93J 3G1OA 1JTYA 2G0EA 3GN5B 2P81A 3FMYA 2IVQA 1IV6A 2KEIA 1VI0A 1DU0A 1BDHA 4X4CA 1W0UA 4W97A 4IHXA 3GTPJ 1LCDA 4O8BA 2M2EA 4C3IJ 3DCFA 1UXDA 5IP6A 1MBKA 3E7LA 2M34A 1YRNA 1ZKGA 3BG5A 3A01A 4D7NA 1B72B 3S1MJ 4MFDA 3RQIA 1ZZ6A 2IVGA 4A3KJ 2PUCA 1B0NA 3F51A 4QSHA 2K9QA 1I6HJ 4FE4A 2DA3A 3BTJA 2LK2A 5IPAA 1WI3A 2HXIA 1WH8A 4PU3C 3JXBC 1QP0A 2LP0A 3HEFA 4FISA 4S0HB 1CJGA 2M8GX 4ABZA 1U8BA 2HSGA 3BT9A 4Y42A 3ZQGA 5J1RA 3S15J 4DYRA 3GTMJ 3JXCL 1POGA 3JRAA 1K61A 4M3DA 3BQZA 4QTRA 3HOYJ 5M3FJ 4B1RA 3IV5A 1MBHA 4D7MA 1ZPQA 2CRGA 3HOUJ 4XK4A 2LD5A 4CYCA 4BY7J 2QF7A 2AXVA 3F52A 1MH4A 1OCPA 2M9HA 3JRCA 5F08A 1A5JA 2NOGA 1HCRA 2RAEA 2GBYA 3BG9A 3A01B 3BR2A 1ETXA 1QRYA 5FLVA 2ICPA 1G2HA 1H8AC 2YS9A 4XIDA 2HXOA 1BA5A 4YG7B 1A6IA 1I3QJ 4X4BA 1U9OA 1ZZCA 3B7HA 2JJ7A 4XRSA 4X1EA 2NVQJ 3W6VA 4I76A 3S16J 2MQKA 2PMZN 1ZZ7A 1LLIA 1QVTA 3CMYA 3HM5A 1PRVA 2DMPA 2DTZA 3JRIA 1Q1VA 5IOZA 4I6ZA 5GPCA 1TC3C 3MKLA 1FEXA 1FTZA 3OQNA 1UG2A 4A3GJ 4Z5DA 1YSEA 2OFYA 1OCTC 2WV1A 4NDWA 2XJ3A 2PUAA 3HGGA 2EF8A 1BJZA 3FK7A 1B8IA 2XSDC 3S17J 3BS3A 1VNDA 2O4AA 1RETA 2W48A 4MIMA 1JUPA 2E2HJ 4JCXA 4XRSG 1ZR2A 2EZHA 2FJ1A 2AWIA 1GUUA 2XPWA 2KZ8A 2MEZA 3DNVB 4X4GA 9ANTA 3F6WA 4J19A 1H89C 3ZKCA 5JLXA 2IBDA 3QF3A 3TP0A 2COBA 3ZQLA 1I50J 4A3MJ 2KT0A 2LYKA 2X9DA 5E3LA 5EZHA 1IUFA 2QCOA 4QIWN 5EG0A 2FX0A 5GPAA 3LNQA 5DTDA 3IH2A 3TEDA 1JT0A 2WIUB 1W0TA 3BTCA 4JX6A 5EGOA 5IP7J 3PXPA 5DS9A 1ETKA 3DEWA 1AKHB 4A3CJ 3FK6A 4JQDA 1JUMA 3Q0UA 2E2JJ 1WETA 2L49A 2MG4A 3HDDA 4PU7A 1RIOA 1UMQA 1BL0A 2VKEA 5K7HA 1ZR4A 2XPVA 2GLOA 1JT6A 3GBGA 3PO2J 2R1JL 1VFCA 2HOAA 3Q0VA 1SFOJ 2JCGA 2D5VA 3HZIB 1LCCA 1H88C 1LE8A 4X4IA 1LMB3 5EDNA 4FTHA 4X6AJ 3BR5A 1ZGWA 3OQOA 4Y52J 2ICTA 4YBAA 2JWTA 2R93J 1SQ8A 3LSGA 2ECCA 5E3NA 2KPJA 2E1OA 3JRBA 3U3WA 2LKXA 2N8GA 4IHYA 3KXAA 3QPSA 2AW6A 4A3FJ 2K40A 4I6TA 1LFBA 3MLFA 3MN2A 2EZLA 3Q0WA 2JA8J 1X2NA 5IOYA 4HNVA 5EYRA 1JKOC 4MCXA 1ZZBA 5EF6A 5FKLA 1IC8A 5C4JJ 3FYMA 4IVZA 3CCYA 3JRHA 1X2LA 1POUA 4L5EA 4FBIA 2XGDA 3QQ6A 1TWCJ 2DA5A 4BBRJ 1LFUP 2GRLA 3QYXA 1MBJA 3R1FA 2XRLA 2Y31A 3HOWJ 3UKGA 2HQ5A 4M3BA 5HODA 2R7ZJ 1ETWA 2L9RA 3BDNA 3S8QA 2HINA 2JA5J 1S7EA 1WH5A 2CJJA 3VPRA 3LSPA 2XB5A 1FTTA 3PM1A 4DYQA 5FJ8J 1EFAA 4RBOA 2LFBA 4A3DJ 2OF7A 1TWFJ 4BXXJ 2ID6A 1IGNA 2O8KA 4YG4A 5F0FA 4W1UA 2VI6A 1T56A 2KDZA 1OSLA 1U78A 2LYQA 4MFEA 2DA1A 1JWLA 4A69C 5IYDJ 1ETOA 2E19A 1Y1WJ 2AO9A 2IV1A 3UFDA 3JXDL 2VUMJ 1IRZA 2AXUA 2PUFA 1HLVA 2JMWA 1YRNB 2MGQA 3GTOJ 3O9XA 2DA7A 2FQ4A 2HOTA 3SDGA 1F36A 1JFTA 2M0CA 2GRMA 3OSGA 1AHDP 4CYCB 1QVUA 1WH6A 2L8NA 2Y0SN 3IVPA 4X4HA 4FCYA 3NAUA 4A3LJ 2CUFA 3M4OJ 1WGXA 2EQRA 3ZOBA 2IEKA 1IDZA 1DW9A 1QP4A 5C4XJ 5FKMA 5K7FA 5BNGA 2NS7A 4XICA 2XI8A 1HF0A 4A3BJ 4V2GA 3OQMA 1UHSA 4C2MJ 2R5ZA 4OB4A 2R5YA 2LLKA 4JYKA 1L1MA 3BTLA 1ETQA 4IHVA 4I6UA 2O49A 2XGEA 3S2DJ 1RZRA 4V2FA 3IH4A 1XS9A 1RR7A 3TW6A 3HB9A 2VPRA 3G7DA 2XPUA 1JGGA 2IAIA 1NK2P 1GVDA 4BBSJ 1ENHA 3D1NI 1BW5A 1DU6A 5FKKA 1MNMC 1JKRC 2LY9A 1PRUA 4F8DA 3GTJJ 1FJLA 3HBLA 2JA6J 1JJ8C 3S2HJ 4IWRA 4B4CA 1ZZ9A 2WUSR 2ME6A 4J1WA 1ZQ3P 4IHWA 3BR6A 3I4MJ 2CROA 2DMQA 3QQAA 1JUSA 5M5WJ 1JKQC 1ETVA 3OMTA 1TWGJ 3OP9A 2R63A 1MBGA 4J1XA 1JFSA 2DMTA 3GN5A 3QPLA 1OJLA 3SCGA 4M3GA 5E3MA 1RKTA 5J1UA 3RZDJ 2TCTA 1X2MA 2VKVA 2R5YB 3KJXA 4BY1J 5FLMJ 1B8IB 2DA4A 4GQMA 3JRGA 1ZTRA 2A6CA 2DA2A 3A02A 5JLWA 3JR9A 1P7JA 1WCMJ 5EG0B 3PO3J 3ZHIA 4Z59A 1AU7A 4DZPA 1WIZA 3BR1A 4I8TA 5EGOB 1XC5A 1PUFA 3ZQIA 2X6OA 3FIWA 2DA6A 1ZUGA 5C44J 4UUTA 2B63J 2PIJA 4I6RA 1HDDC 4DZJA 1OFCX 3IH3A 2FJRA 1NTCA 2GZUA 1LQCA 1ITYA 1HDPA 4FN3A 1ZAYA 5C3EJ 3TW7A 1RZRD 1IJWC 2HYJA 2ECBA 1MSEC 1Y1VJ 1ZK8A 3JRFA 5F0HA 5M5YJ 1UXCA 3GBFA 2NVXJ 1QP7A 1QQBA 3HKZN 5K98B 3A03A 1IG7A 2KEKA 3FISA 2JK3A 1MBEA 3S1RJ 3I4NJ 3RZOJ 1F43A 5GP9A 1RKWA 1JKPC 3BD1A 2FD5A 3QWGA 1Z77A 1B72A 4FE7A 1IDYA 2LTPA 1XWRA 3B6AA 1QQAA 1Z0XA 1APLC 2ID3A 2BNMA 3K7AJ 1SANA 1ETYA 3MVPA 4AYBN 1JH9A 1PUFB 3SCHA 3WHCA 2OR1L 1MSFC 1EF4A 3TP3A 3CROL 4BKXA 2DMUA 2K9SA 1NERA 4Z58A 4IEJA 2LYRA 3L1PA 1WH7A 3LSRA 3JRDA 2XIUA 2CQQA 4DYCA 2KEJA 2PUEA 3BQYA 1VPWA 3SJMA 2XGCA 2LYJA 2EWTA 2EH3A 1GDTA 4MLOA 2BJCA 2PUBA 1TWHJ 1XG1A 2JVLA 2MSYA 2R0QC 3BR0A 4AUXA 4A3JJ 4PU4C 2XB0X 1BW6A 1PERL 3OSFA 1QPZA 2NVTJ 2H8RA 5F04A 1UTXA 1X58A 5F27A 2H1KA 1R63A 1ZS4A 2AXZA 5J3LA 1ZVVA 3JREA 3S1NJ 2BNNA 2NVYJ 1NEQA 2LVSA 2Y9ZA 3NARA 2JA7J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H3V K;  3HOV J;  5J1Y A;  1PRA A;  1E3O C;  2LYS A;  1Y9Q A;  3F0C A;  1JTX A;  2ELK A;  3CQZ J;  1JJ6 C;  4UUS A;  2DMN A;  3H5T A;  4YG1 A;  3ZQH A;  2LCV A;  2O38 A;  3HOZ J;  2HI3 A;  4D5F A;  4M3E A;  2LYL A;  1U9N A;  2LR8 A;  3GTK J;  4GHJ A;  1O4X A;  2CQX A;  3Q3S A;  4M3F A;  2O9L A;  3S14 J;  4AC0 A;  1ORK A;  4A3E J;  1GT0 C;  4JP0 A;  2K9N A;  4XRM A;  3LIS A;  1GV2 A;  4X4F A;  4Y7N J;  1T33 A;  2XCJ A;  2WB1 N;  3RKQ A;  4LOC A;  1CQT A;  1DWK A;  1VF9 A;  4MO7 A;  4C3H J;  5M3M J;  2R5Z B;  3FKI J;  2L7F P;  2O7O A;  4M6V A;  5F1J A;  3G1M A;  3CEC A;  3BR3 A;  3SFI A;  5IYC J;  5F0C A;  2AUW A;  3HGY A;  2PPX A;  2Y9Y A;  1D5Y A;  5M5X J;  4X4D A;  3K2A A;  1NK3 P;  3LFP A;  3OOU A;  4JX5 A;  3H0G J;  2IU7 A;  5IP9 J;  4EEF G;  2LYP A;  3G5G A;  1ADR A;  2PUD A;  4JX4 A;  2L7M P;  2Y30 A;  2CU7 A;  5FKN A;  2DN0 A;  3ZQF A;  3ZHM A;  3CDL A;  1Y7Y A;  3WHB A;  4C3J J;  4PU8 A;  1FIP A;  1R69 A;  1GV5 A;  5EEA A;  3EUS A;  3RZZ A;  3SCF A;  4MCT A;  3O8G A;  3BG3 A;  4B3A A;  2Y2Z A;  4X4E A;  2B5A A;  2R92 J;  4A3I J;  4D5C A;  2EBI A;  1RES A;  1AKH A;  3C2B A;  2X48 A;  1WPK A;  4IA8 A;  1MH3 A;  1RPE L;  3M3Y J;  5A7L A;  1RPW A;  2IUO A;  2EBY A;  3HOX J;  1PNR A;  2L7Z A;  2JN6 A;  2WAQ N;  2NS8 A;  2PUG A;  2DJN A;  1R9T J;  1K83 J;  2CUE A;  4YAR A;  4UUS B;  2HDD A;  1TWA J;  3G1L A;  5E3O A;  2YU9 J;  2CSF A;  1QPI A;  3GTG J;  2TRT A;  2ZB9 A;  2BNO A;  3B6C A;  2GM4 A;  4JCY A;  4G12 A;  4DW6 A;  3BTI A;  2MW8 A;  4GFB A;  4Z5C A;  1RZS A;  1X57 A;  2EZI A;  2E2I J;  1LE8 B;  3GTL J;  5EZG A;  2ME0 A;  2YUS A;  5K7Z A;  3TRB A;  2HOS A;  3OIO A;  5IYB J;  1HOM A;  2IVB A;  4NDL A;  2PE5 A;  3CLC A;  1FIA A;  2OPT A;  2AHQ A;  3LOC A;  3ZQC A;  3KZ3 A;  4Z5H A;  5FKO A;  3GTQ J;  3VK0 A;  3S1Q J;  3FYA A;  2L0K A;  1BDI A;  2EZK A;  2I10 A;  3LSJ A;  1MBF A;  1P7I A;  3O8H A;  1ZZ8 A;  4RDU A;  4A93 J;  3G1O A;  1JTY A;  2G0E A;  3GN5 B;  2P81 A;  3FMY A;  2IVQ A;  1IV6 A;  2KEI A;  1VI0 A;  1DU0 A;  1BDH A;  4X4C A;  1W0U A;  4W97 A;  4IHX A;  3GTP J;  1LCD A;  4O8B A;  2M2E A;  4C3I J;  3DCF A;  1UXD A;  5IP6 A;  1MBK A;  3E7L A;  2M34 A;  1YRN A;  1ZKG A;  3BG5 A;  3A01 A;  4D7N A;  1B72 B;  3S1M J;  4MFD A;  3RQI A;  1ZZ6 A;  2IVG A;  4A3K J;  2PUC A;  1B0N A;  3F51 A;  4QSH A;  2K9Q A;  1I6H J;  4FE4 A;  2DA3 A;  3BTJ A;  2LK2 A;  5IPA A;  1WI3 A;  2HXI A;  1WH8 A;  4PU3 C;  3JXB C;  1QP0 A;  2LP0 A;  3HEF A;  4FIS A;  4S0H B;  1CJG A;  2M8G X;  4ABZ A;  1U8B A;  2HSG A;  3BT9 A;  4Y42 A;  3ZQG A;  5J1R A;  3S15 J;  4DYR A;  3GTM J;  3JXC L;  1POG A;  3JRA A;  1K61 A;  4M3D A;  3BQZ A;  4QTR A;  3HOY J;  5M3F J;  4B1R A;  3IV5 A;  1MBH A;  4D7M A;  1ZPQ A;  2CRG A;  3HOU J;  4XK4 A;  2LD5 A;  4CYC A;  4BY7 J;  2QF7 A;  2AXV A;  3F52 A;  1MH4 A;  1OCP A;  2M9H A;  3JRC A;  5F08 A;  1A5J A;  2NOG A;  1HCR A;  2RAE A;  2GBY A;  3BG9 A;  3A01 B;  3BR2 A;  1ETX A;  1QRY A;  5FLV A;  2ICP A;  1G2H A;  1H8A C;  2YS9 A;  4XID A;  2HXO A;  1BA5 A;  4YG7 B;  1A6I A;  1I3Q J;  4X4B A;  1U9O A;  1ZZC A;  3B7H A;  2JJ7 A;  4XRS A;  4X1E A;  2NVQ J;  3W6V A;  4I76 A;  3S16 J;  2MQK A;  2PMZ N;  1ZZ7 A;  1LLI A;  1QVT A;  3CMY A;  3HM5 A;  1PRV A;  2DMP A;  2DTZ A;  3JRI A;  1Q1V A;  5IOZ A;  4I6Z A;  5GPC A;  1TC3 C;  3MKL A;  1FEX A;  1FTZ A;  3OQN A;  1UG2 A;  4A3G J;  4Z5D A;  1YSE A;  2OFY A;  1OCT C;  2WV1 A;  4NDW A;  2XJ3 A;  2PUA A;  3HGG A;  2EF8 A;  1BJZ A;  3FK7 A;  1B8I A;  2XSD C;  3S17 J;  3BS3 A;  1VND A;  2O4A A;  1RET A;  2W48 A;  4MIM A;  1JUP A;  2E2H J;  4JCX A;  4XRS G;  1ZR2 A;  2EZH A;  2FJ1 A;  2AWI A;  1GUU A;  2XPW A;  2KZ8 A;  2MEZ A;  3DNV B;  4X4G A;  9ANT A;  3F6W A;  4J19 A;  1H89 C;  3ZKC A;  5JLX A;  2IBD A;  3QF3 A;  3TP0 A;  2COB A;  3ZQL A;  1I50 J;  4A3M J;  2KT0 A;  2LYK A;  2X9D A;  5E3L A;  5EZH A;  1IUF A;  2QCO A;  4QIW N;  5EG0 A;  2FX0 A;  5GPA A;  3LNQ A;  5DTD A;  3IH2 A;  3TED A;  1JT0 A;  2WIU B;  1W0T A;  3BTC A;  4JX6 A;  5EGO A;  5IP7 J;  3PXP A;  5DS9 A;  1ETK A;  3DEW A;  1AKH B;  4A3C J;  3FK6 A;  4JQD A;  1JUM A;  3Q0U A;  2E2J J;  1WET A;  2L49 A;  2MG4 A;  3HDD A;  4PU7 A;  1RIO A;  1UMQ A;  1BL0 A;  2VKE A;  5K7H A;  1ZR4 A;  2XPV A;  2GLO A;  1JT6 A;  3GBG A;  3PO2 J;  2R1J L;  1VFC A;  2HOA A;  3Q0V A;  1SFO J;  2JCG A;  2D5V A;  3HZI B;  1LCC A;  1H88 C;  1LE8 A;  4X4I A;  1LMB 3;  5EDN A;  4FTH A;  4X6A J;  3BR5 A;  1ZGW A;  3OQO A;  4Y52 J;  2ICT A;  4YBA A;  2JWT A;  2R93 J;  1SQ8 A;  3LSG A;  2ECC A;  5E3N A;  2KPJ A;  2E1O A;  3JRB A;  3U3W A;  2LKX A;  2N8G A;  4IHY A;  3KXA A;  3QPS A;  2AW6 A;  4A3F J;  2K40 A;  4I6T A;  1LFB A;  3MLF A;  3MN2 A;  2EZL A;  3Q0W A;  2JA8 J;  1X2N A;  5IOY A;  4HNV A;  5EYR A;  1JKO C;  4MCX A;  1ZZB A;  5EF6 A;  5FKL A;  1IC8 A;  5C4J J;  3FYM A;  4IVZ A;  3CCY A;  3JRH A;  1X2L A;  1POU A;  4L5E A;  4FBI A;  2XGD A;  3QQ6 A;  1TWC J;  2DA5 A;  4BBR J;  1LFU P;  2GRL A;  3QYX A;  1MBJ A;  3R1F A;  2XRL A;  2Y31 A;  3HOW J;  3UKG A;  2HQ5 A;  4M3B A;  5HOD A;  2R7Z J;  1ETW A;  2L9R A;  3BDN A;  3S8Q A;  2HIN A;  2JA5 J;  1S7E A;  1WH5 A;  2CJJ A;  3VPR A;  3LSP A;  2XB5 A;  1FTT A;  3PM1 A;  4DYQ A;  5FJ8 J;  1EFA A;  4RBO A;  2LFB A;  4A3D J;  2OF7 A;  1TWF J;  4BXX J;  2ID6 A;  1IGN A;  2O8K A;  4YG4 A;  5F0F A;  4W1U A;  2VI6 A;  1T56 A;  2KDZ A;  1OSL A;  1U78 A;  2LYQ A;  4MFE A;  2DA1 A;  1JWL A;  4A69 C;  5IYD J;  1ETO A;  2E19 A;  1Y1W J;  2AO9 A;  2IV1 A;  3UFD A;  3JXD L;  2VUM J;  1IRZ A;  2AXU A;  2PUF A;  1HLV A;  2JMW A;  1YRN B;  2MGQ A;  3GTO J;  3O9X A;  2DA7 A;  2FQ4 A;  2HOT A;  3SDG A;  1F36 A;  1JFT A;  2M0C A;  2GRM A;  3OSG A;  1AHD P;  4CYC B;  1QVU A;  1WH6 A;  2L8N A;  2Y0S N;  3IVP A;  4X4H A;  4FCY A;  3NAU A;  4A3L J;  2CUF A;  3M4O J;  1WGX A;  2EQR A;  3ZOB A;  2IEK A;  1IDZ A;  1DW9 A;  1QP4 A;  5C4X J;  5FKM A;  5K7F A;  5BNG A;  2NS7 A;  4XIC A;  2XI8 A;  1HF0 A;  4A3B J;  4V2G A;  3OQM A;  1UHS A;  4C2M J;  2R5Z A;  4OB4 A;  2R5Y A;  2LLK A;  4JYK A;  1L1M A;  3BTL A;  1ETQ A;  4IHV A;  4I6U A;  2O49 A;  2XGE A;  3S2D J;  1RZR A;  4V2F A;  3IH4 A;  1XS9 A;  1RR7 A;  3TW6 A;  3HB9 A;  2VPR A;  3G7D A;  2XPU A;  1JGG A;  2IAI A;  1NK2 P;  1GVD A;  4BBS J;  1ENH A;  3D1N I;  1BW5 A;  1DU6 A;  5FKK A;  1MNM C;  1JKR C;  2LY9 A;  1PRU A;  4F8D A;  3GTJ J;  1FJL A;  3HBL A;  2JA6 J;  1JJ8 C;  3S2H J;  4IWR A;  4B4C A;  1ZZ9 A;  2WUS R;  2ME6 A;  4J1W A;  1ZQ3 P;  4IHW A;  3BR6 A;  3I4M J;  2CRO A;  2DMQ A;  3QQA A;  1JUS A;  5M5W J;  1JKQ C;  1ETV A;  3OMT A;  1TWG J;  3OP9 A;  2R63 A;  1MBG A;  4J1X A;  1JFS A;  2DMT A;  3GN5 A;  3QPL A;  1OJL A;  3SCG A;  4M3G A;  5E3M A;  1RKT A;  5J1U A;  3RZD J;  2TCT A;  1X2M A;  2VKV A;  2R5Y B;  3KJX A;  4BY1 J;  5FLM J;  1B8I B;  2DA4 A;  4GQM A;  3JRG A;  1ZTR A;  2A6C A;  2DA2 A;  3A02 A;  5JLW A;  3JR9 A;  1P7J A;  1WCM J;  5EG0 B;  3PO3 J;  3ZHI A;  4Z59 A;  1AU7 A;  4DZP A;  1WIZ A;  3BR1 A;  4I8T A;  5EGO B;  1XC5 A;  1PUF A;  3ZQI A;  2X6O A;  3FIW A;  2DA6 A;  1ZUG A;  5C44 J;  4UUT A;  2B63 J;  2PIJ A;  4I6R A;  1HDD C;  4DZJ A;  1OFC X;  3IH3 A;  2FJR A;  1NTC A;  2GZU A;  1LQC A;  1ITY A;  1HDP A;  4FN3 A;  1ZAY A;  5C3E J;  3TW7 A;  1RZR D;  1IJW C;  2HYJ A;  2ECB A;  1MSE C;  1Y1V J;  1ZK8 A;  3JRF A;  5F0H A;  5M5Y J;  1UXC A;  3GBF A;  2NVX J;  1QP7 A;  1QQB A;  3HKZ N;  5K98 B;  3A03 A;  1IG7 A;  2KEK A;  3FIS A;  2JK3 A;  1MBE A;  3S1R J;  3I4N J;  3RZO J;  1F43 A;  5GP9 A;  1RKW A;  1JKP C;  3BD1 A;  2FD5 A;  3QWG A;  1Z77 A;  1B72 A;  4FE7 A;  1IDY A;  2LTP A;  1XWR A;  3B6A A;  1QQA A;  1Z0X A;  1APL C;  2ID3 A;  2BNM A;  3K7A J;  1SAN A;  1ETY A;  3MVP A;  4AYB N;  1JH9 A;  1PUF B;  3SCH A;  3WHC A;  2OR1 L;  1MSF C;  1EF4 A;  3TP3 A;  3CRO L;  4BKX A;  2DMU A;  2K9S A;  1NER A;  4Z58 A;  4IEJ A;  2LYR A;  3L1P A;  1WH7 A;  3LSR A;  3JRD A;  2XIU A;  2CQQ A;  4DYC A;  2KEJ A;  2PUE A;  3BQY A;  1VPW A;  3SJM A;  2XGC A;  2LYJ A;  2EWT A;  2EH3 A;  1GDT A;  4MLO A;  2BJC A;  2PUB A;  1TWH J;  1XG1 A;  2JVL A;  2MSY A;  2R0Q C;  3BR0 A;  4AUX A;  4A3J J;  4PU4 C;  2XB0 X;  1BW6 A;  1PER L;  3OSF A;  1QPZ A;  2NVT J;  2H8R A;  5F04 A;  1UTX A;  1X58 A;  5F27 A;  2H1K A;  1R63 A;  1ZS4 A;  2AXZ A;  5J3L A;  1ZVV A;  3JRE A;  3S1N J;  2BNN A;  2NVY J;  1NEQ A;  2LVS A;  2Y9Z A;  3NAR A;  2JA7 J; 
#chains in the Genus database with same CATH topology
 3H3V K;  5J1Y A;  1SMY F;  3GUU A;  3WG7 H;  4G6D A;  2PFB A;  3CQZ J;  2PLY A;  3V42 A;  3DM5 A;  1BN5 A;  2O38 A;  2DFI A;  3CF5 F;  1YJ9 I;  2HI3 A;  4D9J A;  2LYL A;  1QO0 D;  3CES A;  3GTK J;  4RLQ A;  2X85 A;  4GHJ A;  2CQX A;  3E5U A;  3S14 J;  3BC8 A;  4AC0 A;  1ORK A;  3LIS A;  4JP0 A;  1G6N A;  3H3Z A;  4Y4R A;  2L54 A;  1B9M A;  1T33 A;  3GME A;  4HQM A;  5D6F A;  5IT3 A;  3WTS C;  1DWK A;  4G7Z F;  3QAH A;  5HLI A;  3GWZ A;  4C3H J;  2R5Z B;  3BY6 A;  1IUY A;  3KYC B;  1EH8 A;  2O7O A;  4LG3 A;  3LWF A;  3G1M A;  3DWL E;  1I27 A;  2LYC A;  3BR3 A;  4PJ0 C;  2GIZ A;  4EGZ A;  1ZRF A;  4IZZ A;  4L0Y B;  2XAU A;  1SEU A;  2XGX A;  2G9W A;  2QEX I;  2QSH X;  3ZXS A;  3AL0 B;  3WGG A;  4UV8 A;  5LRR A;  2DAO A;  1SFX A;  3M07 A;  3PE5 A;  2Y30 A;  2CU7 A;  1Z05 A;  5HDG A;  3W3C A;  5FKN A;  1Y7Y A;  2W24 A;  4C3J J;  1K6Y A;  3K4J A;  2FMY A;  1V5G A;  5CVI A;  4MCT A;  3BG3 A;  4CGZ A;  4YEL A;  4FX0 A;  2B5A A;  2R92 J;  1XX5 A;  2EBI A;  4ZYE A;  4FT8 A;  1EKE A;  3C2B A;  3WTU C;  5JI6 A;  1WPK A;  1W36 C;  1MH3 A;  5HVQ C;  5GTH C;  1V5E A;  3CUQ A;  3SFZ A;  3F8C A;  1BI0 A;  3MZY A;  3HOX J;  4EJU A;  4QPO A;  3GLL A;  4BGD A;  3CCM I;  2JTV A;  2QZ8 A;  4UUS B;  1IXC A;  2XAJ A;  2TRT A;  3KEO A;  1FZP B;  1XN7 A;  2GM4 A;  4JCY A;  2MH9 A;  3DBL B;  1WI9 A;  2ADU A;  4UXN A;  3MD2 A;  1VQO I;  1S6L A;  4O5V A;  1K78 B;  3PFY A;  1QZX A;  3MAJ A;  4GO1 A;  2YUS A;  3O2P E;  5E20 A;  1FOK A;  2HOS A;  3OIO A;  4KJZ A;  3CZ6 A;  3HSE A;  2BY3 A;  4Q5S F;  3HUG B;  4Z5H A;  5F64 A;  2QQ8 A;  5FD6 A;  3GTQ J;  1XGO A;  2EIK H;  2L0K A;  1B9N A;  1CF7 B;  2DFH A;  2MFZ A;  1BDI A;  2I10 A;  1MBF A;  3W2W A;  3CC2 I;  3PSF A;  2KDO A;  3KP5 A;  1ZZ8 A;  3G1O A;  2K27 A;  4NQW B;  3OYM A;  1HSJ A;  2Z16 A;  3KX2 A;  4GGG A;  5KHD A;  3GN5 B;  3IKV A;  2MH2 A;  4PUS A;  1BDH A;  3H5A A;  2GQQ A;  1G3Y A;  4X4C A;  1W0U A;  3OL3 A;  4IHX A;  1WSU A;  3GTP J;  1ACI A;  1DGR M;  3SZG A;  4XKV A;  3FHZ A;  2M2E A;  3K1M A;  2A05 A;  5IP6 A;  4ER5 A;  1XTA A;  1Y0U A;  2OCC H;  3CCL I;  4A2U A;  2DFF A;  1Y6I A;  1ZEL A;  4NC7 A;  2A61 A;  2V7F A;  1ZZ6 A;  3ONQ A;  2PUC A;  1I3A A;  2DBB A;  4II2 A;  1Z1D A;  2XXA A;  1I6H J;  4GYI A;  3N97 A;  2DDA A;  2NVU B;  3KYD B;  3EYY A;  3BTJ A;  3M7G A;  2A5W A;  2HXI A;  3JXB C;  2A3S A;  2LLW A;  2LSO A;  3QP6 A;  1OCO H;  4OMY A;  1U8B A;  2KJC A;  2XAG A;  3OR1 C;  1I6X A;  1MJB A;  2WB1 A;  3TQN A;  5LGT A;  3BT9 A;  3DTI A;  4PK4 A;  1PYV A;  5D5W B;  1ZHF A;  4RLF A;  1POG A;  1S3J A;  3OYI A;  1K61 A;  4G7O F;  2WAF A;  3IV5 A;  4KFC A;  3FXR A;  2OQR A;  5DUI A;  2KRF A;  2IRF G;  4BQQ A;  3IRQ A;  2LNB A;  2KRC A;  1XCV A;  2M9H A;  3JRC A;  5F08 A;  3HRU A;  4ZTJ A;  3HJE A;  1HCR A;  2RAE A;  1D0Z A;  3OIQ A;  3BG9 A;  3K4L A;  3BR2 A;  3A01 B;  4E7H A;  2DOA A;  3TOA A;  4H4K C;  5IT9 Z;  2ICP A;  4RM3 A;  2ZXH A;  4BU2 A;  5LGN A;  2K3F A;  2QUF A;  1XGN A;  2L2O A;  1B59 A;  2CQN A;  2MA3 A;  2O61 A;  4XRS A;  5LEK A;  4I76 A;  4ENN A;  1ZZ7 A;  1LLI A;  1QVT A;  1BM9 A;  3HM5 A;  2BYV E;  1YHQ I;  3JRI A;  2MD5 A;  3QOW A;  3K4B A;  3P5J A;  3WTY C;  4HG2 A;  3LSK A;  5BQT A;  1LNW A;  3RPU D;  5LD2 C;  4Z5D A;  4XKB A;  1A6Q A;  5DTQ A;  2XJ3 A;  3HGG A;  1T0F A;  3OS1 A;  1B8I A;  2P6S A;  5DTM A;  1XMA A;  1I39 A;  2EFO A;  2R7W A;  4O6J A;  1MZB A;  2CYY A;  3RI4 A;  4JCX A;  2E2H J;  1W5T A;  3CP2 A;  4XRS G;  1IN5 A;  3OWT A;  2Z2S B;  3P9C A;  2KZ8 A;  2Y48 A;  4RB1 A;  3B73 A;  4RS8 A;  5JLX A;  5JR3 A;  5EJC A;  4IOC F;  3LA2 A;  2QWW A;  2ESN A;  2OZ6 A;  5EZH A;  2HZD A;  5L3B A;  1FOY A;  1IUF A;  2EA2 A;  5HS9 A;  2FX0 A;  1XPX A;  2VQL A;  2F4M B;  5DTD A;  3TED A;  3J80 Z;  2QM3 A;  5EGO A;  5DS9 A;  5LLQ A;  3DPL C;  3DEW A;  3T8T A;  2KZV A;  3ZN1 A;  2K7L A;  3ZGK A;  3AG3 H;  1AKH B;  5HLG A;  4JQD A;  3Q0U A;  4ZZL A;  4XBF A;  4YRV A;  2PX9 A;  3L00 A;  3KCC A;  4U87 A;  1RUO A;  2PN6 A;  2XPV A;  5DCM B;  2HQR A;  3F9K A;  2A07 F;  1QZE A;  2LY1 A;  4OBM A;  1G8X A;  1XSD A;  2FXA A;  2HQN A;  2HOA A;  1VFC A;  5D4R A;  2VJ4 A;  3V8L A;  2W4S A;  3OIP A;  5EDN A;  5DEQ A;  3BR5 A;  2HKX A;  3QOD A;  4BEH B;  1ODD A;  3K70 C;  5IT9 K;  2R93 J;  2DXI A;  1SQ8 A;  3CC4 I;  4IQJ A;  1XDU A;  1J9I A;  4U7D A;  2NRA C;  1R6R A;  4OIR F;  5J6X A;  3U3W A;  1J0R A;  5B3S H;  1SC7 A;  2KZG A;  4A3F J;  2K40 A;  2ZXW H;  4I6T A;  1LFB A;  1F4K A;  2BY0 A;  4RAF A;  5IOY A;  5EF6 A;  1UHW A;  3TOB A;  3S3M A;  1EH6 A;  5D5U B;  3HSF A;  2YU3 A;  1NW3 A;  2K02 A;  1BR4 A;  2VQG A;  3JRH A;  1IZ1 A;  3CCV I;  3QQ6 A;  2DA5 A;  2DU9 A;  1LFU P;  2GRL A;  3ZQQ A;  4LD5 A;  2HVQ A;  5HOD A;  2BEO A;  2R7Z J;  1T6S A;  3WTZ A;  5HLH A;  2JA5 J;  1S7E A;  3HSR A;  1WH5 A;  2KJB A;  3GW2 A;  2XB5 A;  2XXQ A;  3KZY A;  1J5Y A;  5FJ8 J;  1EFA A;  2OF7 A;  5ILS A;  2M45 A;  4EMS A;  1D3Y A;  1YG2 A;  2NNY A;  4HF0 A;  2Y69 H;  2ZJR F;  2M4G A;  1U78 A;  4LK0 F;  2DA1 A;  4A69 C;  1REP C;  4AM3 A;  2FBI A;  5HS8 A;  4AYB A;  4XQF A;  1Y1W J;  3UFD A;  1KA8 A;  2DCE A;  3O9X A;  2JMW A;  1VQ4 I;  2KMU A;  4ER3 A;  3GZD C;  2FQ4 A;  4MQ9 F;  3ABT A;  1TP4 A;  2HOT A;  1F36 A;  4HRA A;  5H6R A;  4CYC B;  2F5C A;  1R36 A;  4HNU A;  5LRS A;  4X4H A;  2JPC A;  2BXY A;  2OUM A;  2CUF A;  2Z33 A;  5ICC A;  2M1B A;  1YTY A;  1DW9 A;  1FMW A;  1W7P D;  5K7F A;  3F22 A;  2NS7 A;  5E17 F;  4F3Q A;  2MAB A;  4NBQ A;  2LOO A;  4V2G A;  3RKY A;  4BDZ A;  3OQM A;  1UHS A;  2R5Z A;  4OB4 A;  3ISP A;  2R5Y A;  3L7W A;  1L1M A;  4F52 A;  3BTL A;  2PMZ A;  1XMK A;  4GRI A;  1LEA A;  1TQI A;  1HXD A;  3IH4 A;  1XS9 A;  3ZCO A;  4IVN A;  1RR7 A;  3TW6 A;  2KIQ A;  3HB9 A;  1HBX G;  3J7A Y;  2LKS A;  1D0Y A;  1GVD A;  2OAZ A;  1SD6 A;  1SD5 A;  1VQ6 I;  5FKK A;  1JKR C;  1PRU A;  2E1M B;  1AOY A;  4BL0 B;  4M9S A;  4BXF A;  4ENK A;  2H6C A;  2JZY A;  4IWR A;  4KIT B;  2GIV A;  2ME6 A;  2VT2 A;  3I4M J;  2CRO A;  3CTA A;  1BR1 A;  3TO9 A;  3OYA A;  5M5W J;  3CJN A;  4YG2 F;  4WCG A;  1TWG J;  1LVA A;  5DM7 F;  4AVP A;  5JHU A;  1X1A A;  2DMT A;  4BQO A;  3QPL A;  1OJL A;  3HRT A;  2HDW A;  5E3M A;  4CO8 A;  5J1U A;  1T8I A;  1J59 A;  5GAD J;  2TCT A;  3G6E I;  1T0F C;  5JHF A;  2R5Y B;  2E36 A;  3LSH A;  1NG7 A;  2K4B A;  3FXQ A;  4BY1 J;  1B8I B;  4GQM A;  3ERM A;  2K86 A;  5JLW A;  3JR9 A;  4BAY A;  3H5R A;  4WK8 F;  2RRE A;  5D8L B;  4EQQ A;  1BJA A;  2LNM A;  4BXU A;  4L0Z B;  3IAS 2;  4I8T A;  2X6O A;  1I1S A;  4XSX F;  5DT2 A;  2DA6 A;  1PVE A;  5CPR B;  1LDD A;  4X0G A;  4DZJ A;  5KAI C;  4CCJ A;  1I5Z A;  2VC1 A;  1ZAY A;  3HXL A;  4F91 B;  4LIV A;  2HYF A;  2HYJ A;  4D1Q A;  2DK5 A;  5M5Y J;  1UXC A;  2QQA A;  3NWT A;  3HKZ N;  2KEK A;  4E7K A;  3BPV A;  2PBI A;  4XON A;  3OY9 A;  1YLF A;  5FRN A;  2MYS A;  1X1C A;  2OU2 A;  2DOD A;  1JKP C;  2XF5 A;  1R7J A;  2ZC2 A;  5TJJ A;  3BD1 A;  3RTR A;  3QWG A;  2PXF A;  4FE7 A;  1VTN C;  1XWR A;  1S29 A;  4HX8 A;  1APL C;  3JAM K;  2VJJ A;  5LFA A;  2WWY A;  1ZRC A;  1F9N A;  2QSF X;  1SAN A;  2IGN A;  2M87 A;  3QU6 A;  3I3L A;  1YW7 A;  4Q4Z F;  3SCH A;  2FRH A;  2UUZ A;  3OL4 A;  3I64 A;  2IVM A;  3CME I;  3WTT C;  1DPR A;  1R5H A;  4M6Y A;  1EF4 A;  3CRO L;  1BI2 A;  1X3W B;  4BJ5 C;  4BEH A;  2XIU A;  1VPW A;  2CFX A;  2EWT A;  2EH3 A;  1GDT A;  2IT0 A;  2PUB A;  1H0M A;  1TWH J;  2ZJ2 A;  1XG1 A;  1EH7 A;  2MSY A;  1R49 A;  1LQ1 A;  2CQ7 A;  3U2R A;  2VC0 A;  4PU4 C;  2X1D A;  2F2E A;  3VOE A;  4B09 A;  1QPZ A;  1VQ5 I;  3G3Z A;  2LBF B;  5F27 A;  2ISY A;  2AXZ A;  4AD9 A;  1FBU A;  2UXN A;  3RKX A;  3S1N J;  1R23 A;  3PNV A;  2PXD A;  2IS1 A;  3H3U A;  1ZGJ A;  1E0E A;  3ECO A;  4PJL A;  2P5L C;  4FQG A;  3V8K A;  1PRA A;  2HVS A;  1HW2 A;  2LYS A;  2MD0 A;  1G3S A;  5CJ9 A;  5FFX A;  4BJT A;  4Y15 A;  2ZNY A;  2ELK A;  2P8T A;  3L09 A;  2DMN A;  3ZQH A;  4A12 A;  4D5F A;  3RCO A;  2LR8 A;  2W00 A;  3Q3S A;  1IRF A;  2GOX B;  2C6Y A;  2WAE A;  5FD5 A;  2K9N A;  3KZI C;  1GV2 A;  4PDK A;  1YJN I;  4X4F A;  1U3E M;  3KP7 A;  2XCJ A;  1ZYR F;  2WB1 N;  3I4P A;  2DOE A;  5FFZ A;  3RKQ A;  3T8R A;  4LJZ F;  3OKZ A;  1OCZ H;  2DDB A;  4AWX B;  5M3M J;  1JHH A;  3BCB A;  3LMM A;  1QB2 A;  3SFI A;  4JBA A;  3A1Y A;  4RGU A;  3HGY A;  4PGG A;  4G6T B;  5M5X J;  5BPD A;  2VE8 A;  3CF2 A;  4MGR A;  3GCM A;  3WE3 A;  1K4S A;  2A68 F;  3VOD A;  3G71 I;  2COM A;  2FOK A;  2JUC A;  3D0S A;  5IP9 J;  3ABK H;  3HKZ A;  2IA0 A;  2LYP A;  4IPA A;  4RB3 C;  2QBY B;  2PUD A;  5DTR A;  1ZAR A;  3ZQF A;  3WE2 A;  3WHB A;  1R69 A;  4N9H A;  5EEA A;  4WF2 A;  2OCE A;  3RZZ A;  4HDV A;  3SCF A;  3O8G A;  4PJJ A;  3CCJ I;  3RPQ A;  1X19 A;  2BZT A;  3ZMT A;  3F8M A;  2PXV A;  4XLP F;  2E7W A;  4CXF A;  1G4D A;  3GFJ A;  1WVR A;  2XIG A;  5TRD A;  3SX0 A;  2VBY A;  1HW5 A;  1DGW Y;  3M9A A;  1IN6 A;  2G7U A;  3DPU A;  2EBY A;  2K9L A;  4E6K G;  2W85 A;  4YAR A;  4NB5 A;  2CSF A;  1P4W A;  2HPM A;  5LEJ A;  4EJO A;  2BNO A;  1ZRE A;  4G12 A;  4DW6 A;  1R71 A;  3BTI A;  2MW8 A;  4Z5C A;  2DOF A;  1FP2 A;  5JVT A;  1RZS A;  4PCQ A;  5FO5 A;  5EZG A;  2ME0 A;  5K7Z A;  3GTL J;  3TRB A;  5AIP A;  3BZC A;  4AIH A;  2OZU A;  1RZ4 A;  2L4A A;  3CJQ B;  4UVA A;  2CMP A;  3S93 A;  1PP7 U;  2VON A;  4Z6Y A;  4F7Z A;  3H9J A;  3HHH A;  2OPT A;  4ZYH A;  3KZ3 A;  2BV6 A;  2A6H F;  2L9N A;  5E1X A;  5FKO A;  4KNY A;  2XAF A;  5B5E C;  2EZK A;  3L2W A;  4RDU A;  3LQQ A;  2LMD A;  4L9J A;  4CCM A;  4PGH A;  4W97 A;  4B8X A;  1R4N B;  4KIF A;  4CUG A;  2DW4 A;  1J7K A;  3DCF A;  2RNJ A;  2M34 A;  4ESB A;  1ZGA A;  4XLC A;  2EA4 A;  3VB2 A;  1R22 A;  3RQI A;  4KMU X;  2J7U A;  3CDI A;  4A3K J;  4C2U A;  2QGU A;  4XKC A;  2VAS A;  3IUO A;  4QSH A;  2K9Q A;  3UWP A;  3SR4 A;  4IL6 C;  3GZ5 A;  4HSR A;  2LK2 A;  4R1H A;  5IPA A;  1WI3 A;  2F6C A;  3KET A;  2LP0 A;  3VYS B;  3ERE D;  3IWZ A;  3MCZ A;  3SZT A;  3OR2 C;  4OAY A;  1HQ1 A;  4CH7 A;  4Y42 A;  4IRH A;  3ZQG A;  2BE5 F;  2E71 A;  2M30 A;  2E35 A;  2O03 A;  3J81 K;  3JRA A;  2BVL A;  3OYK A;  3HOY J;  5M3F J;  4B1R A;  4MTE A;  4MEY F;  4RMN A;  1ZPQ A;  4KN4 X;  3HOU J;  4XK4 A;  2LD5 A;  4P1W A;  4Y3O A;  2PG4 A;  2WC2 A;  3HUG A;  2NOJ B;  4LIU A;  1DQU A;  1KYW A;  4P55 A;  4RAZ A;  1MD0 A;  2QVO A;  2GBY A;  3CJT B;  4IKF A;  1FNN A;  1ETX A;  1QRY A;  5FLV A;  3OWQ A;  4HEA 2;  3FKJ A;  5LBQ A;  2BHY A;  2HXO A;  1SFU A;  3LST A;  4RAY A;  1U9O A;  1ZZC A;  3B7H A;  3S16 J;  2MQK A;  3QFI A;  2XHK A;  5LHG A;  5BPI A;  1YI2 I;  2DMP A;  4OOI A;  5GAH J;  1TC3 C;  2KIM A;  3FXK A;  1FTZ A;  5K5Q A;  3OQN A;  1RC9 A;  1JE8 A;  2AXT C;  1PJR A;  4IJA A;  2BOL A;  4BHC A;  2EF8 A;  2VKD A;  4O3M A;  3CMM A;  1GLN A;  2Y75 A;  3PNT A;  4EKG A;  3BLY A;  4ER0 A;  2XSD C;  2F5F A;  3J7Z I;  2HCN A;  3BS3 A;  2V3C C;  4XLN F;  2O4A A;  1VQ7 I;  3D5R C;  2HDC A;  1SFK A;  2EZH A;  2FJ1 A;  2MEZ A;  2XV4 S;  2XPW A;  2STW A;  4KMF A;  9ANT A;  3F6W A;  3BRO A;  2PXT A;  3R61 A;  2V6C A;  3ZKC A;  2RNG A;  1VQL I;  4LIT A;  3MKZ A;  2VOO A;  3QF3 A;  3M8E A;  4ZDL A;  3O3K A;  1I50 J;  2RDP A;  1ZG1 A;  2LYK A;  2X9D A;  4YII A;  5E3L A;  4E7J A;  4XN3 A;  4HOB A;  1P4X A;  3HRS A;  3G2B A;  1JT0 A;  5GPA A;  3DV8 A;  2R7R A;  1HST A;  3IH2 A;  3D5S C;  3QP5 A;  4RGX A;  4LG0 B;  2X4H A;  3ABM H;  2M8E A;  2DLL A;  4A3C J;  1Z7U A;  1JGS A;  2BGC A;  1WET A;  2QKM B;  4G6Q A;  3SQN A;  1IRG A;  3SEQ A;  3I58 A;  2ZJQ F;  2L49 A;  2MG4 A;  3HDD A;  5K5O A;  1RIO A;  1RUN A;  2GZW A;  1BL0 A;  2KIF A;  3TGN A;  3OYB A;  2DPD A;  2GLO A;  3PO2 J;  2R1J L;  1O3S A;  3KP2 A;  3Q0V A;  3RPU A;  3SHF A;  1K78 A;  1LEB A;  2PXB A;  3E5X A;  2F4I A;  3I5U A;  1LMB 3;  4QPQ A;  1ZN2 A;  4EK9 A;  1FY7 A;  4X6A J;  2MXD A;  3OQO A;  2E1M C;  3IP4 B;  2JWT A;  3KPH A;  1W1W E;  3P7N A;  4E7I A;  5L3E A;  1MJ9 A;  5E3N A;  1SD7 A;  2STT A;  4OIO F;  3CUQ B;  4Y13 A;  4I99 C;  2N8G A;  4Q2J A;  3UNG C;  3G0T A;  3J7A O;  2E5N A;  3BG6 A;  3FM3 A;  4NQW A;  3Q0W A;  3K4K A;  1E3P A;  1K79 A;  2JA8 J;  5KNL A;  1KQ9 A;  2RGV A;  2V9P A;  5EYR A;  1ZZB A;  2QKL B;  4I01 A;  4RA2 A;  4S05 A;  1SVM A;  5GAE J;  2R3S A;  3CLQ A;  1BOA A;  3CCY A;  3VEP A;  4L5J A;  1S7A A;  1TWC J;  2R7F A;  4NC8 A;  3MKY B;  1MBJ A;  2WY8 Q;  3KP3 A;  5L3G A;  2I5U A;  2Y31 A;  3HOT A;  3HOW J;  2ZJP F;  2KIU A;  4M3B A;  3V7S A;  5J8F A;  3P9K A;  2HIN A;  2L9V A;  3IWF A;  3AG1 H;  2HWV A;  5L3C A;  3HIF A;  4RBO A;  3CCQ I;  3ZQ7 A;  2F48 A;  2V6E A;  2NAZ A;  2ID6 A;  3JCU C;  2O8K A;  2QA4 I;  5K5R A;  3DF8 A;  1KU2 A;  3IKT A;  4HX7 A;  5KCM A;  4Y33 A;  1OSL A;  4QWQ A;  1UST A;  1Y39 A;  1GXQ A;  4MFE A;  3W6K B;  4ZYG A;  1JWL A;  2MBF A;  5IYD J;  1WJ5 A;  4HZF A;  2E19 A;  4M9Z A;  3H35 A;  3R4K A;  4HLX A;  3N4M A;  4RGR A;  1X1P A;  1P4A A;  2V1D A;  1XD7 A;  2WV0 A;  2V9K A;  1HLV A;  3GTO J;  1HKT A;  2V26 A;  3U1D A;  3K4C A;  2RQQ A;  3ZP5 A;  3SDG A;  2V1U A;  2DTR A;  3OSG A;  2CWE A;  1FYL A;  3HYI A;  1GXP A;  2CG4 A;  2FNA A;  4A3L J;  3EUH A;  4S04 A;  1K6O A;  3M4O J;  2EQR A;  1G3W A;  2R7Q A;  5CQG A;  5AIQ A;  3Q9V A;  5E79 C;  5FKM A;  4ZDP A;  3CC7 I;  2PI0 A;  2P5K A;  4HBL A;  1VQK I;  4YEJ A;  1HF0 A;  4A3B J;  3KEY A;  2Z5U A;  3HTU A;  2LLK A;  3QOP A;  3PQJ A;  1MKM A;  4JYK A;  2ZKZ A;  4I6U A;  4XOT A;  1RZR A;  4C9Y A;  4ZJZ A;  3WU2 C;  2VPR A;  3CP8 A;  3ZMS A;  3E6C C;  1JGG A;  1NK2 P;  4ER7 A;  4OIP F;  1ENH A;  1EV7 A;  3EUH C;  3HG9 A;  3OYE A;  4F8D A;  3DLL F;  1U0J A;  1FJL A;  3H36 A;  4XKW A;  3GFL A;  1B6A A;  1JJ8 C;  3S2H J;  1FT9 A;  4P9F A;  4HF1 A;  3R6S A;  4J1W A;  1FWZ A;  4J00 A;  3QQA A;  3TL4 X;  1JKQ C;  3M1C A;  4F92 B;  1X1D A;  4IOA F;  3JW4 A;  4IRG A;  1MBG A;  2V1X A;  4Q48 A;  4J1X A;  3DKY A;  2Q0O A;  3PIO F;  5GAG i;  5BMZ A;  3E1S A;  5E1Z B;  1RKT A;  3RKW A;  3LAP A;  1MDM B;  3RZD J;  2R7U A;  2DI3 A;  3QWL A;  5FLM J;  3D5L A;  5D6E A;  3JRG A;  1PP8 F;  2E1C A;  1ZTR A;  5IY5 H;  2A6C A;  2XXP A;  1P7J A;  1WCM J;  4ENM A;  5DSX A;  1AU7 A;  3OYL A;  1MJA A;  4GCV A;  4XNF A;  3BR1 A;  4II3 A;  3HOS A;  5EGO B;  3ZQI A;  3VDX A;  2EV0 A;  4YFN F;  1ZUG A;  3C2G A;  3BG7 A;  2GOM A;  1VZ0 A;  3FZV A;  2JRT A;  2XUB A;  2B63 J;  2PIJ A;  3H9G A;  3ECH A;  4EM0 B;  4HV6 A;  1OFC X;  2FJR A;  1NTC A;  2UXX A;  3Q9S A;  1ITY A;  3P9I A;  1HDP A;  3U9G A;  1FYK A;  4FN3 A;  3TW7 A;  5DD4 A;  3DU5 A;  1SD4 A;  2ECB A;  1OPC A;  1ZK8 A;  1NHA A;  2R4G A;  3F8N A;  5ICF A;  4BJ6 C;  3GBF A;  1KU9 A;  1JXS A;  1IG7 A;  2RV8 A;  3I59 B;  2JK3 A;  1V5F A;  3I4N J;  4PSW A;  3OV8 A;  5GP9 A;  1RKW A;  3OOP A;  4PJN A;  5TGT A;  1QHH D;  1Z77 A;  1B72 A;  3K6G A;  2L01 A;  3LFU A;  4YFX F;  1N75 A;  4P9U A;  2VXD A;  2BNM A;  3K7A J;  4HW0 A;  1TLH B;  1EA3 A;  2KIS A;  2CGP A;  4AYB N;  4UVB A;  1Y8R B;  5HDK A;  1K4T A;  1NER A;  1LKX A;  4IEJ A;  3L1P A;  1Z6T A;  4ZZD A;  2CQQ A;  2KEJ A;  3BQY A;  2IGO A;  3SJM A;  2LYJ A;  3ZPL A;  2WTE A;  3GO5 A;  4MLO A;  3JTG A;  1YYV A;  4BAC A;  4A3J J;  4AUX A;  1BIA A;  1FMV A;  1PER L;  1O3Q A;  3U21 A;  1KU3 A;  3I59 A;  4CCK A;  4KA4 A;  2F5V A;  2KKO A;  3AG4 H;  3AKZ A;  1QHG A;  3LA3 A;  5E8G A;  2HVR A;  4CCN A;  2LG4 A;  3E6B A;  5D5V B;  1SMT A;  1QBJ A;  3JRE A;  2F5D A;  1STZ A;  3LA7 A;  5J8C A;  3T5X A;  4CA0 A;  5F1R A;  3SEZ A;  1GHC A;  4FET A;  1WZ2 A;  2NVY J;  2W57 A;  3LL7 A;  4HF2 A;  3HC7 A;  4GYG A;  4M74 A;  3JTH A;  2HFZ A;  2Y9Z A;  3LFK A;  2M4H A;  3SYT A;  3TMO A;  3V7C A;  1A31 A;  2KPM A;  4B44 A;  1E3O C;  5ICE A;  2A6T A;  1JTX A;  1JJ6 C;  4KYW A;  4LB6 B;  2VB6 A;  3H5T A;  3B02 A;  4YG1 A;  4HDU A;  2PMH A;  2FE3 A;  3HOZ J;  2YBD A;  2E34 A;  1HW1 A;  4BYY A;  1MND A;  2D2W A;  3H1C A;  5LHI A;  2QSG X;  4M3F A;  5K1Y A;  2O9L A;  1BR2 A;  2V1N A;  3CCS I;  4XRM A;  2KLO A;  1LVK A;  2ZME A;  4XLE A;  4Y7N J;  3AG2 H;  2CW7 A;  3KZZ A;  2AS5 F;  4WVL A;  2VQC A;  2GXA A;  1R1T A;  3DTK A;  1Z9C A;  3PJR A;  3FKI J;  4IXA A;  2L7F P;  2A69 F;  4M6V A;  5F1J A;  2PJR A;  2OBP A;  4KIS A;  5F0C A;  2AUW A;  1M1E B;  3GFI A;  3DKW A;  3KL4 A;  2DYS H;  2CW8 A;  2FBK A;  2VT3 A;  1GVJ A;  1D5Y A;  3VSL A;  1S72 I;  4JX5 A;  3H9Q A;  3LFP A;  3GUD A;  2M5W A;  2BBY A;  3TDZ C;  3QRF F;  4HQE A;  2Z99 A;  3A9Y A;  2HPI A;  4EEF G;  1ADR A;  1YX5 A;  2GWR A;  3K1N A;  1O3R A;  3FXU A;  3I56 I;  3GZD A;  2OTJ I;  2HQA A;  2DN0 A;  3CDL A;  3GX4 X;  2ICW G;  4KIB A;  1UZC A;  1TQP A;  1FIP A;  2LBF A;  3EUS A;  3MQ0 A;  4B3A A;  4NHJ A;  2Y2Z A;  4X4E A;  3K70 D;  1FYM A;  4A3I J;  2E60 A;  1LJ9 A;  4I02 A;  2R7O A;  2X48 A;  2EFP A;  1RPE L;  3M3Y J;  3CD6 I;  1YOV B;  1V3F A;  5A7L A;  1RPW A;  2IUO A;  3CCR I;  2L7Z A;  2JN6 A;  2PUG A;  1OR7 C;  4LG0 A;  5HS7 A;  1K83 J;  2CUE A;  2YSR A;  1R9T J;  2HDD A;  1N25 A;  1IAW A;  3CUO A;  2YU9 J;  3GTG J;  3PNY A;  2ZB9 A;  4ZYA A;  3DPT A;  1ZH5 A;  3C3W A;  2VBW A;  3FMQ A;  5FGM A;  1AWC A;  4GFB A;  2FOW A;  1X57 A;  2H8W A;  2E2I J;  4IHT A;  4RAG A;  1LE8 B;  3WTW C;  2B7E A;  2IVB A;  1U2W A;  5CLS A;  2PE5 A;  3L9F A;  3MKW B;  3A9Z A;  1H9G A;  3CLC A;  4U0W A;  4LB5 A;  1FIA A;  3ZMU A;  1MMD A;  2AHQ A;  3LOC A;  3ZQC A;  2JT1 A;  1J75 A;  1MDM A;  2PXK A;  2IGM A;  3DTE A;  3LSJ A;  4MTD A;  1P7I A;  3O8H A;  4ZH4 F;  2UWM A;  4A93 J;  1LB2 A;  1L0O C;  2G0E A;  2BY1 A;  4I0A A;  2P81 A;  3FMY A;  2KEI A;  1VI0 A;  1OCR H;  1A36 A;  1LCD A;  1VQ8 I;  4CIC A;  1D8J A;  4UUV A;  2MC4 A;  2AXL A;  1UXD A;  4LFU A;  3FXM A;  1MBK A;  5CVU A;  3E7L A;  4HNT A;  5J4Y A;  1KGS A;  1YRN A;  1ZKG A;  3A01 A;  1LFP A;  2E7X A;  4ENJ A;  3S1M J;  1Z3X A;  2TDX A;  2IVG A;  3R0A A;  1B0N A;  3F51 A;  1P9Q C;  1FPQ A;  2D45 A;  4CZC A;  4FE4 A;  1U5T A;  1X3Z B;  2DA3 A;  2HR3 A;  1D8K A;  1N78 A;  4PU3 C;  1QP0 A;  1WH8 A;  2BW3 B;  3K1P A;  4FIS A;  3HEF A;  4AIK A;  2IS2 A;  4R8H A;  4NC6 A;  5DRY A;  2M8G X;  1FOW A;  2VQH A;  3KP6 A;  4L9T A;  1U8R A;  1OMI A;  4ESJ A;  4HRI A;  2EV6 A;  2X1C A;  2HSG A;  3PUF A;  3S15 J;  1D1C A;  2YX4 A;  2L4M A;  2OQG A;  3HHG A;  3VYU B;  3BQZ A;  1T39 A;  3F8B A;  3V4G A;  2O6G E;  1F1Z A;  3OYJ A;  2DT5 A;  4EV0 A;  2CRG A;  3OMY A;  1YQA A;  2B0L A;  4XLA A;  3CCU I;  4BY7 J;  1MH4 A;  2JA2 A;  5DV5 A;  1FSE A;  1A5J A;  2A6E F;  2NOG A;  2DT7 B;  3I54 A;  2KP6 A;  1MGT A;  2EIJ H;  3TDU C;  1HKS A;  2CUZ A;  1KU7 A;  1G2H A;  1J2X A;  5CVR A;  4G7H F;  2H1L A;  4YG7 B;  1A6I A;  1I3Q J;  2JJ7 A;  4X1E A;  2NVQ J;  2W25 A;  1P2F A;  3FXL A;  1RR8 C;  2PMZ N;  1VQ9 I;  1IXR C;  4MNU A;  3W6V A;  1HC8 A;  3GZ6 A;  1IF1 A;  1PRV A;  5ICG A;  1Q1V A;  3X2Q H;  5IOZ A;  1MMS A;  3ULQ B;  2ZFU A;  3MKL A;  1FEX A;  5DD8 A;  4D0P A;  4PSX A;  1UG2 A;  4FX4 A;  1YSE A;  4KIC A;  4DBQ A;  1SAX A;  5DCM A;  2OD5 A;  2WV1 A;  2H27 A;  2PUA A;  1IV8 A;  2R7S A;  3FK7 A;  2W84 A;  3BJA A;  2LY2 A;  4A6E A;  2IPQ X;  1IO2 A;  1RET A;  2W48 A;  3L2U A;  3RJP A;  1YFH A;  1ZR2 A;  2DYR H;  3I71 A;  4I98 B;  4X4G A;  5CVV A;  5JFR A;  2FML A;  3J80 K;  4XMY A;  2DT6 A;  2G7H A;  1NG6 A;  2MLK A;  4P96 A;  4BS9 A;  4EVI A;  2X6W A;  2FQ3 A;  2M3A A;  3A0H C;  4KUM A;  4F55 A;  1FLI A;  2K4J A;  3W6J B;  2DQL A;  5ED4 A;  4A3M J;  1BC7 C;  2QCO A;  1ZLK A;  4QIW N;  3RIR A;  5EG0 A;  3LNQ A;  3VYT B;  1TW3 A;  3BTC A;  3PXP A;  2XKP A;  3FK6 A;  4U0V A;  1KZH A;  1JUM A;  3BZK A;  1D0X A;  1YIJ I;  2LF8 A;  1E3H A;  3TKY A;  1UMQ A;  2VKE A;  3MMY B;  2IGK A;  3DBH B;  5GAG J;  1TNT A;  5TIS C;  5GAH i;  2M7A A;  1USS A;  1UCR A;  2D5V A;  4ITV A;  4I09 A;  2BVM A;  2Q2E B;  3KP4 A;  3IRR A;  4YBA A;  1X3U A;  1H9T A;  2F4O B;  2L3D A;  2J7W A;  3GF2 A;  5HNH A;  2KPJ A;  1UG0 A;  4LMY A;  5CKT A;  3JRB A;  2VL8 A;  4IHY A;  3KXA A;  3QPS A;  2AW6 A;  4UV9 A;  4G8X A;  3MN2 A;  3EET A;  3G4S I;  3GEZ A;  4KT6 A;  1X2N A;  1XCB A;  3ESW B;  3KE2 A;  4HNV A;  4C30 A;  5HLT A;  1V55 H;  2OTL I;  2FFH A;  5FKL A;  3DXJ F;  3E6M A;  1IC8 A;  1SVO A;  3DEE A;  2EFN A;  4EM1 A;  1R4M B;  1YX3 A;  4ZYD A;  5C4J J;  1T38 A;  2BXZ A;  2L1P A;  3MFK A;  2VJI A;  1X2L A;  4LLL A;  3R0J A;  4FBI A;  3IHU A;  2PUF A;  4BHP A;  2NXN B;  3CO7 C;  3I9V 2;  3QYX A;  4LLG F;  1SFE A;  3J7Y J;  2UV1 A;  1BC8 C;  4A0Z A;  2CV1 A;  3S8Q A;  1DUX C;  2FU4 A;  2NNN A;  3LQX A;  3C7J A;  2CJJ A;  2KL4 A;  3S3O A;  4MHG A;  3R09 A;  3PM1 A;  4DYQ A;  1QNT A;  3KLO A;  4A3D J;  2XF7 A;  3NEU A;  4G9Y A;  4EAT A;  1IGN A;  4YG4 A;  3RQ4 A;  3ZMZ A;  2VI6 A;  2I8D A;  1MMA A;  2KDZ A;  2PMU A;  5DM6 F;  4KT5 C;  1WJB A;  1U6G A;  1O3T A;  1ETO A;  4XM3 A;  1S9H A;  1A35 A;  2VUM J;  2ELJ A;  4IRI A;  4OWR B;  2ZCW A;  4WXH A;  2DA7 A;  3N05 A;  1ZAO A;  2MLG A;  2XVC A;  3GZC A;  2VIX A;  4E4H A;  3PFI A;  2W7N A;  2FF4 A;  5DYM A;  4YFK F;  1AHD P;  4RB2 C;  3CO6 C;  1TT5 B;  1QVU A;  1WH6 A;  1IXS B;  2WA0 A;  3WGI A;  2L8N A;  3NAU A;  1U2Z A;  2DJI A;  1SAU A;  2ESH A;  1IDZ A;  1QP4 A;  1RI7 A;  3FHN A;  1XDS A;  1CGP A;  5BNG A;  3KFW X;  4XN0 A;  3W2A A;  2CQK A;  4OAZ A;  5KVR A;  4DQ2 A;  6PAX A;  1BI3 A;  5CQE A;  3T0Y A;  4LK1 F;  2VBX A;  3Q5F A;  2VOP A;  1IW7 F;  1R5G A;  2IP2 A;  1D1B A;  5ERI A;  4IHV A;  4CDG A;  1T2K A;  2WY7 Q;  1O57 A;  2PXU A;  4A6D A;  2XPU A;  3HRM A;  1UEL B;  4BBS J;  3D1N I;  1XSV A;  1VQP I;  2D1H A;  1BW5 A;  1DU6 A;  1MNM C;  2LY9 A;  5FRO A;  3GTJ J;  5JUW A;  1R1V A;  2IA1 A;  1TNS A;  2ZSI B;  3CLO A;  3H92 A;  4BE1 A;  1MNE A;  1YE9 A;  4B3X A;  2JA6 J;  2DO7 A;  2QYO A;  4XSZ F;  2IS6 A;  4A0X A;  1ZG3 A;  1ZQ3 P;  3BR6 A;  4DIQ A;  4YIF A;  1OLT A;  3RSN A;  1XGS A;  3F8F A;  1CF7 A;  1ETV A;  3OP9 A;  2ELH A;  3RYP A;  1JFS A;  1A04 A;  1F5T A;  1QZY A;  4BUP A;  3GN5 A;  3GFM A;  1X2M A;  2VBZ A;  2IA2 A;  2DA4 A;  3HZJ A;  2W82 A;  3SDB A;  2DA2 A;  3A02 A;  3ZHI A;  4Z59 A;  1KYZ A;  1QU3 A;  3HTS B;  4Z2Y A;  4DZP A;  4CYD A;  2HTS A;  1FOX A;  1XSX A;  2O5R A;  1OYW A;  1XC5 A;  1PUF A;  1SVL A;  3FIW A;  2EIL H;  3MZH A;  5A2Q Z;  5C44 J;  3FWE A;  2RC4 A;  2EIM H;  1T08 B;  3V7R A;  1HDD C;  1XGM A;  3IH3 A;  3QPT A;  1ONV A;  2LKP A;  5C3E J;  3AL0 C;  1RZR D;  2HYG D;  3BCA A;  1MSE C;  1WKM A;  4UHT A;  1WWX A;  2NVX J;  2HFH A;  1QP7 A;  5HNF A;  5K98 B;  3A03 A;  1QQB A;  5FLX Z;  3FF5 A;  4WWC A;  3FIS A;  5D8K B;  3BWG A;  1Z7L A;  1MBE A;  3GZN B;  1BOB A;  4MEX F;  3KYL A;  3E3V A;  1F43 A;  3S8P A;  2FD5 A;  3ROU A;  1TTY A;  1R1U A;  3COA C;  1IDY A;  2L5Q A;  3B6A A;  3FM5 A;  1TZL A;  3R60 A;  5L3F A;  2XC7 A;  2A5Y B;  3CMA I;  3MZ8 A;  1ULY A;  2XSJ C;  2OC6 A;  3FBI B;  1JH9 A;  1PUF B;  3WHC A;  2OR1 L;  2VN2 A;  4E7L A;  3M9L A;  3LSR A;  3CJR B;  4ESF A;  3JRD A;  2P0W A;  4BE2 A;  2JVG A;  1IN8 A;  3QYE A;  2BJC A;  1DUL A;  2OV7 A;  5D5X B;  2DK8 A;  3IL2 A;  2MC3 A;  2Z1D A;  3BR0 A;  2M4K A;  3K9T A;  1BW6 A;  2ZFW A;  2NVT J;  4XOR A;  3K4M A;  2J5P A;  3A0B C;  4P5O A;  2EFQ A;  2H8R A;  2H09 A;  1R63 A;  1ZS4 A;  2FA5 A;  1ZVV A;  2FEZ A;  2HZT A;  2QEN A;  1WRJ A;  3TEL A;  2EK5 A;  1LDK B;  3ZMV A;  4A5N A;  1YIT I;  1PDN C;  1NEQ A;  2YX7 A;  2JA7 J;  3HOV J;  1Y9Q A;  3OYD A;  3F0C A;  2P4W A;  2CSO A;  3WU0 A;  4UUS A;  4RGS A;  2KHM A;  2HS5 A;  3VWS A;  3BJO A;  1UHM A;  3NDB B;  3REO A;  2LCV A;  2UZK A;  3WTV C;  2WAD A;  4LLN A;  3WOD F;  4M3E A;  2Y0M A;  1U9N A;  4E7Z A;  1Y0N A;  2JRM A;  2XAQ A;  4DGW B;  1O4X A;  3A2K A;  3H0D A;  1HKQ A;  1P92 A;  1R58 A;  4A3E J;  1Z3Y A;  1GT0 C;  1W5C C;  3G73 A;  2QQB A;  1U5T C;  2ZXJ A;  4FAS D;  1AA7 A;  2HOE A;  3QOX A;  1W5S A;  2RN7 A;  3DKX A;  3QYB A;  4LOC A;  3ABU A;  1CQT A;  2LC2 A;  1VF9 A;  1Z6R A;  1MFQ C;  4MO7 A;  2P5V A;  1ERD A;  2IXS A;  1WFX A;  3CEC A;  5DRT A;  5IYC J;  1Y8Q B;  3ASO H;  1T95 A;  4KDP A;  2Y9Y A;  1WQ2 A;  4BDY A;  2PPX A;  1S7O A;  4I7H A;  3L2C A;  3K2A A;  4EQZ A;  4X4D A;  3S2W A;  2Z3Y A;  1NK3 P;  4ETS A;  3OOU A;  3H0G J;  4ASN A;  2H6B A;  2IU7 A;  1WHU A;  4IQ4 A;  5LHH A;  3G5G A;  4JX4 A;  3IAM 2;  2L7M P;  2VOD A;  1RRJ A;  3ZHM A;  4PU8 A;  1OCC H;  1GV5 A;  1U5T B;  2XKO A;  4J01 A;  1MMN A;  2K85 A;  2FUG 2;  3L2V A;  3FX3 A;  1IN7 A;  1J09 A;  4D5C A;  1RES A;  2DPU A;  1FBQ A;  3E97 A;  3L2R A;  1AKH A;  3W2V A;  4IA8 A;  2P6T A;  4UB8 C;  4Y17 A;  3ZN0 A;  2CUJ A;  3BP8 A;  3NWS A;  1PNR A;  2WAQ N;  3LQR A;  1UFM A;  2NS8 A;  3PUB A;  5D4S A;  2DJN A;  5FLX K;  3ME5 A;  2JQ7 A;  1TWA J;  3G1L A;  4Q47 A;  5E3O A;  1QPI A;  2X51 A;  3B6C A;  3GXO A;  3ELK A;  4XRF A;  2GA1 A;  3BZ6 A;  4U0Y A;  4HLY A;  1RIO H;  4AVZ A;  3GVA A;  2EZI A;  3BOQ A;  2CFO A;  2DQR A;  2WBM A;  1BBY A;  5IYB J;  1HOM A;  4NDL A;  2CV0 A;  2ZME C;  2R7V A;  2ZME B;  3BPX A;  2EJR A;  4IHS A;  1DP3 A;  1E2X A;  3F3X A;  3RDI A;  2Q8K A;  3J81 Z;  2Z9O A;  3VK0 A;  4G94 A;  3S1Q J;  3FYA A;  1MMG A;  4DBR A;  1S5L C;  1ON2 A;  4WX9 A;  1QPM A;  1JTY A;  2EB7 A;  3VWB A;  1C0W A;  3O6B B;  2IVQ A;  1IV6 A;  1DU0 A;  2GAU A;  1TT0 A;  4B47 A;  4O8B A;  4L9N A;  2PXL A;  4HA8 A;  4LGW A;  4C3I J;  1LPQ A;  5AON A;  3DQV C;  4BNC A;  1UJ8 A;  1Z21 A;  3MEX A;  4UVC A;  3BG5 A;  1B72 B;  4D7N A;  2XAH A;  2JVH A;  4MFD A;  4GXO A;  4JQF A;  3NRO A;  2L7K A;  4OU0 A;  2O8X A;  3I0T A;  2PXE A;  1IN4 A;  3K2Z A;  5ILV A;  3NXH A;  4WXC A;  2OJE D;  2CW0 F;  3M8F A;  3NRV A;  4L5I A;  5B66 C;  3FBN B;  2JPB A;  5H2F C;  3JSO A;  4S0H B;  3NQO A;  2EV5 A;  1CJG A;  1WJE A;  4ABZ A;  2H94 A;  1FBS A;  3KLN A;  1WJD A;  4MQV A;  4DE9 A;  2K3P A;  1UAA A;  1TQM A;  2HTJ A;  4CZZ A;  3V8J A;  1LDJ A;  3WG9 A;  5J1R A;  4DYR A;  3GTM J;  2O3F A;  3JXC L;  4HPQ A;  4M3D A;  4QTR A;  2J5O A;  4EJW A;  1MBH A;  4D7M A;  5E8I A;  1YW9 A;  1O7L A;  1QQI A;  4CYC A;  4NUB A;  2ETH A;  3FDY A;  2QF7 A;  1JHF A;  3S3N A;  2AXV A;  3F52 A;  1OCP A;  3T1B A;  3OYF A;  3GYH X;  3FMR A;  1L3L A;  1MW7 A;  3L2Q A;  1KON A;  2P7V B;  2K9M A;  1YS7 A;  5E1W A;  2R7X A;  4DOZ A;  4EM2 A;  2WAQ A;  4I2O A;  1S8N A;  2NYX A;  3LSM A;  3VFZ A;  1X4O A;  1H8A C;  2YS9 A;  4BHB A;  4E70 A;  4XID A;  3C1D A;  3QYF A;  2Q2E A;  1BA5 A;  3FMS A;  4X4B A;  3E6D A;  1WJA A;  2JSC A;  4I0B A;  3CMY A;  4EJV A;  3PSI A;  2DTZ A;  2CV2 A;  2VKH A;  4I6Z A;  2D1V A;  5GPC A;  2LDU A;  3DBR B;  2IJL A;  1UB9 A;  4A3G J;  2OFY A;  2XRN A;  3TFL A;  1OYI A;  1OCT C;  4PJM A;  4NDW A;  4HX4 A;  2V79 A;  1BJZ A;  3EPZ A;  3BJ6 A;  3S17 J;  1VND A;  1X1B A;  4JOM A;  4MIM A;  3OYG A;  3F72 A;  3A9X A;  1JUP A;  1B4A A;  4OIN F;  3DNV B;  2AWI A;  2L02 A;  1GUU A;  2YR2 A;  2VE9 A;  1QA6 A;  1V4R A;  1FSH A;  2LRE A;  3HPH A;  5KAF C;  4J19 A;  1H89 C;  2IBD A;  3TP0 A;  2PQ8 A;  3RYR A;  5FB2 A;  2LLV A;  4ER6 A;  4AU7 A;  2COB A;  3ZQL A;  5A2Q K;  4CCL A;  4B43 A;  2KT0 A;  4M73 A;  3K4N A;  1JI8 A;  1XB4 A;  2FBH A;  5DDG A;  2LF7 A;  3ZPX A;  2WIU B;  1KQ0 A;  3CCE I;  1W0T A;  4JX6 A;  2PJR B;  5IP7 J;  4JK1 X;  1ETK A;  1D1A A;  4WXD A;  4AID A;  2X6X A;  2GXG A;  2E2J J;  5E18 F;  2VLA A;  1W7P B;  2Q1Z B;  3QPH A;  1YO5 C;  5H6Q A;  2HU9 A;  4PU7 A;  3AFH A;  3IC7 A;  4ON0 A;  2K5C A;  5K7H A;  4L18 B;  1P6R A;  1ZR4 A;  3VSK A;  3PIP F;  1JT6 A;  3GBG A;  2PEX A;  3ZMD A;  2L9S A;  2BY2 A;  2VEO A;  2AQF A;  2JCG A;  1SFO J;  4B48 A;  3HZI B;  4CSW A;  1LCC A;  4ZC3 A;  1OKR A;  4HST A;  1H88 C;  2JUG A;  4FTH A;  1LE8 A;  4X4I A;  4IF4 A;  5J40 A;  3FXJ A;  1ZGW A;  4R79 A;  2ISZ A;  4Y52 J;  2ICT A;  1LUJ B;  3LSG A;  5B1A H;  2ECC A;  2VJ5 A;  3K10 A;  2E1O A;  1PUE E;  2R7D A;  5CYV A;  4CHU A;  1IRX A;  2LKX A;  4EJT A;  3OYC A;  1XMX A;  5J47 A;  2HKO A;  3MLF A;  1Z91 A;  3JSP A;  2EZL A;  2JSP A;  3TO7 A;  3OS2 A;  3NZL A;  3DP7 A;  1JKO C;  4MCX A;  4OIQ F;  5CVJ A;  4EKI A;  2P7C B;  3FYM A;  2Y0S A;  3ABL H;  3VYR B;  1TBX A;  4IVZ A;  1POU A;  4L5E A;  5HOO A;  3LAJ A;  2XGD A;  4IX7 A;  3HL2 A;  4BBR J;  4HYE A;  1HQC A;  3R1F A;  2XRL A;  4XLH A;  2ZNZ A;  4H0E A;  2HQ5 A;  4RB0 A;  2KFD A;  3WU1 B;  1ETW A;  2GA2 A;  2L9R A;  3U1K A;  3UKG A;  1ZRD A;  3BDN A;  5DCF A;  1FTT A;  2V4J C;  3VPR A;  1RNL A;  3LSP A;  1DP7 P;  1X4P A;  2M7B A;  2LFB A;  1TWF J;  1FC3 A;  2LH9 A;  1NH3 A;  4BXX J;  1DPU A;  4IO9 F;  5F0F A;  1R00 A;  2KRH A;  4W1U A;  3S32 A;  2M0M A;  1T56 A;  2F5E A;  4U88 A;  3GLX A;  1DDN A;  2AQE A;  3SXY A;  2LYQ A;  4OMZ A;  4XL9 A;  4BQA A;  2W1O A;  1VQN I;  4DJA A;  4DNC A;  3OS0 A;  2AO9 A;  4L9V A;  4XOP A;  2IV1 A;  3JXD L;  1IRZ A;  2PXQ A;  4AIJ A;  2NS0 A;  1Q1H A;  3EUA A;  2CH0 A;  2AXU A;  1YRN B;  1ZLJ A;  4F93 B;  2MGQ A;  1YS6 A;  1G59 A;  2E5Z A;  1WJC A;  2EFW A;  2QBY A;  1OIS A;  1N77 A;  1JFT A;  2M0C A;  2GRM A;  3H5N A;  4NNJ A;  3AAF A;  2Y0S N;  3IVP A;  1VQM I;  4FCY A;  4PFP A;  1WGX A;  4A5M A;  2R7T A;  4GDF A;  3ZOB A;  2IEK A;  2BW3 A;  5C4X J;  4BE0 A;  3MEJ A;  1T98 A;  1YW8 A;  2RVC A;  2X0L A;  3PQK A;  3EQL F;  4XIC A;  2XI8 A;  1OR7 A;  4CCO A;  3WTX C;  3C2H A;  3BDD A;  2X1E A;  4C2M J;  2ZO4 A;  2ODR D;  4E7S A;  1OQY A;  5LGU A;  1ETQ A;  2O49 A;  3TBI A;  2XGE A;  4KN7 X;  3S2D J;  4XR6 A;  2QLZ A;  5BOX A;  4V2F A;  5DUK A;  2RQP A;  4ANJ A;  4C2T A;  3M1E A;  1E17 A;  4DE8 A;  5JVG F;  3G7D A;  3PL8 A;  1Z67 A;  2IAI A;  2DFE A;  4A0Y A;  1TW2 A;  3E0J B;  2XF6 A;  2RKH A;  5BS6 A;  4ZTF A;  5EEG A;  3ML6 A;  4EGY A;  3HBL A;  4YIR X;  3F23 A;  2OA4 A;  2PXP A;  5HDN A;  4B4C A;  1BIB A;  1ZZ9 A;  4UY8 I;  1D5V A;  2WUS R;  4FHT A;  4IHW A;  2HGC A;  3TEP A;  4UB6 C;  1V54 H;  2KQR A;  2DMQ A;  3QOE A;  1JUS A;  2GXB A;  2ACJ A;  4V19 K;  3OMT A;  2ZXI A;  3DFG A;  4N9I A;  3DU6 A;  2R63 A;  1YIO A;  1G3T A;  3SCG A;  3DLA A;  4M3G A;  2B9S A;  1ZG5 A;  2BHZ A;  1HA8 A;  2IS4 A;  2YPR A;  2VKV A;  3KJX A;  2XDV A;  3CDH A;  3M8J A;  2EWN A;  4PFO A;  1QZZ A;  5EEH A;  5KK1 A;  4K2E A;  4U7B A;  5EG0 B;  3PO3 J;  1WJF A;  3A4C A;  1WIZ A;  3SZP A;  1Y56 A;  2LRD A;  3K69 A;  1W36 D;  2HEO A;  4EZI A;  3F6O A;  2EPF A;  4UUT A;  4BH9 A;  4M71 A;  4I6R A;  4HAM A;  1OYY A;  1BI1 A;  2GZU A;  1LQC A;  1R5I D;  5FRM A;  2V9V A;  1MIJ A;  2HNH A;  3CUQ C;  4N0B A;  5H20 A;  1TL8 A;  1IJW C;  2VXZ A;  1Y1V J;  2ZBK A;  4N4O B;  3JRF A;  5F0H A;  3EYI A;  2FNP A;  4QLC U;  3QU3 A;  3ZR8 X;  3JAM Z;  3DEU A;  3S1R J;  3RZO J;  1W7P A;  2QQ9 A;  5F6F A;  5ILU A;  3ZRG A;  4KIG A;  4UNO A;  2X6Y A;  2PJP A;  3MWM A;  3TO6 A;  2LTP A;  1QQA A;  4ZDO A;  1Z0X A;  4PZJ A;  2O0Y A;  2ID3 A;  5L3D A;  2VPL A;  1FX7 A;  3WGH A;  3KEQ A;  2XRO A;  3K0L A;  4HV5 A;  1ETY A;  2E1N A;  3MVP A;  3F21 A;  2FSW A;  3HPG A;  3LSI A;  4XLF A;  1MSF C;  4TV7 A;  2IW5 A;  3TP3 A;  4BKX A;  2DMU A;  2K9S A;  4M72 A;  3C18 A;  4Z58 A;  1O7F A;  2LYR A;  1WH7 A;  4M9X A;  1B1B A;  3KIO A;  3I55 I;  4DYC A;  2PUE A;  1QGP A;  1YJW I;  3OYN A;  3E5Q A;  2XGC A;  2JQE A;  2CS3 A;  3EUK L;  5J4V A;  2JVL A;  2R0Q C;  2XB0 X;  3OSF A;  1KQ8 A;  3OYH A;  1I1G A;  3EDP A;  3ASN H;  3F6V A;  1K7A A;  2XAS A;  5F04 A;  1UTX A;  1X58 A;  2H1K A;  4RM2 A;  2HCS A;  1EJ9 A;  4BQN A;  1ON1 A;  5J3L A;  4N4N B;  5GTI C;  5B1B H;  3FXO A;  3I53 A;  2BNN A;  2EIN H;  1FP1 D;  1W4M A;  2CO5 A;  2LVS A;  4M6X A;  3UR3 C;  3NAR A;  2ZSH B; 
#chains in the Genus database with same CATH homology
 3H3V K;  3HOV J;  5J1Y A;  1PRA A;  1E3O C;  2LYS A;  1Y9Q A;  3F0C A;  1JTX A;  2ELK A;  3CQZ J;  1JJ6 C;  4UUS A;  2DMN A;  3H5T A;  4YG1 A;  3ZQH A;  2LCV A;  2O38 A;  3HOZ J;  2HI3 A;  4D5F A;  4M3E A;  2LYL A;  1U9N A;  2LR8 A;  3GTK J;  4GHJ A;  1O4X A;  2CQX A;  3Q3S A;  4M3F A;  2O9L A;  3S14 J;  4AC0 A;  1ORK A;  4A3E J;  1GT0 C;  4JP0 A;  2K9N A;  4XRM A;  3LIS A;  1GV2 A;  4X4F A;  4Y7N J;  1T33 A;  2XCJ A;  2WB1 N;  3RKQ A;  4LOC A;  1CQT A;  1DWK A;  1VF9 A;  4MO7 A;  4C3H J;  5M3M J;  2R5Z B;  3FKI J;  2L7F P;  2O7O A;  4M6V A;  5F1J A;  3G1M A;  3CEC A;  3BR3 A;  3SFI A;  5IYC J;  5F0C A;  2AUW A;  3HGY A;  2PPX A;  2Y9Y A;  1D5Y A;  5M5X J;  4X4D A;  3K2A A;  1NK3 P;  3LFP A;  3OOU A;  4JX5 A;  3H0G J;  2IU7 A;  5IP9 J;  4EEF G;  2LYP A;  3G5G A;  1ADR A;  2PUD A;  4JX4 A;  2L7M P;  2Y30 A;  2CU7 A;  5FKN A;  2DN0 A;  3ZQF A;  3ZHM A;  3CDL A;  1Y7Y A;  3WHB A;  4C3J J;  4PU8 A;  1FIP A;  1R69 A;  1GV5 A;  5EEA A;  3EUS A;  3RZZ A;  3SCF A;  4MCT A;  3O8G A;  3BG3 A;  4B3A A;  2Y2Z A;  4X4E A;  2B5A A;  2R92 J;  4A3I J;  4D5C A;  2EBI A;  1RES A;  1AKH A;  3C2B A;  2X48 A;  1WPK A;  4IA8 A;  1MH3 A;  1RPE L;  3M3Y J;  5A7L A;  1RPW A;  2IUO A;  2EBY A;  3HOX J;  1PNR A;  2L7Z A;  2JN6 A;  2WAQ N;  2NS8 A;  2PUG A;  2DJN A;  1R9T J;  1K83 J;  2CUE A;  4YAR A;  4UUS B;  2HDD A;  1TWA J;  3G1L A;  5E3O A;  2YU9 J;  2CSF A;  1QPI A;  3GTG J;  2TRT A;  2ZB9 A;  2BNO A;  3B6C A;  2GM4 A;  4JCY A;  4G12 A;  4DW6 A;  3BTI A;  2MW8 A;  4GFB A;  4Z5C A;  1RZS A;  1X57 A;  2EZI A;  2E2I J;  1LE8 B;  3GTL J;  5EZG A;  2ME0 A;  2YUS A;  5K7Z A;  3TRB A;  2HOS A;  3OIO A;  5IYB J;  1HOM A;  2IVB A;  4NDL A;  2PE5 A;  3CLC A;  1FIA A;  2OPT A;  2AHQ A;  3LOC A;  3ZQC A;  3KZ3 A;  4Z5H A;  5FKO A;  3GTQ J;  3VK0 A;  3S1Q J;  3FYA A;  2L0K A;  1BDI A;  2EZK A;  2I10 A;  3LSJ A;  1MBF A;  1P7I A;  3O8H A;  1ZZ8 A;  4RDU A;  4A93 J;  3G1O A;  1JTY A;  2G0E A;  3GN5 B;  2P81 A;  3FMY A;  2IVQ A;  1IV6 A;  2KEI A;  1VI0 A;  1DU0 A;  1BDH A;  4X4C A;  1W0U A;  4W97 A;  4IHX A;  3GTP J;  1LCD A;  4O8B A;  2M2E A;  4C3I J;  3DCF A;  1UXD A;  5IP6 A;  1MBK A;  3E7L A;  2M34 A;  1YRN A;  1ZKG A;  3BG5 A;  3A01 A;  4D7N A;  1B72 B;  3S1M J;  4MFD A;  3RQI A;  1ZZ6 A;  2IVG A;  4A3K J;  2PUC A;  1B0N A;  3F51 A;  4QSH A;  2K9Q A;  1I6H J;  4FE4 A;  2DA3 A;  3BTJ A;  2LK2 A;  5IPA A;  1WI3 A;  2HXI A;  1WH8 A;  4PU3 C;  3JXB C;  1QP0 A;  2LP0 A;  3HEF A;  4FIS A;  4S0H B;  1CJG A;  2M8G X;  4ABZ A;  1U8B A;  2HSG A;  3BT9 A;  4Y42 A;  3ZQG A;  5J1R A;  3S15 J;  4DYR A;  3GTM J;  3JXC L;  1POG A;  3JRA A;  1K61 A;  4M3D A;  3BQZ A;  4QTR A;  3HOY J;  5M3F J;  4B1R A;  3IV5 A;  1MBH A;  4D7M A;  1ZPQ A;  2CRG A;  3HOU J;  4XK4 A;  2LD5 A;  4CYC A;  4BY7 J;  2QF7 A;  2AXV A;  3F52 A;  1MH4 A;  1OCP A;  2M9H A;  3JRC A;  5F08 A;  1A5J A;  2NOG A;  1HCR A;  2RAE A;  2GBY A;  3BG9 A;  3A01 B;  3BR2 A;  1ETX A;  1QRY A;  5FLV A;  2ICP A;  1G2H A;  1H8A C;  2YS9 A;  4XID A;  2HXO A;  1BA5 A;  4YG7 B;  1A6I A;  1I3Q J;  4X4B A;  1U9O A;  1ZZC A;  3B7H A;  2JJ7 A;  4XRS A;  4X1E A;  2NVQ J;  3W6V A;  4I76 A;  3S16 J;  2MQK A;  2PMZ N;  1ZZ7 A;  1LLI A;  1QVT A;  3CMY A;  3HM5 A;  1PRV A;  2DMP A;  2DTZ A;  3JRI A;  1Q1V A;  5IOZ A;  4I6Z A;  5GPC A;  1TC3 C;  3MKL A;  1FEX A;  1FTZ A;  3OQN A;  1UG2 A;  4A3G J;  4Z5D A;  1YSE A;  2OFY A;  1OCT C;  2WV1 A;  4NDW A;  2XJ3 A;  2PUA A;  3HGG A;  2EF8 A;  1BJZ A;  3FK7 A;  1B8I A;  2XSD C;  3S17 J;  3BS3 A;  1VND A;  2O4A A;  1RET A;  2W48 A;  4MIM A;  1JUP A;  2E2H J;  4JCX A;  4XRS G;  1ZR2 A;  2EZH A;  2FJ1 A;  2AWI A;  1GUU A;  2XPW A;  2KZ8 A;  2MEZ A;  3DNV B;  4X4G A;  9ANT A;  3F6W A;  4J19 A;  1H89 C;  3ZKC A;  5JLX A;  2IBD A;  3QF3 A;  3TP0 A;  2COB A;  3ZQL A;  1I50 J;  4A3M J;  2KT0 A;  2LYK A;  2X9D A;  5E3L A;  5EZH A;  1IUF A;  2QCO A;  4QIW N;  5EG0 A;  2FX0 A;  5GPA A;  3LNQ A;  5DTD A;  3IH2 A;  3TED A;  1JT0 A;  2WIU B;  1W0T A;  3BTC A;  4JX6 A;  5EGO A;  5IP7 J;  3PXP A;  5DS9 A;  1ETK A;  3DEW A;  1AKH B;  4A3C J;  3FK6 A;  4JQD A;  1JUM A;  3Q0U A;  2E2J J;  1WET A;  2L49 A;  2MG4 A;  3HDD A;  4PU7 A;  1RIO A;  1UMQ A;  1BL0 A;  2VKE A;  5K7H A;  1ZR4 A;  2XPV A;  2GLO A;  1JT6 A;  3GBG A;  3PO2 J;  2R1J L;  1VFC A;  2HOA A;  3Q0V A;  1SFO J;  2JCG A;  2D5V A;  3HZI B;  1LCC A;  1H88 C;  1LE8 A;  4X4I A;  1LMB 3;  5EDN A;  4FTH A;  4X6A J;  3BR5 A;  1ZGW A;  3OQO A;  4Y52 J;  2ICT A;  4YBA A;  2JWT A;  2R93 J;  1SQ8 A;  3LSG A;  2ECC A;  5E3N A;  2KPJ A;  2E1O A;  3JRB A;  3U3W A;  2LKX A;  2N8G A;  4IHY A;  3KXA A;  3QPS A;  2AW6 A;  4A3F J;  2K40 A;  4I6T A;  1LFB A;  3MLF A;  3MN2 A;  2EZL A;  3Q0W A;  2JA8 J;  1X2N A;  5IOY A;  4HNV A;  5EYR A;  1JKO C;  4MCX A;  1ZZB A;  5EF6 A;  5FKL A;  1IC8 A;  5C4J J;  3FYM A;  4IVZ A;  3CCY A;  3JRH A;  1X2L A;  1POU A;  4L5E A;  4FBI A;  2XGD A;  3QQ6 A;  1TWC J;  2DA5 A;  4BBR J;  1LFU P;  2GRL A;  3QYX A;  1MBJ A;  3R1F A;  2XRL A;  2Y31 A;  3HOW J;  3UKG A;  2HQ5 A;  4M3B A;  5HOD A;  2R7Z J;  1ETW A;  2L9R A;  3BDN A;  3S8Q A;  2HIN A;  2JA5 J;  1S7E A;  1WH5 A;  2CJJ A;  3VPR A;  3LSP A;  2XB5 A;  1FTT A;  3PM1 A;  4DYQ A;  5FJ8 J;  1EFA A;  4RBO A;  2LFB A;  4A3D J;  2OF7 A;  1TWF J;  4BXX J;  2ID6 A;  1IGN A;  2O8K A;  4YG4 A;  5F0F A;  4W1U A;  2VI6 A;  1T56 A;  2KDZ A;  1OSL A;  1U78 A;  2LYQ A;  4MFE A;  2DA1 A;  1JWL A;  4A69 C;  5IYD J;  1ETO A;  2E19 A;  1Y1W J;  2AO9 A;  2IV1 A;  3UFD A;  3JXD L;  2VUM J;  1IRZ A;  2AXU A;  2PUF A;  1HLV A;  2JMW A;  1YRN B;  2MGQ A;  3GTO J;  3O9X A;  2DA7 A;  2FQ4 A;  2HOT A;  3SDG A;  1F36 A;  1JFT A;  2M0C A;  2GRM A;  3OSG A;  1AHD P;  4CYC B;  1QVU A;  1WH6 A;  2L8N A;  2Y0S N;  3IVP A;  4X4H A;  4FCY A;  3NAU A;  4A3L J;  2CUF A;  3M4O J;  1WGX A;  2EQR A;  3ZOB A;  2IEK A;  1IDZ A;  1DW9 A;  1QP4 A;  5C4X J;  5FKM A;  5K7F A;  5BNG A;  2NS7 A;  4XIC A;  2XI8 A;  1HF0 A;  4A3B J;  4V2G A;  3OQM A;  1UHS A;  4C2M J;  2R5Z A;  4OB4 A;  2R5Y A;  2LLK A;  4JYK A;  1L1M A;  3BTL A;  1ETQ A;  4IHV A;  4I6U A;  2O49 A;  2XGE A;  3S2D J;  1RZR A;  4V2F A;  3IH4 A;  1XS9 A;  1RR7 A;  3TW6 A;  3HB9 A;  2VPR A;  3G7D A;  2XPU A;  1JGG A;  2IAI A;  1NK2 P;  1GVD A;  4BBS J;  1ENH A;  3D1N I;  1BW5 A;  1DU6 A;  5FKK A;  1MNM C;  1JKR C;  2LY9 A;  1PRU A;  4F8D A;  3GTJ J;  1FJL A;  3HBL A;  2JA6 J;  1JJ8 C;  3S2H J;  4IWR A;  4B4C A;  1ZZ9 A;  2WUS R;  2ME6 A;  4J1W A;  1ZQ3 P;  4IHW A;  3BR6 A;  3I4M J;  2CRO A;  2DMQ A;  3QQA A;  1JUS A;  5M5W J;  1JKQ C;  1ETV A;  3OMT A;  1TWG J;  3OP9 A;  2R63 A;  1MBG A;  4J1X A;  1JFS A;  2DMT A;  3GN5 A;  3QPL A;  1OJL A;  3SCG A;  4M3G A;  5E3M A;  1RKT A;  5J1U A;  3RZD J;  2TCT A;  1X2M A;  2VKV A;  2R5Y B;  3KJX A;  4BY1 J;  5FLM J;  1B8I B;  2DA4 A;  4GQM A;  3JRG A;  1ZTR A;  2A6C A;  2DA2 A;  3A02 A;  5JLW A;  3JR9 A;  1P7J A;  1WCM J;  5EG0 B;  3PO3 J;  3ZHI A;  4Z59 A;  1AU7 A;  4DZP A;  1WIZ A;  3BR1 A;  4I8T A;  5EGO B;  1XC5 A;  1PUF A;  3ZQI A;  2X6O A;  3FIW A;  2DA6 A;  1ZUG A;  5C44 J;  4UUT A;  2B63 J;  2PIJ A;  4I6R A;  1HDD C;  4DZJ A;  1OFC X;  3IH3 A;  2FJR A;  1NTC A;  2GZU A;  1LQC A;  1ITY A;  1HDP A;  4FN3 A;  1ZAY A;  5C3E J;  3TW7 A;  1RZR D;  1IJW C;  2HYJ A;  2ECB A;  1MSE C;  1Y1V J;  1ZK8 A;  3JRF A;  5F0H A;  5M5Y J;  1UXC A;  3GBF A;  2NVX J;  1QP7 A;  1QQB A;  3HKZ N;  5K98 B;  3A03 A;  1IG7 A;  2KEK A;  3FIS A;  2JK3 A;  1MBE A;  3S1R J;  3I4N J;  3RZO J;  1F43 A;  5GP9 A;  1RKW A;  1JKP C;  3BD1 A;  2FD5 A;  3QWG A;  1Z77 A;  1B72 A;  4FE7 A;  1IDY A;  2LTP A;  1XWR A;  3B6A A;  1QQA A;  1Z0X A;  1APL C;  2ID3 A;  2BNM A;  3K7A J;  1SAN A;  1ETY A;  3MVP A;  4AYB N;  1JH9 A;  1PUF B;  3SCH A;  3WHC A;  2OR1 L;  1MSF C;  1EF4 A;  3TP3 A;  3CRO L;  4BKX A;  2DMU A;  2K9S A;  1NER A;  4Z58 A;  4IEJ A;  2LYR A;  3L1P A;  1WH7 A;  3LSR A;  3JRD A;  2XIU A;  2CQQ A;  4DYC A;  2KEJ A;  2PUE A;  3BQY A;  1VPW A;  3SJM A;  2XGC A;  2LYJ A;  2EWT A;  2EH3 A;  1GDT A;  4MLO A;  2BJC A;  2PUB A;  1TWH J;  1XG1 A;  2JVL A;  2MSY A;  2R0Q C;  3BR0 A;  4AUX A;  4A3J J;  4PU4 C;  2XB0 X;  1BW6 A;  1PER L;  3OSF A;  1QPZ A;  2NVT J;  2H8R A;  5F04 A;  1UTX A;  1X58 A;  5F27 A;  2H1K A;  1R63 A;  1ZS4 A;  2AXZ A;  5J3L A;  1ZVV A;  3JRE A;  3S1N J;  2BNN A;  2NVY J;  1NEQ A;  2LVS A;  2Y9Z A;  3NAR A;  2JA7 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...