1E3OC

Crystal structure of oct-1 pou dimer bound to more
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
160
structure length
132
Chain Sequence
EEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMSKLKPLLEKWLNDAEKRTSIETNIRVALEKSFMENQKPTSEDITLIAEQLNMEKEVIRVWFSNRRQKEKRIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Differential Dimer Activities of the Transcription Factor Oct-1 by DNA-Induced Interface Swapping
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords 5'-D(*AP*TP*GP*CP*AP*TP*GP*AP*GP*GP*A)-3'
total genus 44
structure length 132
sequence length 160
ec nomenclature
pdb deposition date 2000-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00046 Homeodomain Homeodomain
C PF00157 Pou Pou domain - N-terminal to homeobox domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1e3oC02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1e3oC01
3QPLA 3JRAA 2KZ8A 1QRYA 2MGQA 1JKOC 2HOSA 5F04A 2LP0A 4M3EA 4C3JJ 4CYCB 4ABZA 1POGA 2B63J 1QP4A 1WIZA 1BDHA 3IV5A 1TWHJ 2O7OA 4YBAA 1VFCA 4M3GA 1EFAA 5FJ8J 1FTTA 1MBGA 5IOYA 3SCFA 3SFIA 2E2IJ 3GTMJ 3SCGA 3TW6A 2JWTA 1JTXA 1ZZ6A 3RZZA 3KXAA 3HBLA 3MVPA 2L9RA 2DA4A 4JX5A 5J1RA 3S1RJ 3PO3J 3S1NJ 2GBYA 2GRMA 2CUFA 1CQTA 4JX4A 1OFCX 2CJJA 2GRLA 1DW9A 2EH3A 2FJRA 1JKRC 1ZZ7A 2MSYA 2KT0A 3BQYA 2MG4A 1Z77A 1RETA 2Y31A 1JKPC 4D5CA 4IVZA 2M9HA 3BTLA 3KZ3A 3OP9A 3ZKCA 3LSGA 4C3IJ 5FKKA 1MBHA 4JYKA 3TEDA 4NDWA 1Y1VJ 3W6VA 3E7LA 2XPWA 1JUMA 2AO9A 1B72A 1CJGA 3Q0UA 4X4EA 1ETKA 2IVBA 3DNVB 4M3BA 1ZZCA 2OPTA 3FK7A 2AHQA 5IYCJ 1XG1A 3JRIA 2PUGA 2BNMA 2WUSR 1POUA 1Y7YA 4J1XA 2X6OA 3K7AJ 3TW7A 2VUMJ 3SDGA 3BDNA 2ECBA 1MH3A 2FX0A 1L1MA 2L7FP 4A3EJ 1IUFA 3Q0VA 2ZB9A 5IP7J 4XRMA 1UMQA 1YSEA 3SCHA 1I3QJ 3FYMA 5C4XJ 2EZLA 5IPAA 1LE8B 2R5YA 1PUFA 3OIOA 2FD5A 3SJMA 2VKEA 3HKZN 3OMTA 1FIAA 3BR6A 4A3BJ 3ZHIA 4XICA 1AKHB 2OFYA 4A3KJ 3RKQA 4PU7A 3EUSA 5C4JJ 5M5YJ 1AHDP 3PO2J 2MQKA 5M5XJ 3HGGA 2DA5A 2EF8A 4Z59A 2IV1A 4L5EA 3JRFA 3BR5A 2LYQA 3QWGA 1DWKA 1GUUA 1RPEL 4JP0A 1MBJA 1ETYA 3ZQFA 3OSFA 3LSPA 4PU3C 1JGGA 1LCDA 2JA6J 4B3AA 2HSGA 4F8DA 5M3FJ 4YG4A 1E3OC 2D5VA 1ZZ8A 4A3FJ 3FYAA 3GTLJ 1RZRD 1JUSA 2L7ZA 3BD1A 1VF9A 4MO7A 4BBRJ 1U78A 4Y7NJ 1F36A 2TCTA 2PUBA 1WH5A 3CLCA 3ZOBA 2KEIA 1U9OA 5GPCA 4A3IJ 5JLXA 3H3VK 3GN5A 2JVLA 4Z5DA 2LTPA 4OB4A 2XB0X 4QSHA 2LYRA 2XCJA 2LYSA 1IGNA 1QQAA 1H88C 2DMNA 4A3GJ 3BQZA 2O4AA 1ITYA 2IVGA 3A03A 4A3MJ 1JH9A 4IHXA 4W1UA 3IH3A 2E2HJ 1O4XA 1B72B 3BTIA 2XGDA 3Q3SA 2K9SA 5EF6A 1MSFC 4W97A 2XJ3A 2CU7A 2ME6A 2DA3A 2YU9J 1X57A 4FBIA 1RPWA 4LOCA 4MFEA 2NOGA 1ZZBA 1G2HA 3RZOJ 2NS8A 1JFSA 2X9DA 4D5FA 5J1YA 4GQMA 2IVQA 4D7NA 2HXIA 4Z5CA 4DZJA 1MBEA 1XC5A 2JK3A 3A01B 2MEZA 3JREA 4I6ZA 1JUPA 3TP3A 1AU7A 4D7MA 3S2DJ 1T56A 5FLMJ 2XGCA 3WHCA 2WB1N 1FIPA 3ZQHA 3GBGA 1QQBA 1QP7A 1I50J 1B8IB 1SANA 5EG0A 3HOWJ 1WH8A 3OQOA 2R92J 2LYLA 1I6HJ 4X4HA 4M3DA 2IU7A 4B1RA 1IDYA 1RR7A 4CYCA 2O38A 1B8IA 2COBA 2JA5J 3S1MJ 2JCGA 2R1JL 1RZRA 1PNRA 2XI8A 3BS3A 1HDPA 3S2HJ 2LY9A 1ZVVA 1K61A 2DJNA 3JR9A 3MKLA 2HQ5A 1U8BA 4BY1J 1LQCA 2NVYJ 3H0GJ 1P7JA 2IAIA 3G1OA 1VPWA 3ZHMA 3PM1A 1ORKA 2PPXA 5FKLA 1ZR4A 2Y30A 4BY7J 1T33A 2EQRA 1JJ6C 4XRSA 5F08A 1X2MA 3MLFA 4X4DA 1K83J 5A7LA 4X1EA 1ZTRA 3O9XA 1Z0XA 2CRGA 2M0CA 2VKVA 1UXCA 4X4FA 2KEJA 4XK4A 3H5TA 1ETWA 3ZQGA 1D5YA 2HOTA 3CROL 1ZQ3P 1PERL 3LNQA 4GFBA 2EBYA 1OCPA 2WAQN 2B5AA 3GN5B 2XIUA 1QPIA 2TRTA 1MH4A 3R1FA 1RKWA 4Z5HA 2L0KA 5E3LA 3TP0A 2R93J 1XWRA 4IEJA 4RDUA 1ZUGA 2HINA 2AXVA 2LYJA 2XRLA 4IA8A 1GV5A 2OR1L 2N8GA 1H8AC 2JJ7A 4DYCA 1WETA 5F0FA 5FKOA 1ADRA 3VK0A 3JXDL 4I6RA 5IOZA 1VI0A 2DMTA 3LOCA 2NS7A 2NVTJ 4AC0A 2XPVA 2K9QA 1GV2A 3I4NJ 2EZHA 1ETVA 3GTOJ 3FMYA 2R5ZB 4UUSB 1BL0A 2KPJA 3JRHA 4M6VA 2DMQA 2EBIA 4XIDA 1YRNA 3WHBA 2AXUA 2HOAA 2XGEA 2Y9YA 3CQZJ 1ZGWA 2L7MP 3OQMA 5K7HA 4V2FA 5E3MA 1MBFA 5F27A 1OCTC 2A6CA 4FE7A 1TWGJ 3HOXJ 4X4GA 2R7ZJ 3UFDA 3FISA 2ICPA 4JX6A 4M3FA 3BR0A 1B0NA 1JWLA 1ZAYA 2IUOA 3KJXA 1X58A 1MNMC 2VPRA 1WI3A 3A02A 1NEQA 2QF7A 1F43A 3I4MJ 1UHSA 2CQXA 9ANTA 1WGXA 3FK6A 3D1NI 2IBDA 3G1MA 2JMWA 2L49A 1ETOA 4IWRA 2DA2A 4BBSJ 3S8QA 1APLC 1W0TA 2OF7A 1OJLA 1LLIA 2NVXJ 5F0HA 3FKIJ 3BR2A 2LLKA 1HDDC 4MLOA 1JFTA 5FLVA 1NERA 1VNDA 4Y52J 2YS9A 4JCXA 2XB5A 2AW6A 3F0CA 2ME0A 2P81A 3IVPA 2PMZN 1Q1VA 2AUWA 2EZKA 1MBKA 1ZKGA 3G7DA 3K2AA 1AKHA 4A3JJ 1LMB3 1H89C 1QP0A 1ZK8A 2LKXA 4I76A 1R9TJ 3F52A 3CDLA 1IDZA 4X4BA 1JTYA 3L1PA 1LFUP 2QCOA 2PIJA 1BW6A 1WH6A 4MIMA 1YRNB 3HDDA 2X48A 2E2JJ 3VPRA 3BG5A 3FIWA 1BDIA 2LYPA 3G5GA 2HXOA 3ZQLA 1PUFB 1LFBA 4XRSG 1ZR2A 4I6UA 1IV6A 3GTPJ 2BJCA 2FJ1A 3QQAA 2PUDA 1RIOA 1ZPQA 3HOUJ 2Y9ZA 5EDNA 3DCFA 1TWFJ 4AUXA 2CROA 2BNOA 3DEWA 5E3OA 1DU0A 2L8NA 5IP9J 3QQ6A 1OSLA 1NTCA 1UTXA 1QVTA 3GTKJ 1UG2A 3S16J 3IH4A 5GP9A 1SQ8A 2DMPA 4A3DJ 3GTGJ 2R0QC 1ENHA 5DS9A 1RKTA 3QF3A 5M3MJ 3LSRA 1NK2P 2KDZA 2CSFA 2JN6A 1BJZA 5IYBJ 1IJWC 5HODA 4PU4C 1IG7A 5IYDJ 1EF4A 2R5YB 2PUCA 1ETQA 5DTDA 3JRBA 2M2EA 2DN0A 2O8KA 4UUTA 1U9NA 2DMUA 4GHJA 1WPKA 4B4CA 4X4CA 2LK2A 3F51A 1ETXA 1FJLA 1WCMJ 4QTRA 4FE4A 1JT6A 1LE8A 1TC3C 2IEKA 4HNVA 4J1WA 4IHVA 3NAUA 3OQNA 1GT0C 5EG0B 5J1UA 3O8HA 2VI6A 5BNGA 3A01A 2ID3A 4S0HB 5EGOA 1BW5A 3JRCA 1TWAJ 2XPUA 3BG9A 2HDDA 1FTZA 4EEFG 2BNNA 3C2BA 4NDLA 1HOMA 2GM4A 2NVQJ 2O49A 3OSGA 2EZIA 2LVSA 3GTJJ 3OOUA 5K7ZA 2JA7J 4DYQA 2ECCA 4JCYA 2M8GX 5M5WJ 1PRVA 2O9LA 2ID6A 5C44J 5F0CA 5EGOB 3BG3A 4C2MJ 1LCCA 1QVUA 4V2GA 1Y9QA 4X4IA 2MW8A 4FTHA 2H8RA 4BKXA 2LYKA 3UKGA 2R63A 1HCRA 3HEFA 2LD5A 2KEKA 1R69A 2AWIA 1UXDA 3GTQJ 1SFOJ 3O8GA 2PUAA 4IHYA 4BXXJ 2E1OA 4A3LJ 3HOYJ 3JXCL 4QIWN 1GVDA 5F1JA 1ZS4A 2HI3A 1PRUA 3B7HA 3BT9A 4RBOA 4DW6A 4MCTA 4MCXA 3GBFA 3CECA 4Y42A 2K9NA 2CUEA 2HYJA 3B6CA 4YG1A 4JQDA 2JA8J 3M4OJ 3LSJA 3RQIA 3QYXA 2G0EA 2YUSA 4X6AJ 2PE5A 2R5ZA 5EZGA 2PUEA 4YG7B 3LISA 1MSEC 2CQQA 2DA7A 1W0UA 3PXPA 3U3WA 4A69C 4I8TA 3IH2A 2GLOA 4A93J 2M34A 2RAEA 2XSDC 1TWCJ 1X2NA 4DZPA 1NK3P 3HB9A 1IRZA 2PUFA 5GPAA 2H1KA 4I6TA 4IHWA 1A5JA 3S15J 2WV1A 4FISA 3S1QJ 2ICTA 2DA1A 3HZIB 1WH7A 2K40A 3JRGA 4AYBN 3G1LA 3F6WA 4Z58A 1QPZA 3LFPA 2E19A 3TRBA 5EZHA 4O8BA 4DYRA 3B6AA 1JKQC 3M3YJ 5EYRA 1X2LA 3BTCA 1A6IA 2WIUB 3HM5A 1BA5A 1GDTA 1HF0A 3ZQCA 1IC8A 1Y1WJ 5EEAA 5JLWA 3CCYA 1DU6A 5FKMA 4J19A 3BR1A 3JRDA 3ZQIA 4FN3A 1S7EA 4UUSA 5E3NA 4YARA 4C3HJ 1FEXA 3Q0WA 1PRAA 4A3CJ 2W48A 5IP6A 1JT0A 3NARA 2LR8A 4MFDA 2Y0SN 5FKNA 1XS9A 3JXBC 1HLVA 5J3LA 2AXZA 3HGYA 1RESA 4FCYA 3RZDJ 2ELKA 3S17J 1R63A 3MN2A 5K7FA 2FQ4A 3CMYA 1RZSA 3S14J 2Y2ZA 4PU8A 2EWTA 5C3EJ 3BTJA 3HOVJ 1P7IA 2DA6A 3QPSA 2LFBA 3BR3A 5K98B 4G12A 2DTZA 2LCVA 2GZUA 1ZZ9A 3HOZJ 1JJ8C 2I10A
chains in the Genus database with same CATH superfamily
2IA1A 3QOXA 2JRMA 3DBLB 2ZCWA 5IT9K 3FHZA 1V4RA 1P2FA 1WIZA 1GVJA 2IA0A 1TWHJ 2DT6A 1VFCA 3PSIA 4M3GA 5HNFA 5FJ8J 5IOYA 3SCFA 4B3XA 2E2IJ 1XMXA 2KQRA 3KCCA 3K1NA 3GZDA 3HBLA 3S1RJ 2F5CA 2VL8A 2GRMA 5BMZA 1CQTA 2GZWA 2VQGA 3CCVI 4IOCF 1TQIA 4HPQA 4CCNA 2LY2A 2RQQA 1DW9A 2EH3A 2EJRA 3Q9SA 1A35A 3MAJA 3DWLE 1FZPB 3ZN1A 2W00A 3RPUD 2Y31A 5BS6A 4R8HA 4LK0F 4Y33A 3K4NA 3GFIA 1D1AA 2FRHA 1VQLI 4C3IJ 3I59B 4MQ9F 1P4AA 2UXNA 3W6VA 3EUKL 4U88A 2XPWA 1JUMA 3A4CA 3FXJA 2PLYA 4E7SA 4CSWA 4IXAA 3Q0UA 2VBYA 4BHPA 2DODA 3PQJA 4X4EA 3ABMH 4M3BA 2PXTA 4HA8A 1A04A 1ZARA 3MZHA 4HRIA 1R58A 1MNEA 5IYCJ 1S9HA 2IPQX 3JRIA 1Y7YA 1K6YA 2X6OA 4Y3OA 3JAMZ 1FPQA 1BIBA 3GCMA 4OBMA 1FP2A 3WODF 1Z6RA 1FOKA 5LHGA 5HDNA 1WJEA 3OYAA 4K2EA 4Q48A 3SJMA 1W7PA 2CG4A 1R1VA 1D0YA 3N97A 1C0WA 1FIAA 1AKHB 2OFYA 6PAXA 5D5XB 5M5XJ 4Z59A 2XRNA 5JVGF 2EFPA 3L9FA 2ELHA 3UR3C 5BQTA 1BI2A 4QWQA 3ASNH 1HW1A 4JP0A 1TTYA 2JRTA 2W57A 3CESA 3NEUA 4G6QA 3OSFA 5DTQA 2FXAA 2LF7A 1JI8A 1LCDA 2JA6J 1MMAA 4B3AA 4DIQA 4YG4A 1Z3XA 4JK1X 2IT0A 3FYAA 2HYGD 3KP5A 3GW2A 4BDZA 4XNFA 4RM2A 4BNCA 1QHGA 3KP3A 4Y7NJ 2TCTA 3ZQ7A 3ABKH 2WTEA 2WY7Q 3PIPF 3ZOBA 1XCBA 1U9OA 5GPCA 5JLXA 1FP1D 4N4NB 3GN5A 4Z5DA 4OB4A 3OYNA 4QSHA 2XCJA 2EFNA 2LYSA 3CCSI 3JW4A 1DP7P 3W6KB 2KMUA 1B9MA 4ZC3A 2RKHA 1JH9A 4DQ2A 3DEUA 4IHXA 1LKXA 1X1DA 3REOA 4HYEA 2K9SA 3HUGB 5E20A 1MSFC 3DKXA 2XJ3A 4ZH4F 2ME6A 2DA3A 3FMQA 3K1PA 4OWRB 1JFSA 2IGNA 4CCOA 1Z67A 3ZQQA 4Z5CA 1XC5A 3A01B 1SFUA 2NRAC 2KRCA 4I0BA 2EIMH 1JUPA 2DI3A 3F72A 4NUBA 3TP3A 2O03A 3IKTA 3H9GA 1T56A 1OMIA 2HYFA 1Z6TA 2WBMA 2KJCA 2PXVA 5FFXA 1QQBA 4PFPA 3VWBA 1B8IB 3WTSC 3DPUA 3PNYA 3A9ZA 3I3LA 4XSXF 2LYLA 4KNYA 2IU7A 4B1RA 3U3WA 2R1JL 5A2QK 2JCGA 1IRFA 4I01A 2C6YA 3DKYA 5EJCA 1ZVVA 3KEOA 2CQKA 1K61A 5CLSA 2HQ5A 3DFGA 4KMUX 1XN7A 2P8TA 3JTHA 2MFZA 4KJZA 3CC7I 3VWSA 3A9YA 3QP6A 4YIRX 2XSJC 2IAIA 1F5TA 2BV6A 1D1BA 2JA2A 1VPWA 1Y8QB 5FKLA 5LHHA 1DDNA 1UELB 3OIQA 1KYWA 3E6CC 3FX3A 2UWMA 3OMYA 1G4DA 1T33A 2EQRA 1JJ6C 5DCFA 2ZJQF 1XDSA 2HTSA 2M7AA 5J4VA 2IS2A 1Y0UA 4G6DA 2R7UA 4ER6A 4X1EA 3V7CA 3C1DA 3SEQA 4UV8A 2VKVA 2M4GA 3V8KA 1TNTA 2KEJA 3PSFA 4AIJA 2E34A 3ERMA 3AL0C 1KU3A 3FMRA 2PQ8A 2L4AA 3CP8A 2YSRA 4PGGA 4G7ZF 3KLOA 1QA6A 2LKSA 1P92A 1A31A 1TT5B 2KIMA 1N25A 2Y75A 2WAQN 3R4KA 4HQEA 3R1FA 2TRTA 1SFKA 3V4GA 3OS2A 1U5TC 1UAAA 1DP3A 2R93J 2EFWA 4IEJA 5ERIA 2QWWA 4IQ4A 2AXVA 2A68F 1FMVA 2WA0A 3G73A 3A0HC 3CUQC 1GV5A 3FXQA 1RC9A 2XF5A 1R00A 1H8AC 2OR1L 3E5XA 5KAIC 1B9NA 3C2HA 4ESFA 1VQ8I 2W7NA 3GZ6A 4I6RA 5IOZA 2DOEA 2DT5A 4G94A 4AC0A 2VASA 4A6DA 4HSRA 3F8BA 1Z7LA 4BE2A 3SFZA 4UUSB 3CUQA 1BL0A 4M6VA 3WHBA 2AXUA 3CZ6A 5JHUA 1ZGWA 1MZBA 1FYMA 4MTDA 1SFEA 2EK5A 2LOOA 3I55I 2GA1A 4M3FA 3S8PA 3WU2C 1U6GA 1WJCA 2B7EA 3RCOA 1IO2A 1BOBA 3H92A 1ZAYA 4KICA 2IUOA 1WI3A 1XDUA 3V8JA 1YYVA 3S3OA 4EK9A 3ZXSA 2PG4A 5GADJ 3G1MA 2PXQA 1HKTA 3S8QA 3M1EA 4AM3A 1OJLA 1UCRA 3LFKA 2VJ4A 3RQ4A 2QSHX 1NERA 1VNDA 4Y52J 5JUWA 1O3QA 3F0CA 2R7SA 3DEEA 2JZYA 4N9IA 2V9PA 3TGNA 3BC8A 4HQMA 3HYIA 4WX9A 1J75A 1OCRH 1MBKA 3WGIA 3G7DA 3RKYA 3CC2I 2JVHA 2LKXA 3LSTA 3F52A 2FSWA 4CHUA 1QBJA 3BP8A 4V19K 3L1PA 1JE8A 3FWEA 5E18F 2PXEA 1Z3YA 4LGWA 3CCRI 5DM6F 5E79C 2QGUA 1YRNB 3HDDA 3RPQA 1XSXA 2E2JJ 5DCMA 3KEQA 2ZNZA 1XMKA 2LYPA 3FKJA 4P55A 2ZKZA 2HXOA 3VYTB 4C2UA 1HQ1A 1G3YA 2JUCA 2HFHA 2X1DA 4XRSG 3CCQI 3GTPJ 2BJCA 1EJ9A 4RGUA 2R7VA 4I02A 2LNMA 3FM3A 1LJ9A 1K4SA 3HOUJ 2ZJRF 1TWFJ 2CROA 3OV8A 2EPFA 1XSVA 2DYRH 2K85A 2XKOA 3DEWA 4LMYA 5E3OA 2L8NA 1R4NB 5IP9J 4AYBA 4BEHB 1UTXA 2PXLA 1SMYF 3DM5A 3HHHA 1S6LA 3IH4A 1SQ8A 2DMPA 5HLGA 4A3DJ 3CDHA 5DS9A 3BROA 4XRFA 5M3MJ 2J5OA 4PGHA 1K6OA 2BY3A 5IYBJ 2KISA 2STWA 2R5YB 1ETQA 2VPLA 1LDKB 3VSLA 2DN0A 1YIOA 3BCAA 4UUTA 2G7HA 4Y4RA 2D1VA 4BDYA 4IHSA 2LK2A 2V6CA 3F51A 5AONA 2ZSHB 5KVRA 1JXSA 2KZGA 2ZNYA 2DFHA 1TC3C 2PX9A 2YPRA 1QB2A 4J1WA 2OD5A 2VONA 2BE5F 1U2ZA 1TLHB 3OQNA 5TJJA 2ZXHA 4UNOA 3H0DA 4ER5A 1VQKI 3DTKA 2XPUA 3WGHA 1GLNA 4EEFG 4ZYHA 2BNNA 3X2QH 4BQNA 2DPUA 1R7JA 2BY0A 2UUZA 2HQRA 3Q5FA 3GTJJ 1ULYA 4KITB 5ICCA 5LBQA 1SMTA 3TELA 2RDPA 2O9LA 2A5YB 1WSUA 4H0EA 4C2MJ 2CQNA 1Y9QA 2BGCA 2CW0F 4ON0A 5HLHA 3G6EI 3IP4B 3UKGA 3N4MA 3KP2A 4Y17A 3HEFA 2DPDA 1K4TA 3KLNA 4F92B 3KZYA 2ISZA 1P9QC 2KIQA 3HPHA 3O8GA 1CF7A 4BXXJ 1VQMI 1QO0D 3ELKA 3HOYJ 3MWMA 3JXCL 1J5YA 3GMEA 4IHTA 1KQ8A 2IS6A 4HNTA 4DW6A 3GBFA 3CECA 4WXDA 2OTJI 2CUEA 2HYJA 5FO5A 2DBBA 3HRTA 4JQDA 2JA8J 3I0TA 1PUEE 3R0JA 2I5UA 3T0YA 2E1CA 4IKFA 1R23A 2P5KA 2YX4A 4X6AJ 2PE5A 5EZGA 3LL7A 4YG7B 3KP6A 2HNHA 2EIKH 4IWRA 2ACJA 2CQQA 5E1ZB 4EGYA 4PJMA 1MFQC 3IH2A 2GLOA 4BHCA 1LVKA 3F8NA 2QKMB 2W84A 1X2NA 3CTAA 4UY8I 1NG7A 5IY5H 3OYGA 2PUFA 5GPAA 4XN0A 4IHWA 1A5JA 2WV1A 4FISA 4ZTJA 1G59A 1XB4A 4ESJA 1I27A 2QENA 4MTEA 1G6NA 4DE9A 1D0XA 3JRGA 3G1LA 2L9NA 3OYJA 3F6WA 1KQ0A 1TT0A 2IVMA 4UB6C 1I1SA 1Y56A 4DYRA 4I0AA 5EYRA 3J7AY 2A61A 2VBZA 3BTCA 1X2LA 2AQFA 3HM5A 1V5EA 1T2KA 5D4SA 4HRAA 3GZDC 2HVQA 3V42A 2V1DA 4J19A 2JT1A 3BR1A 1S7EA 1LPQA 3RI4A 2QUFA 1FEXA 1R4MB 1MNDA 2W48A 1O57A 4A6EA 2BXZA 1SFXA 4GGGA 5FKNA 1XS9A 3JCUC 1HQCA 4L0ZB 1R63A 2QKLB 3CMYA 5K7FA 2FQ4A 1LDDA 4XOTA 2ZC2A 1T8IA 2EWTA 5CVRA 4I2OA 3LSMA 1T98A 3AG1H 1P7IA 2DA6A 4UV9A 2LFBA 2QZ8A 3ESWB 3TO9A 4G12A 2GOMA 3ABLH 2H27A 4GRIA 3KZIC 3FM5A 5DTRA 5ILVA 2HOSA 2LP0A 1QHHD 4ABZA 2OTLI 3BG6A 4A12A 4LLNA 3IV5A 2Z16A 4UHTA 1YX3A 3PNVA 2V4JC 4YBAA 4LITA 1MBGA 3GTMJ 5JFRA 3TW6A 2JWTA 3FXRA 4F52A 2RN7A 1KQ9A 1MDMB 1BI0A 1WFXA 2L9RA 3VOEA 1ZZ6A 5JVTA 1IXRC 5GAGi 4CCJA 1G3SA 2CUFA 1SD4A 2Z2SB 4JOMA 4HBLA 1A6QA 1R5ID 4JX4A 3S3NA 2R7QA 1DPUA 2XF7A 4CDGA 4II2A 5B3SH 1O7FA 1ZZ7A 1G3TA 2MSYA 1UHMA 1RETA 3QFIA 2BVMA 4D5CA 3ZKCA 4M9ZA 3LSGA 4ZZLA 1MBHA 1ZRFA 4C2TA 1MD0A 2AO9A 5F64A 1CJGA 1FMWA 1QGPA 1ETKA 4AVPA 4F3QA 3K2ZA 2OC6A 1R49A 2IVBA 3C7JA 4IRHA 1FT9A 1ZZCA 1REPC 2OPTA 3F9KA 4EJWA 4F7ZA 2AHQA 2M5WA 3E5UA 4L9TA 3KFWX 4S05A 3K7AJ 3AL0B 4BJ6C 4RAYA 3BDNA 2KIUA 2HZDA 1MH3A 1L1MA 1X3ZB 2ZJ2A 3Q0VA 4HW0A 4RGRA 2K3FA 2ZB9A 3K4LA 5IP7J 2VT3A 4KIBA 3PNTA 3WGGA 2E36A 3SCHA 1RUNA 2EV0A 3HRMA 5C4XJ 3GVAA 1ZH5A 2HDWA 3OIOA 2FD5A 2D1HA 2P7VB 3ROUA 4S04A 1VQ5I 3SEZA 3HKZN 3WU1B 1E0EA 3OMTA 4A3BJ 4D0PA 3ZHIA 3PE5A 2E35A 3VFZA 4BL0B 1OYIA 1SD5A 3RKQA 5C4JJ 3SHFA 2CW8A 3WE2A 3PO2J 2MQKA 3FZVA 1BR2A 2A07F 4UB8C 2ICWG 3EYYA 3TO6A 5CJ9A 1IUYA 3KEYA 4HV6A 2YX7A 4KMFA 1DGWY 4GYIA 4OIPF 4PU3C 2R7DA 3P9IA 3MEJA 3LAJA 1LB2A 3RYPA 1JGGA 5J47A 4B47A 1ZG3A 2VIXA 2F4OB 4XLAA 2UXXA 2HOEA 3QAHA 4KISA 3E6BA 3ZCOA 4B09A 1FBUA 1YO5C 4BBRJ 2W4SA 2Y48A 2JPBA 1JHHA 1WH5A 3CLCA 1XGNA 2KEIA 3GX4X 1SVLA 3B73A 3I64A 1SAUA 2LTPA 3DTIA 1LFPA 2HPMA 3ECHA 3KIOA 3E1SA 2CO5A 2OJED 1QQAA 4EKIA 3BQZA 1ITYA 3A03A 4ENKA 2ODRD 3IH3A 4G7HF 2XGDA 5L3EA 3Q3SA 3G71I 5EF6A 1HXDA 3D5LA 4G9YA 4I98B 2CU7A 2YU9J 1X57A 4FBIA 2O0YA 2KKOA 4Y13A 1G2HA 2HPIA 1LNWA 2NS8A 2X9DA 3PFYA 4I09A 5J1YA 4GQMA 3IKVA 5DRTA 4DZJA 1MBEA 3H9QA 2XUBA 2W25A 3JREA 2MEZA 3BWGA 4LFUA 4D7MA 3OY9A 3FXKA 4YFXF 1BJAA 4JQFA 3V7SA 4ER3A 2PXDA 2PJPA 3HOWJ 5CYVA 5A2QZ 3KL4A 4F91B 2QEXI 2MH2A 3I4PA 3A2KA 3T8RA 4ZDPA 4F93B 3OL3A 4CYCA 1B8IA 4RB3C 2BOLA 1HDPA 1USTA 2VXDA 3OYFA 1OR7C 1G3WA 1OCZH 3JTGA 3HG9A 3NWTA 2FOWA 1U8BA 1LQCA 2BW3B 5IT9Z 1IF1A 2F5FA 2M3AA 1YJNI 3FHNA 1WI9A 3E97A 4FT8A 3QRFF 2L9SA 5H6QA 2LDUA 5K1YA 4LLLA 3TL4X 4PDKA 3H3ZA 4X4DA 2XDVA 3J7YJ 2XXQA 5E1WA 3KZZA 1ZTRA 3GEZA 1X19A 3P5JA 3WTXC 3OYBA 1D0ZA 4ENJA 3TEPA 1QZZA 4X4FA 4FX4A 2STTA 4OMZA 2VXZA 4KN7X 3OYCA 3HJEA 1D5YA 3D5SC 4XBFA 3VSKA 1ZGAA 2EBYA 3IRQA 3BLYA 1VQ7I 1MH4A 3IAM2 4KT6A 1J59A 4Z5HA 3CJQB 2L0KA 3NQOA 5CVUA 1ZUGA 1I39A 5FLXZ 1OYYA 2KJBA 2XRLA 3DV8A 1HA8A 2LYJA 5TRDA 4QPQA 2AS5F 3HPGA 1Y0NA 2E60A 3K70C 2NYXA 1WHUA 2WY8Q 3VK0A 3EPZA 3J80Z 1P4XA 4OIOF 3JXDL 2VE9A 2DO7A 2L01A 1YW8A 4KA4A 3ZPLA 2XPVA 2K9QA 1GV2A 2YBDA 4CH7A 2BHZA 3QU3A 3GTOJ 3FMYA 1R1UA 2R5ZB 2DAOA 4XIDA 1YRNA 2XGEA 2Z99A 2L7MP 4PFOA 4PSWA 3OQMA 3M8FA 3LSHA 4V2FA 5KAFC 4D1QA 3M07A 5F27A 2A6CA 3CJNA 1RR8C 1ODDA 2R7ZJ 4X4GA 1VZ0A 3FISA 4OOIA 1B0NA 1KU7A 2I8DA 1OR7A 5KNLA 4EJTA 5J6XA 3F3XA 3IRRA 4BS9A 2HCSA 2ELJA 2VPRA 3A02A 1F43A 3H5AA 1OYWA 1UHSA 3ZMTA 4RLQA 3U9GA 9ANTA 3FK6A 2LF8A 2LLWA 3DTEA 4FHTA 5TISC 2IBDA 5LGUA 2JMWA 3AG3H 1ETOA 4XOPA 2DA2A 5LLQA 1YW7A 5CVIA 2L49A 3CLQA 4DE8A 2OF7A 1LLIA 1XD7A 2JSCA 3FKIJ 5K5RA 2ZXJA 2J5PA 2Q2EA 2E7XA 3AG2H 2IW5A 2LRDA 3QOPA 2YS9A 4GO1A 1KU9A 2FNPA 3RSNA 4EM1A 2LC2A 2P81A 5J8FA 3VYSB 2JPCA 4RAGA 2AUWA 3LQRA 1ZKGA 1IAWA 3K2AA 4WVLA 3T8TA 5B1BH 1LMB3 2M0MA 4HLXA 1QP0A 1ZK8A 4I76A 4HF2A 5FRNA 4X4BA 4E7ZA 3K0LA 1LFUP 2PIJA 2M4KA 2D2WA 3WTVC 1F9NA 1X1AA 2X48A 1HSJA 2Z9OA 3VPRA 3IWFA 3FIWA 1BN5A 1OKRA 2HQNA 2P7CB 5FD5A 4OIQF 4I6UA 1Y39A 5DSXA 2FJ1A 2PUDA 1ZPQA 2FBHA 3WU0A 4ZYGA 2Y9ZA 2FBIA 4WXHA 3CC4I 4O3MA 3J80K 4AUXA 1TW2A 1X1PA 3DLLF 3QQ6A 2X85A 3ZMZA 5LGTA 4U0YA 3MFKA 1W36D 1OSLA 2CQ7A 3GTKJ 3ONQA 5F6FA 3PUBA 5AIPA 2DYSH 5CVJA 1V54H 4ER7A 2MH9A 1H9TA 1X1CA 3ZMUA 2KDZA 5GAGJ 2O61A 2V9KA 2VODA 3ZPXA 1BJZA 1IJWC 5KHDA 1FYKA 3BDDA 3IUOA 3BJAA 2V3CC 3D0SA 3A0BC 2JQ7A 4LIVA 4ENNA 5HLTA 1QU3A 1U5TA 2DMUA 1WJBA 1WPKA 5FROA 4B4CA 4GHJA 4X4CA 4L9VA 2Y0MA 1ETXA 4IVNA 2NNYA 3HSFA 4FE4A 1LE8A 3NRVA 5J40A 3TKYA 1RZ4A 4HNVA 1QPMA 4IHVA 1DUXC 2GA2A 3NAUA 4RB2C 1GT0C 2IRFG 4L5IA 1T0FC 1W5TA 3CJRB 1YW9A 3MEXA 3O8HA 5EGOA 2EV5A 1FYLA 4IRIA 2HEOA 4BAYA 1BI1A 2FQ3A 3C2BA 3CUQB 4NDLA 1HOMA 4II3A 2GM4A 5ICGA 3OSGA 3R0AA 2HR3A 2LVSA 2TDXA 1N78A 2CMPA 1SVMA 4XLPF 1DGRM 5K7ZA 3LQXA 2FNAA 3DXJF 1HKSA 2LH9A 4OINF 4DYQA 2M8GX 3RKXA 3KYDB 1YS6A 2ID6A 2QA4I 2CFOA 3FDYA 1LCCA 4V2GA 4BKXA 4M73A 3HTUA 2NAZA 1HCRA 2R63A 5D6EA 1I3AA 1YOVB 2FBKA 2L5QA 3ECOA 3K70D 4XKCA 3CO6C 2IS1A 1EV7A 1KA8A 1Z21A 4EQQA 4IHYA 2PUAA 3M8EA 3OL4A 4CZZA 2E1OA 4E7LA 1GVDA 4PJNA 3HRSA 4FETA 2HI3A 1PRUA 4XQFA 4RBOA 1ZG5A 3OYIA 3DBHB 1K7AA 4MCTA 2H94A 4MCXA 5CQGA 2X6WA 4ZJZA 5E17F 5HOOA 2PJRA 4HV5A 3LSJA 1XX5A 2PFBA 1Z05A 2DJIA 2G0EA 4QLCU 4J00A 3LFUA 2PUEA 2A6EF 3SQNA 2DA7A 1W0UA 4I8TA 1KYZA 4A69C 4XLFA 4KIGA 1WJFA 2XSDC 4LB5A 1TWCJ 1Z91A 3W2VA 2M30A 2XXPA 1D5VA 2CV0A 2H1KA 2OA4A 4LJZF 5HVQC 3MMYB 2NVUB 1KGSA 2H6CA 2MD5A 1I5ZA 2ICTA 1YJ9I 2WAQA 3HZIB 2PMZA 3E3VA 2GWRA 2GXGA 2EFQA 3J81Z 1L0OC 1WH7A 4B48A 1QPZA 5LFAA 4I7HA 3L2QA 3TRBA 4O8BA 3GZNB 2ESNA 3KP7A 3B6AA 3M3YJ 1J2XA 1IW7F 5L3GA 4B43A 1A6IA 2DFFA 2PXKA 2R7RA 2IGOA 1BA5A 2ZFUA 1GDTA 5B66C 2K3PA 5HS8A 1IC8A 5EEAA 2RGVA 5JLWA 4A2UA 3CMAI 2VE8A 2IGKA 3JRDA 2R4GA 3VYUB 3ZQIA 4UUSA 4FN3A 4N0BA 1WKMA 4HX7A 3IAS2 1X4OA 4MNUA 3DU6A 3MZ8A 2LR8A 2PXFA 2Y0SN 3JXBC 2AXZA 1Z7UA 3HGYA 4IO9F 2VT2A 1IN6A 2ELKA 4IPAA 3V7RA 4WCGA 2M87A 3SXYA 3S14J 2W1OA 5K5QA 4PU8A 1WQ2A 5HDKA 5C3EJ 4YELA 3BTJA 3HOVJ 1Z1DA 3QPSA 4HG2A 5K98B 1JGSA 3ABTA 2LCVA 1ZZ9A 2JSPA 1S7AA 3HOZJ 2I10A 4LB6B 2IGMA 3LAPA 3DPTA 3QPLA 3CDIA 2KZ8A 2MGQA 4HSTA 2O5RA 1MKMA 4C3JJ 4CYCB 2B63J 2RVCA 3BY6A 3TO7A 3EUHC 3KYCB 1BDHA 3OYKA 2O7OA 1LDJA 2EA2A 3BJOA 5KK1A 1PERL 3H5RA 4M6YA 1FTTA 3SCGA 3SFIA 4F55A 1JTXA 2MBFA 3RZZA 4DJAA 3KXAA 3MVPA 4JX5A 3C2GA 3TOAA 1I6XA 3A1YA 1NW3A 2BHYA 1OFCX 4ER0A 2Q8KA 2CJJA 3IWZA 3F22A 5H6RA 2QBYB 2MLGA 1JKRC 3OKZA 2KT0A 4L18B 2MG4A 1Z77A 3A9XA 3GF2A 2ISYA 1JKPC 5FD6A 1IN8A 3CMMA 2M9HA 5AIQA 4JYKA 3TEDA 4NDWA 2AXLA 3E7LA 1E3PA 1USSA 2P6SA 1SD7A 4MEYF 4PCQA 3HOTA 1ZRCA 2V6EA 2X4HA 3J81K 2ZMEA 3WTUC 1YTYA 3DNVB 1T0FA 4CZCA 3OWQA 4EM2A 4IQJA 3EYIA 1W4MA 2F5EA 3SDBA 1POUA 4DBRA 3K4CA 2OQGA 3TW7A 3VEPA 2CV1A 3AG4H 2PJRB 2PXUA 2ECBA 2FX0A 1G8XA 2L7FP 2ZFWA 3P9CA 4TV7A 3G2BA 3R61A 2PMUA 3AAFA 1MMGA 1W7PB 3UNGC 1YSEA 1FSEA 1I3QJ 2CUZA 2EZLA 5D5WB 1E3HA 2R5YA 4A5MA 4MEXF 1Y8RB 1PP8F 4XICA 3CO7C 4A3KJ 2VQCA 2WAFA 3OIPA 3WTTC 2R7XA 3EUSA 1R5HA 1ZHFA 1AHDP 1WJ5A 3SYTA 3HGGA 2QQ9A 3TDZC 3ZMSA 2IV1A 1AA7A 2WV0A 2WADA 4O5VA 3JRFA 2YR2A 2LYQA 4HZFA 1DWKA 1GUUA 3KPHA 3NXHA 1XPXA 4YFNF 1ETYA 2WC2A 3W2AA 2Y0SA 3LSPA 4AD9A 2VKHA 2HS5A 1HSTA 5CKTA 1IN5A 4CO8A 2XHKA 3ULQB 2HWVA 1E3OC 4ETSA 2DU9A 4A3FJ 1MDMA 2D5VA 1ZZ8A 1OISA 3GUDA 1S3JA 1TQPA 1W7PD 2ZMEC 2Q0OA 4ZDLA 4AIHA 2HTJA 1RZRD 3NDBB 4CA0A 2L7ZA 1VF9A 3U21A 2P5LC 1PP7U 1UFMA 1ZG1A 2DCEA 2PN6A 4KN4X 2QQAA 4E7KA 5BPDA 2Z3YA 3H3VK 1R6RA 4HOBA 2JVLA 1YITI 2XB0X 1XGSA 2LYRA 3GLLA 3OR1C 3ZR8X 1H88C 2DMNA 3GFJA 1ZLKA 2O8XA 4A3GJ 3B02A 2PEXA 2QQBA 1Q1HA 3KX2A 4Y15A 4A3MJ 4L9NA 1B72B 2BY2A 3BTIA 4EVIA 3ASOH 4P9FA 3RTRA 4W97A 3E6DA 2RQPA 4LOCA 2JQEA 1ZZBA 3MKYB 3RZOJ 3BPVA 4RGSA 3HUGA 5GTIC 2HXIA 4LLGF 4NQWB 4I6ZA 2XXAA 4OMYA 3DBRB 4ZYEA 3ZQHA 2WB1N 2OCEA 1V55H 2Y69H 4QPOA 3HOSA 2UZKA 4ANJA 5ILSA 3OYDA 1QP7A 1SANA 3KE2A 3OWTA 4BXUA 5EG0A 1WH8A 2R92J 1I6HJ 1ZLJA 4M3DA 1IDYA 2L9VA 4R1HA 1EH6A 2PXBA 4XM3A 2XI8A 3BS3A 4Q4ZF 3S2HJ 2LY9A 3K9TA 3MKLA 2IXSA 3GFMA 3PUFA 3D5RC 2KP6A 4H4KC 2K4JA 1UJ8A 2NVYJ 2XKPA 2A05A 1P7JA 3LWFA 5ILUA 3G1OA 3RYRA 3ZHMA 2PXPA 5BPIA 5D8LB 2PPXA 2K27A 2MLKA 3TMOA 2OU2A 1VQOI 2FMLA 2H09A 3N05A 1VTNC 4BY7J 5DDGA 1XGOA 2MC4A 2LY1A 1XMAA 5FGMA 2H8WA 3BCBA 5F08A 3MLFA 1K83J 2BBYA 1T39A 5A7LA 3K4JA 1Z0XA 2PMHA 2RC4A 5ICEA 3RKWA 5D5UB 1XSDA 1TQMA 5D6FA 3W2WA 1UXCA 4PK4A 4XK4A 1ETWA 3COAC 3H5TA 5J8CA 3I5UA 3CROL 2HOTA 1R5GA 1WVRA 1ZQ3P 4GDFA 2O3FA 5LGNA 5DUIA 1BR1A 3LNQA 2HQAA 2A3SA 2P4WA 5GTHC 2B5AA 3M1CA 3GN5B 1B6AA 1QPIA 2F48A 2P6TA 1OPCA 2VQHA 1VQ9I 5E3LA 2H6BA 3TP0A 1XWRA 2E1MC 3I58A 4RDUA 5FFZA 4XL9A 2ZXWH 4Z2YA 4IA8A 2N8GA 1R22A 2JJ7A 4DYCA 3L2WA 1WETA 3GYHX 1ADRA 4GYGA 2A5WA 4HDUA 4M6XA 1IN4A 2O6GE 1ONVA 2DMTA 3I59A 3LOCA 4DGWB 4N9HA 3I4NJ 1ETVA 4L0YB 2KPJA 2R3SA 2EBIA 1W36C 4LD5A 3CQZJ 2Y9YA 3S2WA 3W3CA 5K7HA 4E70A 1MBFA 4CYDA 1TWGJ 3HOXJ 1B4AA 2M4HA 1W5CC 4GXOA 4JX6A 1VQNI 1BBYA 2L54A 3BR0A 4CGZA 2OCCH 4BYYA 2HKXA 2KDOA 1BC7C 2K86A 3C18A 2XAJA 3GUUA 2Z1DA 4IRGA 3KJXA 3L2UA 3CCEI 1AWCA 3MQ0A 1MNMC 1F4KA 3NZLA 4ZZDA 3EETA 3CCJI 2GAUA 2QF7A 3QOEA 2CQXA 1SVOA 1WGXA 3D1NI 5IT3A 4BBSJ 1J0RA 2B9SA 2P5VA 1W0TA 1APLC 1HW2A 3PL8A 5F0HA 1STZA 4NQWA 2NVXJ 2L7KA 3BR2A 1Z9CA 2HFZA 2LLKA 5B1AH 1HDDC 2MA3A 1XGMA 4MLOA 5FLVA 2RV8A 3ZMVA 4JCXA 1R36A 2M8EA 3S32A 3OS1A 3JSOA 3CCMI 1HBXG 2EIJH 3IVPA 2HGCA 2EZKA 1YLFA 3RJPA 4LG0A 1EH8A 1AKHA 3DKWA 4A3JJ 1ZRDA 5FRMA 3ZP5A 4NC7A 1R9TJ 3CDLA 2EA4A 1IDZA 1JTYA 3VB2A 4A5NA 4EMSA 2QCOA 3PJRA 1D8JA 2XF6A 2DDBA 2XC7A 3K4BA 2W24A 3BG5A 1FSHA 1U0JA 1ZAOA 3G5GA 2F5VA 1O7LA 1PUFB 2ESHA 1LFBA 1OQYA 2RNGA 2XAFA 3QU6A 1OCOH 3T5XA 3EDPA 2KLOA 2OBPA 2BZTA 2GXBA 5EDNA 3DCFA 3LQQA 2OUMA 4EZIA 5JHFA 1DU0A 3GZCA 3V8LA 2VJ5A 2L02A 1QVTA 1IZ1A 1NH3A 1UG2A 3IC7A 3BJ6A 3S16J 4XMYA 5GP9A 5LRRA 2OZUA 2EFOA 2R0QC 1RKTA 4IZZA 1FLIA 2JTVA 2CSFA 1E2XA 5HODA 1FC3A 1IG7A 4BXFA 2PUCA 1B59A 4PSXA 5EEGA 1BR4A 3DP7A 3HTSB 3I54A 3Q9VA 2O8KA 4IOAF 1U9NA 2OQRA 2A69F 1FJLA 4QTRA 4WK8F 3GXOA 1EH7A 2IEKA 3OS0A 4AU7A 2JUGA 5L3DA 3FBIB 3SR4A 1MMSA 1T6SA 5J1UA 3GLXA 3VYRB 2VI6A 5BNGA 4BACA 3A01A 1U8RA 4S0HB 2QSGX 3IL2A 3JRCA 1SAXA 4WWCA 1TWAJ 1S7OA 3JAMK 1FTZA 3HSEA 4EV0A 2MXDA 2EZIA 3WTZA 3F6OA 2FEZA 2ECCA 2CSOA 2R7OA 4RAZA 5F0CA 5ICFA 4IJAA 2V7FA 1WJAA 4X4IA 2V26A 2MW8A 3K1MA 2H8RA 2LYKA 4XKVA 3ZN0A 1WZ2A 1MJBA 1LUJB 3ME5A 3OOPA 1GXPA 3HHGA 1FOXA 4PZJA 1R69A 2AWIA 5E1XA 3GTQJ 1UXDA 1E17A 2L3DA 2CWEA 1V3FA 2NXNB 3MCZA 4Z6YA 4RS8A 2PBIA 5F1JA 4XLCA 4LG3A 1ERDA 1ZS4A 3U1KA 4A0ZA 3B7HA 3LA2A 3BT9A 3MD2A 1VQ4I 2VBXA 3F8MA 4BJ5C 4M74A 2FOKA 2OZ6A 2K9NA 2V9VA 4YG1A 3CLOA 3M4OJ 1ON2A 3QYXA 2YUSA 1W1WE 3ZRGA 3P9KA 1RI7A 2W85A 3OYHA 1IRGA 4A93J 3QYEA 3WE3A 3CF5F 1H9GA 3HSRA 3OR2C 2XVCA 1IRZA 3FF5A 3CCUI 3CMEI 3S1QJ 3F8CA 3NWSA 3LSKA 5JR3A 1S8NA 2DA1A 3HIFA 4XORA 3K69A 1FOYA 1YJWI 2K40A 3FXOA 2KL4A 1SC7A 4AYBN 4Z58A 1MGTA 1YFHA 4EJVA 2E19A 4DBQA 5K5OA 1S5LC 2X6YA 5LEJA 1B1BA 1JKQC 1UB9A 2DXIA 2IA2A 1K79A 4U0VA 1J9IA 2WIUB 3ZQCA 2X1EA 3BOQA 3CCYA 1BOAA 2F4IA 1ZYRF 1X4PA 1X3WB 4YEJA 4RB0A 3G0TA 4C3HJ 1RNLA 4LIUA 5IP6A 3NARA 4KIFA 5DT2A 1FWZA 4MFDA 1TZLA 3HZJA 1O3SA 1AOYA 3QYFA 4OAYA 3RZDJ 3EUAA 3MN2A 5FB2A 2EINH 2Y2ZA 3RDIA 2E7WA 3ZGKA 5D5VB 2CS3A 2DFEA 2Q2EB 4D9JA 3H1CA 5ED4A 3IHUA 2GZUA 4HAMA 5J3LA 5BOXA 3JRAA 2A6TA 1QRYA 1ZN2A 4RB1A 3WTYC 1JKOC 5F04A 3O2PE 4M3EA 3NROA 1POGA 2RNJA 1VQPI 1YI2I 1QP4A 2RREA 2DTRA 3L2RA 3LMMA 4P9UA 1MMNA 4RLFA 2EILH 4BGDA 1EFAA 3GFLA 1N77A 2XAHA 2YU3A 4ENMA 3W6JB 1W5SA 3PO3J 3LSIA 2DA4A 2K7LA 5J1RA 3S1NJ 2ZBKA 2GBYA 2KHMA 4M9SA 3K4MA 3WTWC 2W82A 1LVAA 1XTAA 3CCLI 2P0WA 1S29A 3F8FA 3LA3A 3R6SA 3J7AO 2FJRA 2GRLA 3KYLA 4DOZA 5HNHA 4ZTFA 2V1UA 3BQYA 3ERED 2V1XA 1QZEA 2KRFA 1X1BA 2FFHA 3BZCA 4IVZA 4CICA 3BTLA 3KZ3A 5LEKA 3OP9A 2HU9A 5FKKA 4BUPA 3QPTA 2EV6A 5LRSA 1Y1VJ 2F4MB 4ASNA 1FY7A 2L1PA 2LG4A 2Q1ZB 3SZPA 2AQEA 1B72A 1K78A 3I53A 5GAHJ 2K9LA 3FK7A 4CXFA 1PDNC 1XG1A 2M45A 3FBNB 2CGPA 2PUGA 2BNMA 2MD0A 4YG2F 4AIDA 5J4YA 2WUSR 4J1XA 4BEHA 3SDGA 2VUMJ 2X51A 5L3BA 4A3EJ 1IUFA 5LHIA 3L00A 2COMA 1KONA 1BC8C 5DV5A 2NNNA 4XRMA 3GO5A 5DD4A 1UMQA 4PJJA 1O3TA 3ISPA 3FYMA 2IJLA 4L5JA 5IPAA 1LE8B 1PUFA 1A36A 4YFKF 2XV4S 4P1WA 2E5NA 2VKEA 3G4SI 3DU5A 3BR6A 4XKBA 4PU7A 4A0YA 2BY1A 2WB1A 2ETHA 5M5YJ 4C9YA 3F21A 2DA5A 2KFDA 2EF8A 4FASD 4ESBA 4L5EA 4A0XA 2B0LA 3BR5A 4CUGA 1ZREA 2L2OA 3H36A 3QWGA 2CUJA 4G7OF 1RPEL 1FX7A 4X0GA 1MBJA 3U1DA 2HVSA 1DPRA 2XASA 3ZQFA 2V79A 1DQUA 3FXMA 4UVAA 4NHJA 1YG2A 4EATA 2OV7A 1KZHA 4MQVA 2K9MA 4PJ0C 1H0MA 1U3EM 2BVLA 1N75A 4NBQA 1D8KA 2HSGA 4F8DA 5M3FJ 1IXCA 3TQNA 3UWPA 3AFHA 3I56I 2X1CA 4NB5A 3GTLJ 3C3WA 1JUSA 1YE9A 4FX0A 3BD1A 2F6CA 4MO7A 4YRVA 1U78A 1F36A 2PUBA 3OYEA 2FUG2 1WJDA 2VJJA 2V1NA 3DLAA 4A3IJ 1F1ZA 1ZGJA 1NG6A 2LNBA 3MKWB 4RGXA 2LMDA 4BQOA 1IGNA 2CV2A 3G3ZA 4XSZF 2O4AA 2IVGA 3EUHA 2WWYA 4W1UA 2E2HJ 2VKDA 1O4XA 5CVVA 3HXLA 2DQRA 3ABUA 4KFCA 2QVOA 3E6MA 3L2VA 1RPWA 2CYYA 4MFEA 2NOGA 4BH9A 1RIOH 4D5FA 4BQAA 1R1TA 5L3FA 2IVQA 2EB7A 4LK1F 2VBWA 4BU2A 4M9XA 4D7NA 2JK3A 2XROA 1AU7A 1IXSB 3S2DJ 5FLMJ 2XGCA 4M72A 3WHCA 1FIPA 3QPHA 3GBGA 2J7UA 2HKOA 2QBYA 1I50J 3QP5A 3KETA 4AVZA 2NS0A 1T95A 2JVGA 3OYMA 4EQZA 3OQOA 3EQLF 1QQIA 4X4HA 4BJTA 5DCMB 1RR7A 3VDXA 2O38A 1PNRA 2COBA 4MGRA 2QM3A 3HRUA 2XAUA 2JA5J 3S1MJ 1RZRA 2OAZA 2DJNA 3JR9A 4ZYDA 1L3LA 2MYSA 4O6JA 4BY1J 4L9JA 4RA2A 1PJRA 1YIJI 2J7WA 3H0GJ 1YHQI 3RIRA 1QNTA 2ZMEB 4EGZA 3PM1A 3PFIA 1RUOA 1K78B 1ORKA 1J7KA 1ZR4A 2WAEA 2Y30A 3U2RA 2FF4A 1GHCA 4XRSA 2BYVE 2CFXA 4BE0A 4RM3A 1X2MA 3H35A 2CRGA 3GWZA 2M0CA 3BPXA 3MZYA 4G6TB 2G7UA 2M1BA 2M7BA 3AKZA 3FXLA 3S3MA 1DULA 1U2WA 1QZXA 3ZQGA 4U7DA 1UHWA 3WG7H 2K4BA 3R60A 4GFBA 3JSPA 1OCPA 3FMSA 5E8GA 2LBFA 2UV1A 4KUMA 2XIUA 1D1CA 1RKWA 5DTMA 3KP4A 5EEHA 2HINA 2VC1A 3VODA 3WG9A 2VOPA 3K6GA 5F0FA 4UVCA 3K4KA 5FKOA 2GXAA 1VI0A 2F5DA 2NS7A 2R7WA 4UUVA 2NVTJ 1LEAA 5HS9A 2L4MA 3H3UA 2LSOA 4GCVA 4UXNA 5CPRB 4P96A 3QWLA 1TL8A 2EZHA 2LKPA 2GQQA 2E5ZA 3JRHA 2DMQA 1LQ1A 3O9XA 3LA7A 2HOAA 3TBIA 4BHBA 5E3MA 4NC6A 1OCTC 4G8XA 4FE7A 2FA5A 3UFDA 2K02A 5F1RA 1S72I 2ICPA 1U5TB 2PI0A 4KDPA 3E5QA 5LD2C 1JWLA 1YX5A 3PIOF 2BXYA 4EJUA 2QQ8A 4HNUA 4KYWA 1X58A 1I1GA 1P4WA 1NEQA 1FNNA 1FOWA 3H5NA 3I4MJ 2LLVA 4PJLA 4XR6A 1SD6A 3O6BB 1YS7A 4E7JA 4ITVA 4XLEA 3GZ5A 4N4OB 2R7FA 1Y6IA 3MKZA 4R79A 1JFTA 3L7WA 1IN7A 2ZSIB 3TOBA 3O3KA 1GXQA 2XB5A 1P6RA 2AW6A 3CF2A 2G9WA 5DYMA 2DW4A 5GAEJ 4M71A 1UG0A 2ME0A 3BG7A 4EKGA 3I9V2 2MABA 2PMZN 1Q1VA 4DNCA 1MIJA 4OAZA 1H89C 2ZXIA 2F2EA 2KRHA 2R7TA 4YIFA 4ZDOA 2KIFA 4EJOA 2NOJB 1MJ9A 4HX8A 1BW6A 1WH6A 4MIMA 2DK5A 4NNJA 3QYBA 4P5OA 3CJTB 4IX7A 1ON1A 2HCNA 1BDIA 4CCMA 2EWNA 4AWXB 1J09A 1CGPA 1YQAA 4B44A 2CH0A 3ZQLA 1ACIA 1IV8A 2ZJPF 1OCCH 1ZR2A 2A6HF 2FMYA 2ADUA 4J01A 1IV6A 2DK8A 1T08B 3QQAA 3HL2A 2XIGA 2D45A 1RIOA 1TNSA 4HEA2 1HKQA 2DQLA 4AIKA 4XN3A 3ML6A 4U7BA 5DRYA 4U0WA 2BNOA 3QOWA 3HC7A 1V5GA 2XAQA 1NTCA 2IP2A 2AXTC 5HDGA 4CCKA 1R71A 3L2CA 4E7IA 3GTGJ 3BZKA 1ENHA 1OLTA 4HLYA 5D4RA 3QF3A 1T38A 5CQEA 1NK2P 1D3YA 3LSRA 2E1NA 4XKWA 2JN6A 1IRXA 1O3RA 2HDCA 4PU4C 3HKZA 5IYDJ 4E4HA 4Q5SF 1EF4A 5DTDA 3JRBA 3SX0A 3H9JA 5DEQA 2M2EA 3R09A 3S93A 4U87A 2LYCA 4XLNF 3L09A 1QZYA 1RRJA 2VC0A 3RPUA 1MMDA 1WWXA 1SEUA 1WCMJ 3FXUA 2LBFB 3CUOA 1JT6A 2H1LA 4ZYAA 2CW7A 5JI6A 3BZ6A 1TW3A 5EG0B 2VQLA 5TGTA 5GAHi 1PYVA 2ID3A 1BW5A 2VEOA 1LEBA 3BG9A 2DDAA 2MC3A 2VLAA 2HDDA 1JHFA 3F23A 2NVQJ 3CD6I 2O49A 4RMNA 2VOOA 1TP4A 2E1MB 1NHAA 4YIIA 4MHGA 2KPMA 3OOUA 4Q2JA 2DFIA 2LREA 4IF4A 4Q47A 2Z33A 2JA7J 3PQKA 4JCYA 4XLHA 5M5WJ 1PRVA 2X0LA 5C44J 5EGOB 3BG3A 1QVUA 2DLLA 4JBAA 3M7GA 3TDUC 4FTHA 3TFLA 3SZGA 1BM9A 1X3UA 2BW3A 2LD5A 4HF0A 2KEKA 4E7HA 1SFOJ 5H20A 5DD8A 2X6XA 4A3LJ 3F6VA 4QIWN 1ZELA 4OU0A 4C30A 1KU2A 2IS4A 5DM7F 5FLXK 4OIRF 3DF8A 2QLZA 4Y42A 2FU4A 2BEOA 1BIAA 3B6CA 2DT7B 3CP2A 4BE1A 3RQIA 3M8JA 4I99C 2R5ZA 2DOAA 5HS7A 1PVEA 3LISA 1MSEC 3PXPA 1FBQA 2ZO4A 3M9LA 4NC8A 4HDVA 2GIVA 3K10A 4LG0B 2M34A 2RAEA 1MJAA 1MW7A 4RAFA 4UVBA 1EA3A 4DZPA 4E6KG 1NK3P 4HF1A 3HB9A 3DPLC 2HVRA 4I6TA 2FE3A 4B8XA 3S15J 3P7NA 1WRJA 4EM0B 3DQVC 3M9AA 3QODA 4IL6C 1V5FA 5L3CA 2GOXB 2HZTA 1BI3A 4PUSA 3T1BA 3LFPA 1TBXA 5B5EC 4FQGA 1XCVA 5EZHA 1EKEA 3ZMDA 2DOFA 3J7ZI 2VJIA 4WXCA 2VB6A 5D8KB 2E71A 4BQQA 1HF0A 1Y1WJ 1M1EB 3SZTA 1DU6A 5FKMA 4YARA 5KCMA 5E3NA 2Z5UA 1PRAA 3Q0WA 2KZVA 4A3CJ 1UZCA 1CF7B 4WF2A 1JT0A 4CCLA 3OYLA 5HLIA 4HX4A 1HLVA 3I71A 1HW5A 2QYOA 1HC8A 1RESA 4FCYA 3S17J 1FBSA 3E0JB 1RZSA 2QSFX 2VN2A 5E8IA 2XAGA 3BR3A 5H2FC 2DTZA 2GIZA 4XONA 5DUKA 2XGXA 4KT5C 2K5CA 1JJ8C 1VQ6I
chains in the Genus database with same CATH topology
3QPLA 3JRAA 2KZ8A 1QRYA 2MGQA 1JKOC 2HOSA 5F04A 2LP0A 4M3EA 4C3JJ 4CYCB 4ABZA 1POGA 2B63J 1QP4A 1WIZA 1BDHA 3IV5A 1TWHJ 2O7OA 4YBAA 1VFCA 4M3GA 1EFAA 5FJ8J 1FTTA 1MBGA 5IOYA 3SCFA 3SFIA 2E2IJ 3GTMJ 3SCGA 3TW6A 2JWTA 1JTXA 1ZZ6A 3RZZA 3KXAA 3HBLA 3MVPA 2L9RA 2DA4A 4JX5A 5J1RA 3S1RJ 3PO3J 3S1NJ 2GBYA 2GRMA 2CUFA 1CQTA 4JX4A 1OFCX 2CJJA 2GRLA 1DW9A 2EH3A 2FJRA 1JKRC 1ZZ7A 2MSYA 2KT0A 3BQYA 2MG4A 1Z77A 1RETA 2Y31A 1JKPC 4D5CA 4IVZA 2M9HA 3BTLA 3KZ3A 3OP9A 3ZKCA 3LSGA 4C3IJ 5FKKA 1MBHA 4JYKA 3TEDA 4NDWA 1Y1VJ 3W6VA 3E7LA 2XPWA 1JUMA 2AO9A 1B72A 1CJGA 3Q0UA 4X4EA 1ETKA 2IVBA 3DNVB 4M3BA 1ZZCA 2OPTA 3FK7A 2AHQA 5IYCJ 1XG1A 3JRIA 2PUGA 2BNMA 2WUSR 1POUA 1Y7YA 4J1XA 2X6OA 3K7AJ 3TW7A 2VUMJ 3SDGA 3BDNA 2ECBA 1MH3A 2FX0A 1L1MA 2L7FP 4A3EJ 1IUFA 3Q0VA 2ZB9A 5IP7J 4XRMA 1UMQA 1YSEA 3SCHA 1I3QJ 3FYMA 5C4XJ 2EZLA 5IPAA 1LE8B 2R5YA 1PUFA 3OIOA 2FD5A 3SJMA 2VKEA 3HKZN 3OMTA 1FIAA 3BR6A 4A3BJ 3ZHIA 4XICA 1AKHB 2OFYA 4A3KJ 3RKQA 4PU7A 3EUSA 5C4JJ 5M5YJ 1AHDP 3PO2J 2MQKA 5M5XJ 3HGGA 2DA5A 2EF8A 4Z59A 2IV1A 4L5EA 3JRFA 3BR5A 2LYQA 3QWGA 1DWKA 1GUUA 1RPEL 4JP0A 1MBJA 1ETYA 3ZQFA 3OSFA 3LSPA 4PU3C 1JGGA 1LCDA 2JA6J 4B3AA 2HSGA 4F8DA 5M3FJ 4YG4A 1E3OC 2D5VA 1ZZ8A 4A3FJ 3FYAA 3GTLJ 1RZRD 1JUSA 2L7ZA 3BD1A 1VF9A 4MO7A 4BBRJ 1U78A 4Y7NJ 1F36A 2TCTA 2PUBA 1WH5A 3CLCA 3ZOBA 2KEIA 1U9OA 5GPCA 4A3IJ 5JLXA 3H3VK 3GN5A 2JVLA 4Z5DA 2LTPA 4OB4A 2XB0X 4QSHA 2LYRA 2XCJA 2LYSA 1IGNA 1QQAA 1H88C 2DMNA 4A3GJ 3BQZA 2O4AA 1ITYA 2IVGA 3A03A 4A3MJ 1JH9A 4IHXA 4W1UA 3IH3A 2E2HJ 1O4XA 1B72B 3BTIA 2XGDA 3Q3SA 2K9SA 5EF6A 1MSFC 4W97A 2XJ3A 2CU7A 2ME6A 2DA3A 2YU9J 1X57A 4FBIA 1RPWA 4LOCA 4MFEA 2NOGA 1ZZBA 1G2HA 3RZOJ 2NS8A 1JFSA 2X9DA 4D5FA 5J1YA 4GQMA 2IVQA 4D7NA 2HXIA 4Z5CA 4DZJA 1MBEA 1XC5A 2JK3A 3A01B 2MEZA 3JREA 4I6ZA 1JUPA 3TP3A 1AU7A 4D7MA 3S2DJ 1T56A 5FLMJ 2XGCA 3WHCA 2WB1N 1FIPA 3ZQHA 3GBGA 1QQBA 1QP7A 1I50J 1B8IB 1SANA 5EG0A 3HOWJ 1WH8A 3OQOA 2R92J 2LYLA 1I6HJ 4X4HA 4M3DA 2IU7A 4B1RA 1IDYA 1RR7A 4CYCA 2O38A 1B8IA 2COBA 2JA5J 3S1MJ 2JCGA 2R1JL 1RZRA 1PNRA 2XI8A 3BS3A 1HDPA 3S2HJ 2LY9A 1ZVVA 1K61A 2DJNA 3JR9A 3MKLA 2HQ5A 1U8BA 4BY1J 1LQCA 2NVYJ 3H0GJ 1P7JA 2IAIA 3G1OA 1VPWA 3ZHMA 3PM1A 1ORKA 2PPXA 5FKLA 1ZR4A 2Y30A 4BY7J 1T33A 2EQRA 1JJ6C 4XRSA 5F08A 1X2MA 3MLFA 4X4DA 1K83J 5A7LA 4X1EA 1ZTRA 3O9XA 1Z0XA 2CRGA 2M0CA 2VKVA 1UXCA 4X4FA 2KEJA 4XK4A 3H5TA 1ETWA 3ZQGA 1D5YA 2HOTA 3CROL 1ZQ3P 1PERL 3LNQA 4GFBA 2EBYA 1OCPA 2WAQN 2B5AA 3GN5B 2XIUA 1QPIA 2TRTA 1MH4A 3R1FA 1RKWA 4Z5HA 2L0KA 5E3LA 3TP0A 2R93J 1XWRA 4IEJA 4RDUA 1ZUGA 2HINA 2AXVA 2LYJA 2XRLA 4IA8A 1GV5A 2OR1L 2N8GA 1H8AC 2JJ7A 4DYCA 1WETA 5F0FA 5FKOA 1ADRA 3VK0A 3JXDL 4I6RA 5IOZA 1VI0A 2DMTA 3LOCA 2NS7A 2NVTJ 4AC0A 2XPVA 2K9QA 1GV2A 3I4NJ 2EZHA 1ETVA 3GTOJ 3FMYA 2R5ZB 4UUSB 1BL0A 2KPJA 3JRHA 4M6VA 2DMQA 2EBIA 4XIDA 1YRNA 3WHBA 2AXUA 2HOAA 2XGEA 2Y9YA 3CQZJ 1ZGWA 2L7MP 3OQMA 5K7HA 4V2FA 5E3MA 1MBFA 5F27A 1OCTC 2A6CA 4FE7A 1TWGJ 3HOXJ 4X4GA 2R7ZJ 3UFDA 3FISA 2ICPA 4JX6A 4M3FA 3BR0A 1B0NA 1JWLA 1ZAYA 2IUOA 3KJXA 1X58A 1MNMC 2VPRA 1WI3A 3A02A 1NEQA 2QF7A 1F43A 3I4MJ 1UHSA 2CQXA 9ANTA 1WGXA 3FK6A 3D1NI 2IBDA 3G1MA 2JMWA 2L49A 1ETOA 4IWRA 2DA2A 4BBSJ 3S8QA 1APLC 1W0TA 2OF7A 1OJLA 1LLIA 2NVXJ 5F0HA 3FKIJ 3BR2A 2LLKA 1HDDC 4MLOA 1JFTA 5FLVA 1NERA 1VNDA 4Y52J 2YS9A 4JCXA 2XB5A 2AW6A 3F0CA 2ME0A 2P81A 3IVPA 2PMZN 1Q1VA 2AUWA 2EZKA 1MBKA 1ZKGA 3G7DA 3K2AA 1AKHA 4A3JJ 1LMB3 1H89C 1QP0A 1ZK8A 2LKXA 4I76A 1R9TJ 3F52A 3CDLA 1IDZA 4X4BA 1JTYA 3L1PA 1LFUP 2QCOA 2PIJA 1BW6A 1WH6A 4MIMA 1YRNB 3HDDA 2X48A 2E2JJ 3VPRA 3BG5A 3FIWA 1BDIA 2LYPA 3G5GA 2HXOA 3ZQLA 1PUFB 1LFBA 4XRSG 1ZR2A 4I6UA 1IV6A 3GTPJ 2BJCA 2FJ1A 3QQAA 2PUDA 1RIOA 1ZPQA 3HOUJ 2Y9ZA 5EDNA 3DCFA 1TWFJ 4AUXA 2CROA 2BNOA 3DEWA 5E3OA 1DU0A 2L8NA 5IP9J 3QQ6A 1OSLA 1NTCA 1UTXA 1QVTA 3GTKJ 1UG2A 3S16J 3IH4A 5GP9A 1SQ8A 2DMPA 4A3DJ 3GTGJ 2R0QC 1ENHA 5DS9A 1RKTA 3QF3A 5M3MJ 3LSRA 1NK2P 2KDZA 2CSFA 2JN6A 1BJZA 5IYBJ 1IJWC 5HODA 4PU4C 1IG7A 5IYDJ 1EF4A 2R5YB 2PUCA 1ETQA 5DTDA 3JRBA 2M2EA 2DN0A 2O8KA 4UUTA 1U9NA 2DMUA 4GHJA 1WPKA 4B4CA 4X4CA 2LK2A 3F51A 1ETXA 1FJLA 1WCMJ 4QTRA 4FE4A 1JT6A 1LE8A 1TC3C 2IEKA 4HNVA 4J1WA 4IHVA 3NAUA 3OQNA 1GT0C 5EG0B 5J1UA 3O8HA 2VI6A 5BNGA 3A01A 2ID3A 4S0HB 5EGOA 1BW5A 3JRCA 1TWAJ 2XPUA 3BG9A 2HDDA 1FTZA 4EEFG 2BNNA 3C2BA 4NDLA 1HOMA 2GM4A 2NVQJ 2O49A 3OSGA 2EZIA 2LVSA 3GTJJ 3OOUA 5K7ZA 2JA7J 4DYQA 2ECCA 4JCYA 2M8GX 5M5WJ 1PRVA 2O9LA 2ID6A 5C44J 5F0CA 5EGOB 3BG3A 4C2MJ 1LCCA 1QVUA 4V2GA 1Y9QA 4X4IA 2MW8A 4FTHA 2H8RA 4BKXA 2LYKA 3UKGA 2R63A 1HCRA 3HEFA 2LD5A 2KEKA 1R69A 2AWIA 1UXDA 3GTQJ 1SFOJ 3O8GA 2PUAA 4IHYA 4BXXJ 2E1OA 4A3LJ 3HOYJ 3JXCL 4QIWN 1GVDA 5F1JA 1ZS4A 2HI3A 1PRUA 3B7HA 3BT9A 4RBOA 4DW6A 4MCTA 4MCXA 3GBFA 3CECA 4Y42A 2K9NA 2CUEA 2HYJA 3B6CA 4YG1A 4JQDA 2JA8J 3M4OJ 3LSJA 3RQIA 3QYXA 2G0EA 2YUSA 4X6AJ 2PE5A 2R5ZA 5EZGA 2PUEA 4YG7B 3LISA 1MSEC 2CQQA 2DA7A 1W0UA 3PXPA 3U3WA 4A69C 4I8TA 3IH2A 2GLOA 4A93J 2M34A 2RAEA 2XSDC 1TWCJ 1X2NA 4DZPA 1NK3P 3HB9A 1IRZA 2PUFA 5GPAA 2H1KA 4I6TA 4IHWA 1A5JA 3S15J 2WV1A 4FISA 3S1QJ 2ICTA 2DA1A 3HZIB 1WH7A 2K40A 3JRGA 4AYBN 3G1LA 3F6WA 4Z58A 1QPZA 3LFPA 2E19A 3TRBA 5EZHA 4O8BA 4DYRA 3B6AA 1JKQC 3M3YJ 5EYRA 1X2LA 3BTCA 1A6IA 2WIUB 3HM5A 1BA5A 1GDTA 1HF0A 3ZQCA 1IC8A 1Y1WJ 5EEAA 5JLWA 3CCYA 1DU6A 5FKMA 4J19A 3BR1A 3JRDA 3ZQIA 4FN3A 1S7EA 4UUSA 5E3NA 4YARA 4C3HJ 1FEXA 3Q0WA 1PRAA 4A3CJ 2W48A 5IP6A 1JT0A 3NARA 2LR8A 4MFDA 2Y0SN 5FKNA 1XS9A 3JXBC 1HLVA 5J3LA 2AXZA 3HGYA 1RESA 4FCYA 3RZDJ 2ELKA 3S17J 1R63A 3MN2A 5K7FA 2FQ4A 3CMYA 1RZSA 3S14J 2Y2ZA 4PU8A 2EWTA 5C3EJ 3BTJA 3HOVJ 1P7IA 2DA6A 3QPSA 2LFBA 3BR3A 5K98B 4G12A 2DTZA 2LCVA 2GZUA 1ZZ9A 3HOZJ 1JJ8C 2I10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QPL A;  3JRA A;  2KZ8 A;  1QRY A;  2MGQ A;  1JKO C;  2HOS A;  5F04 A;  2LP0 A;  4M3E A;  4C3J J;  4CYC B;  4ABZ A;  1POG A;  2B63 J;  1QP4 A;  1WIZ A;  1BDH A;  3IV5 A;  1TWH J;  2O7O A;  4YBA A;  1VFC A;  4M3G A;  1EFA A;  5FJ8 J;  1FTT A;  1MBG A;  5IOY A;  3SCF A;  3SFI A;  2E2I J;  3GTM J;  3SCG A;  3TW6 A;  2JWT A;  1JTX A;  1ZZ6 A;  3RZZ A;  3KXA A;  3HBL A;  3MVP A;  2L9R A;  2DA4 A;  4JX5 A;  5J1R A;  3S1R J;  3PO3 J;  3S1N J;  2GBY A;  2GRM A;  2CUF A;  1CQT A;  4JX4 A;  1OFC X;  2CJJ A;  2GRL A;  1DW9 A;  2EH3 A;  2FJR A;  1JKR C;  1ZZ7 A;  2MSY A;  2KT0 A;  3BQY A;  2MG4 A;  1Z77 A;  1RET A;  2Y31 A;  1JKP C;  4D5C A;  4IVZ A;  2M9H A;  3BTL A;  3KZ3 A;  3OP9 A;  3ZKC A;  3LSG A;  4C3I J;  5FKK A;  1MBH A;  4JYK A;  3TED A;  4NDW A;  1Y1V J;  3W6V A;  3E7L A;  2XPW A;  1JUM A;  2AO9 A;  1B72 A;  1CJG A;  3Q0U A;  4X4E A;  1ETK A;  2IVB A;  3DNV B;  4M3B A;  1ZZC A;  2OPT A;  3FK7 A;  2AHQ A;  5IYC J;  1XG1 A;  3JRI A;  2PUG A;  2BNM A;  2WUS R;  1POU A;  1Y7Y A;  4J1X A;  2X6O A;  3K7A J;  3TW7 A;  2VUM J;  3SDG A;  3BDN A;  2ECB A;  1MH3 A;  2FX0 A;  1L1M A;  2L7F P;  4A3E J;  1IUF A;  3Q0V A;  2ZB9 A;  5IP7 J;  4XRM A;  1UMQ A;  1YSE A;  3SCH A;  1I3Q J;  3FYM A;  5C4X J;  2EZL A;  5IPA A;  1LE8 B;  2R5Y A;  1PUF A;  3OIO A;  2FD5 A;  3SJM A;  2VKE A;  3HKZ N;  3OMT A;  1FIA A;  3BR6 A;  4A3B J;  3ZHI A;  4XIC A;  1AKH B;  2OFY A;  4A3K J;  3RKQ A;  4PU7 A;  3EUS A;  5C4J J;  5M5Y J;  1AHD P;  3PO2 J;  2MQK A;  5M5X J;  3HGG A;  2DA5 A;  2EF8 A;  4Z59 A;  2IV1 A;  4L5E A;  3JRF A;  3BR5 A;  2LYQ A;  3QWG A;  1DWK A;  1GUU A;  1RPE L;  4JP0 A;  1MBJ A;  1ETY A;  3ZQF A;  3OSF A;  3LSP A;  4PU3 C;  1JGG A;  1LCD A;  2JA6 J;  4B3A A;  2HSG A;  4F8D A;  5M3F J;  4YG4 A;  1E3O C;  2D5V A;  1ZZ8 A;  4A3F J;  3FYA A;  3GTL J;  1RZR D;  1JUS A;  2L7Z A;  3BD1 A;  1VF9 A;  4MO7 A;  4BBR J;  1U78 A;  4Y7N J;  1F36 A;  2TCT A;  2PUB A;  1WH5 A;  3CLC A;  3ZOB A;  2KEI A;  1U9O A;  5GPC A;  4A3I J;  5JLX A;  3H3V K;  3GN5 A;  2JVL A;  4Z5D A;  2LTP A;  4OB4 A;  2XB0 X;  4QSH A;  2LYR A;  2XCJ A;  2LYS A;  1IGN A;  1QQA A;  1H88 C;  2DMN A;  4A3G J;  3BQZ A;  2O4A A;  1ITY A;  2IVG A;  3A03 A;  4A3M J;  1JH9 A;  4IHX A;  4W1U A;  3IH3 A;  2E2H J;  1O4X A;  1B72 B;  3BTI A;  2XGD A;  3Q3S A;  2K9S A;  5EF6 A;  1MSF C;  4W97 A;  2XJ3 A;  2CU7 A;  2ME6 A;  2DA3 A;  2YU9 J;  1X57 A;  4FBI A;  1RPW A;  4LOC A;  4MFE A;  2NOG A;  1ZZB A;  1G2H A;  3RZO J;  2NS8 A;  1JFS A;  2X9D A;  4D5F A;  5J1Y A;  4GQM A;  2IVQ A;  4D7N A;  2HXI A;  4Z5C A;  4DZJ A;  1MBE A;  1XC5 A;  2JK3 A;  3A01 B;  2MEZ A;  3JRE A;  4I6Z A;  1JUP A;  3TP3 A;  1AU7 A;  4D7M A;  3S2D J;  1T56 A;  5FLM J;  2XGC A;  3WHC A;  2WB1 N;  1FIP A;  3ZQH A;  3GBG A;  1QQB A;  1QP7 A;  1I50 J;  1B8I B;  1SAN A;  5EG0 A;  3HOW J;  1WH8 A;  3OQO A;  2R92 J;  2LYL A;  1I6H J;  4X4H A;  4M3D A;  2IU7 A;  4B1R A;  1IDY A;  1RR7 A;  4CYC A;  2O38 A;  1B8I A;  2COB A;  2JA5 J;  3S1M J;  2JCG A;  2R1J L;  1RZR A;  1PNR A;  2XI8 A;  3BS3 A;  1HDP A;  3S2H J;  2LY9 A;  1ZVV A;  1K61 A;  2DJN A;  3JR9 A;  3MKL A;  2HQ5 A;  1U8B A;  4BY1 J;  1LQC A;  2NVY J;  3H0G J;  1P7J A;  2IAI A;  3G1O A;  1VPW A;  3ZHM A;  3PM1 A;  1ORK A;  2PPX A;  5FKL A;  1ZR4 A;  2Y30 A;  4BY7 J;  1T33 A;  2EQR A;  1JJ6 C;  4XRS A;  5F08 A;  1X2M A;  3MLF A;  4X4D A;  1K83 J;  5A7L A;  4X1E A;  1ZTR A;  3O9X A;  1Z0X A;  2CRG A;  2M0C A;  2VKV A;  1UXC A;  4X4F A;  2KEJ A;  4XK4 A;  3H5T A;  1ETW A;  3ZQG A;  1D5Y A;  2HOT A;  3CRO L;  1ZQ3 P;  1PER L;  3LNQ A;  4GFB A;  2EBY A;  1OCP A;  2WAQ N;  2B5A A;  3GN5 B;  2XIU A;  1QPI A;  2TRT A;  1MH4 A;  3R1F A;  1RKW A;  4Z5H A;  2L0K A;  5E3L A;  3TP0 A;  2R93 J;  1XWR A;  4IEJ A;  4RDU A;  1ZUG A;  2HIN A;  2AXV A;  2LYJ A;  2XRL A;  4IA8 A;  1GV5 A;  2OR1 L;  2N8G A;  1H8A C;  2JJ7 A;  4DYC A;  1WET A;  5F0F A;  5FKO A;  1ADR A;  3VK0 A;  3JXD L;  4I6R A;  5IOZ A;  1VI0 A;  2DMT A;  3LOC A;  2NS7 A;  2NVT J;  4AC0 A;  2XPV A;  2K9Q A;  1GV2 A;  3I4N J;  2EZH A;  1ETV A;  3GTO J;  3FMY A;  2R5Z B;  4UUS B;  1BL0 A;  2KPJ A;  3JRH A;  4M6V A;  2DMQ A;  2EBI A;  4XID A;  1YRN A;  3WHB A;  2AXU A;  2HOA A;  2XGE A;  2Y9Y A;  3CQZ J;  1ZGW A;  2L7M P;  3OQM A;  5K7H A;  4V2F A;  5E3M A;  1MBF A;  5F27 A;  1OCT C;  2A6C A;  4FE7 A;  1TWG J;  3HOX J;  4X4G A;  2R7Z J;  3UFD A;  3FIS A;  2ICP A;  4JX6 A;  4M3F A;  3BR0 A;  1B0N A;  1JWL A;  1ZAY A;  2IUO A;  3KJX A;  1X58 A;  1MNM C;  2VPR A;  1WI3 A;  3A02 A;  1NEQ A;  2QF7 A;  1F43 A;  3I4M J;  1UHS A;  2CQX A;  9ANT A;  1WGX A;  3FK6 A;  3D1N I;  2IBD A;  3G1M A;  2JMW A;  2L49 A;  1ETO A;  4IWR A;  2DA2 A;  4BBS J;  3S8Q A;  1APL C;  1W0T A;  2OF7 A;  1OJL A;  1LLI A;  2NVX J;  5F0H A;  3FKI J;  3BR2 A;  2LLK A;  1HDD C;  4MLO A;  1JFT A;  5FLV A;  1NER A;  1VND A;  4Y52 J;  2YS9 A;  4JCX A;  2XB5 A;  2AW6 A;  3F0C A;  2ME0 A;  2P81 A;  3IVP A;  2PMZ N;  1Q1V A;  2AUW A;  2EZK A;  1MBK A;  1ZKG A;  3G7D A;  3K2A A;  1AKH A;  4A3J J;  1LMB 3;  1H89 C;  1QP0 A;  1ZK8 A;  2LKX A;  4I76 A;  1R9T J;  3F52 A;  3CDL A;  1IDZ A;  4X4B A;  1JTY A;  3L1P A;  1LFU P;  2QCO A;  2PIJ A;  1BW6 A;  1WH6 A;  4MIM A;  1YRN B;  3HDD A;  2X48 A;  2E2J J;  3VPR A;  3BG5 A;  3FIW A;  1BDI A;  2LYP A;  3G5G A;  2HXO A;  3ZQL A;  1PUF B;  1LFB A;  4XRS G;  1ZR2 A;  4I6U A;  1IV6 A;  3GTP J;  2BJC A;  2FJ1 A;  3QQA A;  2PUD A;  1RIO A;  1ZPQ A;  3HOU J;  2Y9Z A;  5EDN A;  3DCF A;  1TWF J;  4AUX A;  2CRO A;  2BNO A;  3DEW A;  5E3O A;  1DU0 A;  2L8N A;  5IP9 J;  3QQ6 A;  1OSL A;  1NTC A;  1UTX A;  1QVT A;  3GTK J;  1UG2 A;  3S16 J;  3IH4 A;  5GP9 A;  1SQ8 A;  2DMP A;  4A3D J;  3GTG J;  2R0Q C;  1ENH A;  5DS9 A;  1RKT A;  3QF3 A;  5M3M J;  3LSR A;  1NK2 P;  2KDZ A;  2CSF A;  2JN6 A;  1BJZ A;  5IYB J;  1IJW C;  5HOD A;  4PU4 C;  1IG7 A;  5IYD J;  1EF4 A;  2R5Y B;  2PUC A;  1ETQ A;  5DTD A;  3JRB A;  2M2E A;  2DN0 A;  2O8K A;  4UUT A;  1U9N A;  2DMU A;  4GHJ A;  1WPK A;  4B4C A;  4X4C A;  2LK2 A;  3F51 A;  1ETX A;  1FJL A;  1WCM J;  4QTR A;  4FE4 A;  1JT6 A;  1LE8 A;  1TC3 C;  2IEK A;  4HNV A;  4J1W A;  4IHV A;  3NAU A;  3OQN A;  1GT0 C;  5EG0 B;  5J1U A;  3O8H A;  2VI6 A;  5BNG A;  3A01 A;  2ID3 A;  4S0H B;  5EGO A;  1BW5 A;  3JRC A;  1TWA J;  2XPU A;  3BG9 A;  2HDD A;  1FTZ A;  4EEF G;  2BNN A;  3C2B A;  4NDL A;  1HOM A;  2GM4 A;  2NVQ J;  2O49 A;  3OSG A;  2EZI A;  2LVS A;  3GTJ J;  3OOU A;  5K7Z A;  2JA7 J;  4DYQ A;  2ECC A;  4JCY A;  2M8G X;  5M5W J;  1PRV A;  2O9L A;  2ID6 A;  5C44 J;  5F0C A;  5EGO B;  3BG3 A;  4C2M J;  1LCC A;  1QVU A;  4V2G A;  1Y9Q A;  4X4I A;  2MW8 A;  4FTH A;  2H8R A;  4BKX A;  2LYK A;  3UKG A;  2R63 A;  1HCR A;  3HEF A;  2LD5 A;  2KEK A;  1R69 A;  2AWI A;  1UXD A;  3GTQ J;  1SFO J;  3O8G A;  2PUA A;  4IHY A;  4BXX J;  2E1O A;  4A3L J;  3HOY J;  3JXC L;  4QIW N;  1GVD A;  5F1J A;  1ZS4 A;  2HI3 A;  1PRU A;  3B7H A;  3BT9 A;  4RBO A;  4DW6 A;  4MCT A;  4MCX A;  3GBF A;  3CEC A;  4Y42 A;  2K9N A;  2CUE A;  2HYJ A;  3B6C A;  4YG1 A;  4JQD A;  2JA8 J;  3M4O J;  3LSJ A;  3RQI A;  3QYX A;  2G0E A;  2YUS A;  4X6A J;  2PE5 A;  2R5Z A;  5EZG A;  2PUE A;  4YG7 B;  3LIS A;  1MSE C;  2CQQ A;  2DA7 A;  1W0U A;  3PXP A;  3U3W A;  4A69 C;  4I8T A;  3IH2 A;  2GLO A;  4A93 J;  2M34 A;  2RAE A;  2XSD C;  1TWC J;  1X2N A;  4DZP A;  1NK3 P;  3HB9 A;  1IRZ A;  2PUF A;  5GPA A;  2H1K A;  4I6T A;  4IHW A;  1A5J A;  3S15 J;  2WV1 A;  4FIS A;  3S1Q J;  2ICT A;  2DA1 A;  3HZI B;  1WH7 A;  2K40 A;  3JRG A;  4AYB N;  3G1L A;  3F6W A;  4Z58 A;  1QPZ A;  3LFP A;  2E19 A;  3TRB A;  5EZH A;  4O8B A;  4DYR A;  3B6A A;  1JKQ C;  3M3Y J;  5EYR A;  1X2L A;  3BTC A;  1A6I A;  2WIU B;  3HM5 A;  1BA5 A;  1GDT A;  1HF0 A;  3ZQC A;  1IC8 A;  1Y1W J;  5EEA A;  5JLW A;  3CCY A;  1DU6 A;  5FKM A;  4J19 A;  3BR1 A;  3JRD A;  3ZQI A;  4FN3 A;  1S7E A;  4UUS A;  5E3N A;  4YAR A;  4C3H J;  1FEX A;  3Q0W A;  1PRA A;  4A3C J;  2W48 A;  5IP6 A;  1JT0 A;  3NAR A;  2LR8 A;  4MFD A;  2Y0S N;  5FKN A;  1XS9 A;  3JXB C;  1HLV A;  5J3L A;  2AXZ A;  3HGY A;  1RES A;  4FCY A;  3RZD J;  2ELK A;  3S17 J;  1R63 A;  3MN2 A;  5K7F A;  2FQ4 A;  3CMY A;  1RZS A;  3S14 J;  2Y2Z A;  4PU8 A;  2EWT A;  5C3E J;  3BTJ A;  3HOV J;  1P7I A;  2DA6 A;  3QPS A;  2LFB A;  3BR3 A;  5K98 B;  4G12 A;  2DTZ A;  2LCV A;  2GZU A;  1ZZ9 A;  3HOZ J;  1JJ8 C;  2I10 A; 
#chains in the Genus database with same CATH topology
 2IA1 A;  3QOX A;  2JRM A;  3DBL B;  2ZCW A;  5IT9 K;  3FHZ A;  1V4R A;  1P2F A;  1WIZ A;  1GVJ A;  2IA0 A;  1TWH J;  2DT6 A;  1VFC A;  3PSI A;  4M3G A;  5HNF A;  5FJ8 J;  5IOY A;  3SCF A;  4B3X A;  2E2I J;  1XMX A;  2KQR A;  3KCC A;  3K1N A;  3GZD A;  3HBL A;  3S1R J;  2F5C A;  2VL8 A;  2GRM A;  5BMZ A;  1CQT A;  2GZW A;  2VQG A;  3CCV I;  4IOC F;  1TQI A;  4HPQ A;  4CCN A;  2LY2 A;  2RQQ A;  1DW9 A;  2EH3 A;  2EJR A;  3Q9S A;  1A35 A;  3MAJ A;  3DWL E;  1FZP B;  3ZN1 A;  2W00 A;  3RPU D;  2Y31 A;  5BS6 A;  4R8H A;  4LK0 F;  4Y33 A;  3K4N A;  3GFI A;  1D1A A;  2FRH A;  1VQL I;  4C3I J;  3I59 B;  4MQ9 F;  1P4A A;  2UXN A;  3W6V A;  3EUK L;  4U88 A;  2XPW A;  1JUM A;  3A4C A;  3FXJ A;  2PLY A;  4E7S A;  4CSW A;  4IXA A;  3Q0U A;  2VBY A;  4BHP A;  2DOD A;  3PQJ A;  4X4E A;  3ABM H;  4M3B A;  2PXT A;  4HA8 A;  1A04 A;  1ZAR A;  3MZH A;  4HRI A;  1R58 A;  1MNE A;  5IYC J;  1S9H A;  2IPQ X;  3JRI A;  1Y7Y A;  1K6Y A;  2X6O A;  4Y3O A;  3JAM Z;  1FPQ A;  1BIB A;  3GCM A;  4OBM A;  1FP2 A;  3WOD F;  1Z6R A;  1FOK A;  5LHG A;  5HDN A;  1WJE A;  3OYA A;  4K2E A;  4Q48 A;  3SJM A;  1W7P A;  2CG4 A;  1R1V A;  1D0Y A;  3N97 A;  1C0W A;  1FIA A;  1AKH B;  2OFY A;  6PAX A;  5D5X B;  5M5X J;  4Z59 A;  2XRN A;  5JVG F;  2EFP A;  3L9F A;  2ELH A;  3UR3 C;  5BQT A;  1BI2 A;  4QWQ A;  3ASN H;  1HW1 A;  4JP0 A;  1TTY A;  2JRT A;  2W57 A;  3CES A;  3NEU A;  4G6Q A;  3OSF A;  5DTQ A;  2FXA A;  2LF7 A;  1JI8 A;  1LCD A;  2JA6 J;  1MMA A;  4B3A A;  4DIQ A;  4YG4 A;  1Z3X A;  4JK1 X;  2IT0 A;  3FYA A;  2HYG D;  3KP5 A;  3GW2 A;  4BDZ A;  4XNF A;  4RM2 A;  4BNC A;  1QHG A;  3KP3 A;  4Y7N J;  2TCT A;  3ZQ7 A;  3ABK H;  2WTE A;  2WY7 Q;  3PIP F;  3ZOB A;  1XCB A;  1U9O A;  5GPC A;  5JLX A;  1FP1 D;  4N4N B;  3GN5 A;  4Z5D A;  4OB4 A;  3OYN A;  4QSH A;  2XCJ A;  2EFN A;  2LYS A;  3CCS I;  3JW4 A;  1DP7 P;  3W6K B;  2KMU A;  1B9M A;  4ZC3 A;  2RKH A;  1JH9 A;  4DQ2 A;  3DEU A;  4IHX A;  1LKX A;  1X1D A;  3REO A;  4HYE A;  2K9S A;  3HUG B;  5E20 A;  1MSF C;  3DKX A;  2XJ3 A;  4ZH4 F;  2ME6 A;  2DA3 A;  3FMQ A;  3K1P A;  4OWR B;  1JFS A;  2IGN A;  4CCO A;  1Z67 A;  3ZQQ A;  4Z5C A;  1XC5 A;  3A01 B;  1SFU A;  2NRA C;  2KRC A;  4I0B A;  2EIM H;  1JUP A;  2DI3 A;  3F72 A;  4NUB A;  3TP3 A;  2O03 A;  3IKT A;  3H9G A;  1T56 A;  1OMI A;  2HYF A;  1Z6T A;  2WBM A;  2KJC A;  2PXV A;  5FFX A;  1QQB A;  4PFP A;  3VWB A;  1B8I B;  3WTS C;  3DPU A;  3PNY A;  3A9Z A;  3I3L A;  4XSX F;  2LYL A;  4KNY A;  2IU7 A;  4B1R A;  3U3W A;  2R1J L;  5A2Q K;  2JCG A;  1IRF A;  4I01 A;  2C6Y A;  3DKY A;  5EJC A;  1ZVV A;  3KEO A;  2CQK A;  1K61 A;  5CLS A;  2HQ5 A;  3DFG A;  4KMU X;  1XN7 A;  2P8T A;  3JTH A;  2MFZ A;  4KJZ A;  3CC7 I;  3VWS A;  3A9Y A;  3QP6 A;  4YIR X;  2XSJ C;  2IAI A;  1F5T A;  2BV6 A;  1D1B A;  2JA2 A;  1VPW A;  1Y8Q B;  5FKL A;  5LHH A;  1DDN A;  1UEL B;  3OIQ A;  1KYW A;  3E6C C;  3FX3 A;  2UWM A;  3OMY A;  1G4D A;  1T33 A;  2EQR A;  1JJ6 C;  5DCF A;  2ZJQ F;  1XDS A;  2HTS A;  2M7A A;  5J4V A;  2IS2 A;  1Y0U A;  4G6D A;  2R7U A;  4ER6 A;  4X1E A;  3V7C A;  3C1D A;  3SEQ A;  4UV8 A;  2VKV A;  2M4G A;  3V8K A;  1TNT A;  2KEJ A;  3PSF A;  4AIJ A;  2E34 A;  3ERM A;  3AL0 C;  1KU3 A;  3FMR A;  2PQ8 A;  2L4A A;  3CP8 A;  2YSR A;  4PGG A;  4G7Z F;  3KLO A;  1QA6 A;  2LKS A;  1P92 A;  1A31 A;  1TT5 B;  2KIM A;  1N25 A;  2Y75 A;  2WAQ N;  3R4K A;  4HQE A;  3R1F A;  2TRT A;  1SFK A;  3V4G A;  3OS2 A;  1U5T C;  1UAA A;  1DP3 A;  2R93 J;  2EFW A;  4IEJ A;  5ERI A;  2QWW A;  4IQ4 A;  2AXV A;  2A68 F;  1FMV A;  2WA0 A;  3G73 A;  3A0H C;  3CUQ C;  1GV5 A;  3FXQ A;  1RC9 A;  2XF5 A;  1R00 A;  1H8A C;  2OR1 L;  3E5X A;  5KAI C;  1B9N A;  3C2H A;  4ESF A;  1VQ8 I;  2W7N A;  3GZ6 A;  4I6R A;  5IOZ A;  2DOE A;  2DT5 A;  4G94 A;  4AC0 A;  2VAS A;  4A6D A;  4HSR A;  3F8B A;  1Z7L A;  4BE2 A;  3SFZ A;  4UUS B;  3CUQ A;  1BL0 A;  4M6V A;  3WHB A;  2AXU A;  3CZ6 A;  5JHU A;  1ZGW A;  1MZB A;  1FYM A;  4MTD A;  1SFE A;  2EK5 A;  2LOO A;  3I55 I;  2GA1 A;  4M3F A;  3S8P A;  3WU2 C;  1U6G A;  1WJC A;  2B7E A;  3RCO A;  1IO2 A;  1BOB A;  3H92 A;  1ZAY A;  4KIC A;  2IUO A;  1WI3 A;  1XDU A;  3V8J A;  1YYV A;  3S3O A;  4EK9 A;  3ZXS A;  2PG4 A;  5GAD J;  3G1M A;  2PXQ A;  1HKT A;  3S8Q A;  3M1E A;  4AM3 A;  1OJL A;  1UCR A;  3LFK A;  2VJ4 A;  3RQ4 A;  2QSH X;  1NER A;  1VND A;  4Y52 J;  5JUW A;  1O3Q A;  3F0C A;  2R7S A;  3DEE A;  2JZY A;  4N9I A;  2V9P A;  3TGN A;  3BC8 A;  4HQM A;  3HYI A;  4WX9 A;  1J75 A;  1OCR H;  1MBK A;  3WGI A;  3G7D A;  3RKY A;  3CC2 I;  2JVH A;  2LKX A;  3LST A;  3F52 A;  2FSW A;  4CHU A;  1QBJ A;  3BP8 A;  4V19 K;  3L1P A;  1JE8 A;  3FWE A;  5E18 F;  2PXE A;  1Z3Y A;  4LGW A;  3CCR I;  5DM6 F;  5E79 C;  2QGU A;  1YRN B;  3HDD A;  3RPQ A;  1XSX A;  2E2J J;  5DCM A;  3KEQ A;  2ZNZ A;  1XMK A;  2LYP A;  3FKJ A;  4P55 A;  2ZKZ A;  2HXO A;  3VYT B;  4C2U A;  1HQ1 A;  1G3Y A;  2JUC A;  2HFH A;  2X1D A;  4XRS G;  3CCQ I;  3GTP J;  2BJC A;  1EJ9 A;  4RGU A;  2R7V A;  4I02 A;  2LNM A;  3FM3 A;  1LJ9 A;  1K4S A;  3HOU J;  2ZJR F;  1TWF J;  2CRO A;  3OV8 A;  2EPF A;  1XSV A;  2DYR H;  2K85 A;  2XKO A;  3DEW A;  4LMY A;  5E3O A;  2L8N A;  1R4N B;  5IP9 J;  4AYB A;  4BEH B;  1UTX A;  2PXL A;  1SMY F;  3DM5 A;  3HHH A;  1S6L A;  3IH4 A;  1SQ8 A;  2DMP A;  5HLG A;  4A3D J;  3CDH A;  5DS9 A;  3BRO A;  4XRF A;  5M3M J;  2J5O A;  4PGH A;  1K6O A;  2BY3 A;  5IYB J;  2KIS A;  2STW A;  2R5Y B;  1ETQ A;  2VPL A;  1LDK B;  3VSL A;  2DN0 A;  1YIO A;  3BCA A;  4UUT A;  2G7H A;  4Y4R A;  2D1V A;  4BDY A;  4IHS A;  2LK2 A;  2V6C A;  3F51 A;  5AON A;  2ZSH B;  5KVR A;  1JXS A;  2KZG A;  2ZNY A;  2DFH A;  1TC3 C;  2PX9 A;  2YPR A;  1QB2 A;  4J1W A;  2OD5 A;  2VON A;  2BE5 F;  1U2Z A;  1TLH B;  3OQN A;  5TJJ A;  2ZXH A;  4UNO A;  3H0D A;  4ER5 A;  1VQK I;  3DTK A;  2XPU A;  3WGH A;  1GLN A;  4EEF G;  4ZYH A;  2BNN A;  3X2Q H;  4BQN A;  2DPU A;  1R7J A;  2BY0 A;  2UUZ A;  2HQR A;  3Q5F A;  3GTJ J;  1ULY A;  4KIT B;  5ICC A;  5LBQ A;  1SMT A;  3TEL A;  2RDP A;  2O9L A;  2A5Y B;  1WSU A;  4H0E A;  4C2M J;  2CQN A;  1Y9Q A;  2BGC A;  2CW0 F;  4ON0 A;  5HLH A;  3G6E I;  3IP4 B;  3UKG A;  3N4M A;  3KP2 A;  4Y17 A;  3HEF A;  2DPD A;  1K4T A;  3KLN A;  4F92 B;  3KZY A;  2ISZ A;  1P9Q C;  2KIQ A;  3HPH A;  3O8G A;  1CF7 A;  4BXX J;  1VQM I;  1QO0 D;  3ELK A;  3HOY J;  3MWM A;  3JXC L;  1J5Y A;  3GME A;  4IHT A;  1KQ8 A;  2IS6 A;  4HNT A;  4DW6 A;  3GBF A;  3CEC A;  4WXD A;  2OTJ I;  2CUE A;  2HYJ A;  5FO5 A;  2DBB A;  3HRT A;  4JQD A;  2JA8 J;  3I0T A;  1PUE E;  3R0J A;  2I5U A;  3T0Y A;  2E1C A;  4IKF A;  1R23 A;  2P5K A;  2YX4 A;  4X6A J;  2PE5 A;  5EZG A;  3LL7 A;  4YG7 B;  3KP6 A;  2HNH A;  2EIK H;  4IWR A;  2ACJ A;  2CQQ A;  5E1Z B;  4EGY A;  4PJM A;  1MFQ C;  3IH2 A;  2GLO A;  4BHC A;  1LVK A;  3F8N A;  2QKM B;  2W84 A;  1X2N A;  3CTA A;  4UY8 I;  1NG7 A;  5IY5 H;  3OYG A;  2PUF A;  5GPA A;  4XN0 A;  4IHW A;  1A5J A;  2WV1 A;  4FIS A;  4ZTJ A;  1G59 A;  1XB4 A;  4ESJ A;  1I27 A;  2QEN A;  4MTE A;  1G6N A;  4DE9 A;  1D0X A;  3JRG A;  3G1L A;  2L9N A;  3OYJ A;  3F6W A;  1KQ0 A;  1TT0 A;  2IVM A;  4UB6 C;  1I1S A;  1Y56 A;  4DYR A;  4I0A A;  5EYR A;  3J7A Y;  2A61 A;  2VBZ A;  3BTC A;  1X2L A;  2AQF A;  3HM5 A;  1V5E A;  1T2K A;  5D4S A;  4HRA A;  3GZD C;  2HVQ A;  3V42 A;  2V1D A;  4J19 A;  2JT1 A;  3BR1 A;  1S7E A;  1LPQ A;  3RI4 A;  2QUF A;  1FEX A;  1R4M B;  1MND A;  2W48 A;  1O57 A;  4A6E A;  2BXZ A;  1SFX A;  4GGG A;  5FKN A;  1XS9 A;  3JCU C;  1HQC A;  4L0Z B;  1R63 A;  2QKL B;  3CMY A;  5K7F A;  2FQ4 A;  1LDD A;  4XOT A;  2ZC2 A;  1T8I A;  2EWT A;  5CVR A;  4I2O A;  3LSM A;  1T98 A;  3AG1 H;  1P7I A;  2DA6 A;  4UV9 A;  2LFB A;  2QZ8 A;  3ESW B;  3TO9 A;  4G12 A;  2GOM A;  3ABL H;  2H27 A;  4GRI A;  3KZI C;  3FM5 A;  5DTR A;  5ILV A;  2HOS A;  2LP0 A;  1QHH D;  4ABZ A;  2OTL I;  3BG6 A;  4A12 A;  4LLN A;  3IV5 A;  2Z16 A;  4UHT A;  1YX3 A;  3PNV A;  2V4J C;  4YBA A;  4LIT A;  1MBG A;  3GTM J;  5JFR A;  3TW6 A;  2JWT A;  3FXR A;  4F52 A;  2RN7 A;  1KQ9 A;  1MDM B;  1BI0 A;  1WFX A;  2L9R A;  3VOE A;  1ZZ6 A;  5JVT A;  1IXR C;  5GAG i;  4CCJ A;  1G3S A;  2CUF A;  1SD4 A;  2Z2S B;  4JOM A;  4HBL A;  1A6Q A;  1R5I D;  4JX4 A;  3S3N A;  2R7Q A;  1DPU A;  2XF7 A;  4CDG A;  4II2 A;  5B3S H;  1O7F A;  1ZZ7 A;  1G3T A;  2MSY A;  1UHM A;  1RET A;  3QFI A;  2BVM A;  4D5C A;  3ZKC A;  4M9Z A;  3LSG A;  4ZZL A;  1MBH A;  1ZRF A;  4C2T A;  1MD0 A;  2AO9 A;  5F64 A;  1CJG A;  1FMW A;  1QGP A;  1ETK A;  4AVP A;  4F3Q A;  3K2Z A;  2OC6 A;  1R49 A;  2IVB A;  3C7J A;  4IRH A;  1FT9 A;  1ZZC A;  1REP C;  2OPT A;  3F9K A;  4EJW A;  4F7Z A;  2AHQ A;  2M5W A;  3E5U A;  4L9T A;  3KFW X;  4S05 A;  3K7A J;  3AL0 B;  4BJ6 C;  4RAY A;  3BDN A;  2KIU A;  2HZD A;  1MH3 A;  1L1M A;  1X3Z B;  2ZJ2 A;  3Q0V A;  4HW0 A;  4RGR A;  2K3F A;  2ZB9 A;  3K4L A;  5IP7 J;  2VT3 A;  4KIB A;  3PNT A;  3WGG A;  2E36 A;  3SCH A;  1RUN A;  2EV0 A;  3HRM A;  5C4X J;  3GVA A;  1ZH5 A;  2HDW A;  3OIO A;  2FD5 A;  2D1H A;  2P7V B;  3ROU A;  4S04 A;  1VQ5 I;  3SEZ A;  3HKZ N;  3WU1 B;  1E0E A;  3OMT A;  4A3B J;  4D0P A;  3ZHI A;  3PE5 A;  2E35 A;  3VFZ A;  4BL0 B;  1OYI A;  1SD5 A;  3RKQ A;  5C4J J;  3SHF A;  2CW8 A;  3WE2 A;  3PO2 J;  2MQK A;  3FZV A;  1BR2 A;  2A07 F;  4UB8 C;  2ICW G;  3EYY A;  3TO6 A;  5CJ9 A;  1IUY A;  3KEY A;  4HV6 A;  2YX7 A;  4KMF A;  1DGW Y;  4GYI A;  4OIP F;  4PU3 C;  2R7D A;  3P9I A;  3MEJ A;  3LAJ A;  1LB2 A;  3RYP A;  1JGG A;  5J47 A;  4B47 A;  1ZG3 A;  2VIX A;  2F4O B;  4XLA A;  2UXX A;  2HOE A;  3QAH A;  4KIS A;  3E6B A;  3ZCO A;  4B09 A;  1FBU A;  1YO5 C;  4BBR J;  2W4S A;  2Y48 A;  2JPB A;  1JHH A;  1WH5 A;  3CLC A;  1XGN A;  2KEI A;  3GX4 X;  1SVL A;  3B73 A;  3I64 A;  1SAU A;  2LTP A;  3DTI A;  1LFP A;  2HPM A;  3ECH A;  3KIO A;  3E1S A;  2CO5 A;  2OJE D;  1QQA A;  4EKI A;  3BQZ A;  1ITY A;  3A03 A;  4ENK A;  2ODR D;  3IH3 A;  4G7H F;  2XGD A;  5L3E A;  3Q3S A;  3G71 I;  5EF6 A;  1HXD A;  3D5L A;  4G9Y A;  4I98 B;  2CU7 A;  2YU9 J;  1X57 A;  4FBI A;  2O0Y A;  2KKO A;  4Y13 A;  1G2H A;  2HPI A;  1LNW A;  2NS8 A;  2X9D A;  3PFY A;  4I09 A;  5J1Y A;  4GQM A;  3IKV A;  5DRT A;  4DZJ A;  1MBE A;  3H9Q A;  2XUB A;  2W25 A;  3JRE A;  2MEZ A;  3BWG A;  4LFU A;  4D7M A;  3OY9 A;  3FXK A;  4YFX F;  1BJA A;  4JQF A;  3V7S A;  4ER3 A;  2PXD A;  2PJP A;  3HOW J;  5CYV A;  5A2Q Z;  3KL4 A;  4F91 B;  2QEX I;  2MH2 A;  3I4P A;  3A2K A;  3T8R A;  4ZDP A;  4F93 B;  3OL3 A;  4CYC A;  1B8I A;  4RB3 C;  2BOL A;  1HDP A;  1UST A;  2VXD A;  3OYF A;  1OR7 C;  1G3W A;  1OCZ H;  3JTG A;  3HG9 A;  3NWT A;  2FOW A;  1U8B A;  1LQC A;  2BW3 B;  5IT9 Z;  1IF1 A;  2F5F A;  2M3A A;  1YJN I;  3FHN A;  1WI9 A;  3E97 A;  4FT8 A;  3QRF F;  2L9S A;  5H6Q A;  2LDU A;  5K1Y A;  4LLL A;  3TL4 X;  4PDK A;  3H3Z A;  4X4D A;  2XDV A;  3J7Y J;  2XXQ A;  5E1W A;  3KZZ A;  1ZTR A;  3GEZ A;  1X19 A;  3P5J A;  3WTX C;  3OYB A;  1D0Z A;  4ENJ A;  3TEP A;  1QZZ A;  4X4F A;  4FX4 A;  2STT A;  4OMZ A;  2VXZ A;  4KN7 X;  3OYC A;  3HJE A;  1D5Y A;  3D5S C;  4XBF A;  3VSK A;  1ZGA A;  2EBY A;  3IRQ A;  3BLY A;  1VQ7 I;  1MH4 A;  3IAM 2;  4KT6 A;  1J59 A;  4Z5H A;  3CJQ B;  2L0K A;  3NQO A;  5CVU A;  1ZUG A;  1I39 A;  5FLX Z;  1OYY A;  2KJB A;  2XRL A;  3DV8 A;  1HA8 A;  2LYJ A;  5TRD A;  4QPQ A;  2AS5 F;  3HPG A;  1Y0N A;  2E60 A;  3K70 C;  2NYX A;  1WHU A;  2WY8 Q;  3VK0 A;  3EPZ A;  3J80 Z;  1P4X A;  4OIO F;  3JXD L;  2VE9 A;  2DO7 A;  2L01 A;  1YW8 A;  4KA4 A;  3ZPL A;  2XPV A;  2K9Q A;  1GV2 A;  2YBD A;  4CH7 A;  2BHZ A;  3QU3 A;  3GTO J;  3FMY A;  1R1U A;  2R5Z B;  2DAO A;  4XID A;  1YRN A;  2XGE A;  2Z99 A;  2L7M P;  4PFO A;  4PSW A;  3OQM A;  3M8F A;  3LSH A;  4V2F A;  5KAF C;  4D1Q A;  3M07 A;  5F27 A;  2A6C A;  3CJN A;  1RR8 C;  1ODD A;  2R7Z J;  4X4G A;  1VZ0 A;  3FIS A;  4OOI A;  1B0N A;  1KU7 A;  2I8D A;  1OR7 A;  5KNL A;  4EJT A;  5J6X A;  3F3X A;  3IRR A;  4BS9 A;  2HCS A;  2ELJ A;  2VPR A;  3A02 A;  1F43 A;  3H5A A;  1OYW A;  1UHS A;  3ZMT A;  4RLQ A;  3U9G A;  9ANT A;  3FK6 A;  2LF8 A;  2LLW A;  3DTE A;  4FHT A;  5TIS C;  2IBD A;  5LGU A;  2JMW A;  3AG3 H;  1ETO A;  4XOP A;  2DA2 A;  5LLQ A;  1YW7 A;  5CVI A;  2L49 A;  3CLQ A;  4DE8 A;  2OF7 A;  1LLI A;  1XD7 A;  2JSC A;  3FKI J;  5K5R A;  2ZXJ A;  2J5P A;  2Q2E A;  2E7X A;  3AG2 H;  2IW5 A;  2LRD A;  3QOP A;  2YS9 A;  4GO1 A;  1KU9 A;  2FNP A;  3RSN A;  4EM1 A;  2LC2 A;  2P81 A;  5J8F A;  3VYS B;  2JPC A;  4RAG A;  2AUW A;  3LQR A;  1ZKG A;  1IAW A;  3K2A A;  4WVL A;  3T8T A;  5B1B H;  1LMB 3;  2M0M A;  4HLX A;  1QP0 A;  1ZK8 A;  4I76 A;  4HF2 A;  5FRN A;  4X4B A;  4E7Z A;  3K0L A;  1LFU P;  2PIJ A;  2M4K A;  2D2W A;  3WTV C;  1F9N A;  1X1A A;  2X48 A;  1HSJ A;  2Z9O A;  3VPR A;  3IWF A;  3FIW A;  1BN5 A;  1OKR A;  2HQN A;  2P7C B;  5FD5 A;  4OIQ F;  4I6U A;  1Y39 A;  5DSX A;  2FJ1 A;  2PUD A;  1ZPQ A;  2FBH A;  3WU0 A;  4ZYG A;  2Y9Z A;  2FBI A;  4WXH A;  3CC4 I;  4O3M A;  3J80 K;  4AUX A;  1TW2 A;  1X1P A;  3DLL F;  3QQ6 A;  2X85 A;  3ZMZ A;  5LGT A;  4U0Y A;  3MFK A;  1W36 D;  1OSL A;  2CQ7 A;  3GTK J;  3ONQ A;  5F6F A;  3PUB A;  5AIP A;  2DYS H;  5CVJ A;  1V54 H;  4ER7 A;  2MH9 A;  1H9T A;  1X1C A;  3ZMU A;  2KDZ A;  5GAG J;  2O61 A;  2V9K A;  2VOD A;  3ZPX A;  1BJZ A;  1IJW C;  5KHD A;  1FYK A;  3BDD A;  3IUO A;  3BJA A;  2V3C C;  3D0S A;  3A0B C;  2JQ7 A;  4LIV A;  4ENN A;  5HLT A;  1QU3 A;  1U5T A;  2DMU A;  1WJB A;  1WPK A;  5FRO A;  4B4C A;  4GHJ A;  4X4C A;  4L9V A;  2Y0M A;  1ETX A;  4IVN A;  2NNY A;  3HSF A;  4FE4 A;  1LE8 A;  3NRV A;  5J40 A;  3TKY A;  1RZ4 A;  4HNV A;  1QPM A;  4IHV A;  1DUX C;  2GA2 A;  3NAU A;  4RB2 C;  1GT0 C;  2IRF G;  4L5I A;  1T0F C;  1W5T A;  3CJR B;  1YW9 A;  3MEX A;  3O8H A;  5EGO A;  2EV5 A;  1FYL A;  4IRI A;  2HEO A;  4BAY A;  1BI1 A;  2FQ3 A;  3C2B A;  3CUQ B;  4NDL A;  1HOM A;  4II3 A;  2GM4 A;  5ICG A;  3OSG A;  3R0A A;  2HR3 A;  2LVS A;  2TDX A;  1N78 A;  2CMP A;  1SVM A;  4XLP F;  1DGR M;  5K7Z A;  3LQX A;  2FNA A;  3DXJ F;  1HKS A;  2LH9 A;  4OIN F;  4DYQ A;  2M8G X;  3RKX A;  3KYD B;  1YS6 A;  2ID6 A;  2QA4 I;  2CFO A;  3FDY A;  1LCC A;  4V2G A;  4BKX A;  4M73 A;  3HTU A;  2NAZ A;  1HCR A;  2R63 A;  5D6E A;  1I3A A;  1YOV B;  2FBK A;  2L5Q A;  3ECO A;  3K70 D;  4XKC A;  3CO6 C;  2IS1 A;  1EV7 A;  1KA8 A;  1Z21 A;  4EQQ A;  4IHY A;  2PUA A;  3M8E A;  3OL4 A;  4CZZ A;  2E1O A;  4E7L A;  1GVD A;  4PJN A;  3HRS A;  4FET A;  2HI3 A;  1PRU A;  4XQF A;  4RBO A;  1ZG5 A;  3OYI A;  3DBH B;  1K7A A;  4MCT A;  2H94 A;  4MCX A;  5CQG A;  2X6W A;  4ZJZ A;  5E17 F;  5HOO A;  2PJR A;  4HV5 A;  3LSJ A;  1XX5 A;  2PFB A;  1Z05 A;  2DJI A;  2G0E A;  4QLC U;  4J00 A;  3LFU A;  2PUE A;  2A6E F;  3SQN A;  2DA7 A;  1W0U A;  4I8T A;  1KYZ A;  4A69 C;  4XLF A;  4KIG A;  1WJF A;  2XSD C;  4LB5 A;  1TWC J;  1Z91 A;  3W2V A;  2M30 A;  2XXP A;  1D5V A;  2CV0 A;  2H1K A;  2OA4 A;  4LJZ F;  5HVQ C;  3MMY B;  2NVU B;  1KGS A;  2H6C A;  2MD5 A;  1I5Z A;  2ICT A;  1YJ9 I;  2WAQ A;  3HZI B;  2PMZ A;  3E3V A;  2GWR A;  2GXG A;  2EFQ A;  3J81 Z;  1L0O C;  1WH7 A;  4B48 A;  1QPZ A;  5LFA A;  4I7H A;  3L2Q A;  3TRB A;  4O8B A;  3GZN B;  2ESN A;  3KP7 A;  3B6A A;  3M3Y J;  1J2X A;  1IW7 F;  5L3G A;  4B43 A;  1A6I A;  2DFF A;  2PXK A;  2R7R A;  2IGO A;  1BA5 A;  2ZFU A;  1GDT A;  5B66 C;  2K3P A;  5HS8 A;  1IC8 A;  5EEA A;  2RGV A;  5JLW A;  4A2U A;  3CMA I;  2VE8 A;  2IGK A;  3JRD A;  2R4G A;  3VYU B;  3ZQI A;  4UUS A;  4FN3 A;  4N0B A;  1WKM A;  4HX7 A;  3IAS 2;  1X4O A;  4MNU A;  3DU6 A;  3MZ8 A;  2LR8 A;  2PXF A;  2Y0S N;  3JXB C;  2AXZ A;  1Z7U A;  3HGY A;  4IO9 F;  2VT2 A;  1IN6 A;  2ELK A;  4IPA A;  3V7R A;  4WCG A;  2M87 A;  3SXY A;  3S14 J;  2W1O A;  5K5Q A;  4PU8 A;  1WQ2 A;  5HDK A;  5C3E J;  4YEL A;  3BTJ A;  3HOV J;  1Z1D A;  3QPS A;  4HG2 A;  5K98 B;  1JGS A;  3ABT A;  2LCV A;  1ZZ9 A;  2JSP A;  1S7A A;  3HOZ J;  2I10 A;  4LB6 B;  2IGM A;  3LAP A;  3DPT A;  3QPL A;  3CDI A;  2KZ8 A;  2MGQ A;  4HST A;  2O5R A;  1MKM A;  4C3J J;  4CYC B;  2B63 J;  2RVC A;  3BY6 A;  3TO7 A;  3EUH C;  3KYC B;  1BDH A;  3OYK A;  2O7O A;  1LDJ A;  2EA2 A;  3BJO A;  5KK1 A;  1PER L;  3H5R A;  4M6Y A;  1FTT A;  3SCG A;  3SFI A;  4F55 A;  1JTX A;  2MBF A;  3RZZ A;  4DJA A;  3KXA A;  3MVP A;  4JX5 A;  3C2G A;  3TOA A;  1I6X A;  3A1Y A;  1NW3 A;  2BHY A;  1OFC X;  4ER0 A;  2Q8K A;  2CJJ A;  3IWZ A;  3F22 A;  5H6R A;  2QBY B;  2MLG A;  1JKR C;  3OKZ A;  2KT0 A;  4L18 B;  2MG4 A;  1Z77 A;  3A9X A;  3GF2 A;  2ISY A;  1JKP C;  5FD6 A;  1IN8 A;  3CMM A;  2M9H A;  5AIQ A;  4JYK A;  3TED A;  4NDW A;  2AXL A;  3E7L A;  1E3P A;  1USS A;  2P6S A;  1SD7 A;  4MEY F;  4PCQ A;  3HOT A;  1ZRC A;  2V6E A;  2X4H A;  3J81 K;  2ZME A;  3WTU C;  1YTY A;  3DNV B;  1T0F A;  4CZC A;  3OWQ A;  4EM2 A;  4IQJ A;  3EYI A;  1W4M A;  2F5E A;  3SDB A;  1POU A;  4DBR A;  3K4C A;  2OQG A;  3TW7 A;  3VEP A;  2CV1 A;  3AG4 H;  2PJR B;  2PXU A;  2ECB A;  2FX0 A;  1G8X A;  2L7F P;  2ZFW A;  3P9C A;  4TV7 A;  3G2B A;  3R61 A;  2PMU A;  3AAF A;  1MMG A;  1W7P B;  3UNG C;  1YSE A;  1FSE A;  1I3Q J;  2CUZ A;  2EZL A;  5D5W B;  1E3H A;  2R5Y A;  4A5M A;  4MEX F;  1Y8R B;  1PP8 F;  4XIC A;  3CO7 C;  4A3K J;  2VQC A;  2WAF A;  3OIP A;  3WTT C;  2R7X A;  3EUS A;  1R5H A;  1ZHF A;  1AHD P;  1WJ5 A;  3SYT A;  3HGG A;  2QQ9 A;  3TDZ C;  3ZMS A;  2IV1 A;  1AA7 A;  2WV0 A;  2WAD A;  4O5V A;  3JRF A;  2YR2 A;  2LYQ A;  4HZF A;  1DWK A;  1GUU A;  3KPH A;  3NXH A;  1XPX A;  4YFN F;  1ETY A;  2WC2 A;  3W2A A;  2Y0S A;  3LSP A;  4AD9 A;  2VKH A;  2HS5 A;  1HST A;  5CKT A;  1IN5 A;  4CO8 A;  2XHK A;  3ULQ B;  2HWV A;  1E3O C;  4ETS A;  2DU9 A;  4A3F J;  1MDM A;  2D5V A;  1ZZ8 A;  1OIS A;  3GUD A;  1S3J A;  1TQP A;  1W7P D;  2ZME C;  2Q0O A;  4ZDL A;  4AIH A;  2HTJ A;  1RZR D;  3NDB B;  4CA0 A;  2L7Z A;  1VF9 A;  3U21 A;  2P5L C;  1PP7 U;  1UFM A;  1ZG1 A;  2DCE A;  2PN6 A;  4KN4 X;  2QQA A;  4E7K A;  5BPD A;  2Z3Y A;  3H3V K;  1R6R A;  4HOB A;  2JVL A;  1YIT I;  2XB0 X;  1XGS A;  2LYR A;  3GLL A;  3OR1 C;  3ZR8 X;  1H88 C;  2DMN A;  3GFJ A;  1ZLK A;  2O8X A;  4A3G J;  3B02 A;  2PEX A;  2QQB A;  1Q1H A;  3KX2 A;  4Y15 A;  4A3M J;  4L9N A;  1B72 B;  2BY2 A;  3BTI A;  4EVI A;  3ASO H;  4P9F A;  3RTR A;  4W97 A;  3E6D A;  2RQP A;  4LOC A;  2JQE A;  1ZZB A;  3MKY B;  3RZO J;  3BPV A;  4RGS A;  3HUG A;  5GTI C;  2HXI A;  4LLG F;  4NQW B;  4I6Z A;  2XXA A;  4OMY A;  3DBR B;  4ZYE A;  3ZQH A;  2WB1 N;  2OCE A;  1V55 H;  2Y69 H;  4QPO A;  3HOS A;  2UZK A;  4ANJ A;  5ILS A;  3OYD A;  1QP7 A;  1SAN A;  3KE2 A;  3OWT A;  4BXU A;  5EG0 A;  1WH8 A;  2R92 J;  1I6H J;  1ZLJ A;  4M3D A;  1IDY A;  2L9V A;  4R1H A;  1EH6 A;  2PXB A;  4XM3 A;  2XI8 A;  3BS3 A;  4Q4Z F;  3S2H J;  2LY9 A;  3K9T A;  3MKL A;  2IXS A;  3GFM A;  3PUF A;  3D5R C;  2KP6 A;  4H4K C;  2K4J A;  1UJ8 A;  2NVY J;  2XKP A;  2A05 A;  1P7J A;  3LWF A;  5ILU A;  3G1O A;  3RYR A;  3ZHM A;  2PXP A;  5BPI A;  5D8L B;  2PPX A;  2K27 A;  2MLK A;  3TMO A;  2OU2 A;  1VQO I;  2FML A;  2H09 A;  3N05 A;  1VTN C;  4BY7 J;  5DDG A;  1XGO A;  2MC4 A;  2LY1 A;  1XMA A;  5FGM A;  2H8W A;  3BCB A;  5F08 A;  3MLF A;  1K83 J;  2BBY A;  1T39 A;  5A7L A;  3K4J A;  1Z0X A;  2PMH A;  2RC4 A;  5ICE A;  3RKW A;  5D5U B;  1XSD A;  1TQM A;  5D6F A;  3W2W A;  1UXC A;  4PK4 A;  4XK4 A;  1ETW A;  3COA C;  3H5T A;  5J8C A;  3I5U A;  3CRO L;  2HOT A;  1R5G A;  1WVR A;  1ZQ3 P;  4GDF A;  2O3F A;  5LGN A;  5DUI A;  1BR1 A;  3LNQ A;  2HQA A;  2A3S A;  2P4W A;  5GTH C;  2B5A A;  3M1C A;  3GN5 B;  1B6A A;  1QPI A;  2F48 A;  2P6T A;  1OPC A;  2VQH A;  1VQ9 I;  5E3L A;  2H6B A;  3TP0 A;  1XWR A;  2E1M C;  3I58 A;  4RDU A;  5FFZ A;  4XL9 A;  2ZXW H;  4Z2Y A;  4IA8 A;  2N8G A;  1R22 A;  2JJ7 A;  4DYC A;  3L2W A;  1WET A;  3GYH X;  1ADR A;  4GYG A;  2A5W A;  4HDU A;  4M6X A;  1IN4 A;  2O6G E;  1ONV A;  2DMT A;  3I59 A;  3LOC A;  4DGW B;  4N9H A;  3I4N J;  1ETV A;  4L0Y B;  2KPJ A;  2R3S A;  2EBI A;  1W36 C;  4LD5 A;  3CQZ J;  2Y9Y A;  3S2W A;  3W3C A;  5K7H A;  4E70 A;  1MBF A;  4CYD A;  1TWG J;  3HOX J;  1B4A A;  2M4H A;  1W5C C;  4GXO A;  4JX6 A;  1VQN I;  1BBY A;  2L54 A;  3BR0 A;  4CGZ A;  2OCC H;  4BYY A;  2HKX A;  2KDO A;  1BC7 C;  2K86 A;  3C18 A;  2XAJ A;  3GUU A;  2Z1D A;  4IRG A;  3KJX A;  3L2U A;  3CCE I;  1AWC A;  3MQ0 A;  1MNM C;  1F4K A;  3NZL A;  4ZZD A;  3EET A;  3CCJ I;  2GAU A;  2QF7 A;  3QOE A;  2CQX A;  1SVO A;  1WGX A;  3D1N I;  5IT3 A;  4BBS J;  1J0R A;  2B9S A;  2P5V A;  1W0T A;  1APL C;  1HW2 A;  3PL8 A;  5F0H A;  1STZ A;  4NQW A;  2NVX J;  2L7K A;  3BR2 A;  1Z9C A;  2HFZ A;  2LLK A;  5B1A H;  1HDD C;  2MA3 A;  1XGM A;  4MLO A;  5FLV A;  2RV8 A;  3ZMV A;  4JCX A;  1R36 A;  2M8E A;  3S32 A;  3OS1 A;  3JSO A;  3CCM I;  1HBX G;  2EIJ H;  3IVP A;  2HGC A;  2EZK A;  1YLF A;  3RJP A;  4LG0 A;  1EH8 A;  1AKH A;  3DKW A;  4A3J J;  1ZRD A;  5FRM A;  3ZP5 A;  4NC7 A;  1R9T J;  3CDL A;  2EA4 A;  1IDZ A;  1JTY A;  3VB2 A;  4A5N A;  4EMS A;  2QCO A;  3PJR A;  1D8J A;  2XF6 A;  2DDB A;  2XC7 A;  3K4B A;  2W24 A;  3BG5 A;  1FSH A;  1U0J A;  1ZAO A;  3G5G A;  2F5V A;  1O7L A;  1PUF B;  2ESH A;  1LFB A;  1OQY A;  2RNG A;  2XAF A;  3QU6 A;  1OCO H;  3T5X A;  3EDP A;  2KLO A;  2OBP A;  2BZT A;  2GXB A;  5EDN A;  3DCF A;  3LQQ A;  2OUM A;  4EZI A;  5JHF A;  1DU0 A;  3GZC A;  3V8L A;  2VJ5 A;  2L02 A;  1QVT A;  1IZ1 A;  1NH3 A;  1UG2 A;  3IC7 A;  3BJ6 A;  3S16 J;  4XMY A;  5GP9 A;  5LRR A;  2OZU A;  2EFO A;  2R0Q C;  1RKT A;  4IZZ A;  1FLI A;  2JTV A;  2CSF A;  1E2X A;  5HOD A;  1FC3 A;  1IG7 A;  4BXF A;  2PUC A;  1B59 A;  4PSX A;  5EEG A;  1BR4 A;  3DP7 A;  3HTS B;  3I54 A;  3Q9V A;  2O8K A;  4IOA F;  1U9N A;  2OQR A;  2A69 F;  1FJL A;  4QTR A;  4WK8 F;  3GXO A;  1EH7 A;  2IEK A;  3OS0 A;  4AU7 A;  2JUG A;  5L3D A;  3FBI B;  3SR4 A;  1MMS A;  1T6S A;  5J1U A;  3GLX A;  3VYR B;  2VI6 A;  5BNG A;  4BAC A;  3A01 A;  1U8R A;  4S0H B;  2QSG X;  3IL2 A;  3JRC A;  1SAX A;  4WWC A;  1TWA J;  1S7O A;  3JAM K;  1FTZ A;  3HSE A;  4EV0 A;  2MXD A;  2EZI A;  3WTZ A;  3F6O A;  2FEZ A;  2ECC A;  2CSO A;  2R7O A;  4RAZ A;  5F0C A;  5ICF A;  4IJA A;  2V7F A;  1WJA A;  4X4I A;  2V26 A;  2MW8 A;  3K1M A;  2H8R A;  2LYK A;  4XKV A;  3ZN0 A;  1WZ2 A;  1MJB A;  1LUJ B;  3ME5 A;  3OOP A;  1GXP A;  3HHG A;  1FOX A;  4PZJ A;  1R69 A;  2AWI A;  5E1X A;  3GTQ J;  1UXD A;  1E17 A;  2L3D A;  2CWE A;  1V3F A;  2NXN B;  3MCZ A;  4Z6Y A;  4RS8 A;  2PBI A;  5F1J A;  4XLC A;  4LG3 A;  1ERD A;  1ZS4 A;  3U1K A;  4A0Z A;  3B7H A;  3LA2 A;  3BT9 A;  3MD2 A;  1VQ4 I;  2VBX A;  3F8M A;  4BJ5 C;  4M74 A;  2FOK A;  2OZ6 A;  2K9N A;  2V9V A;  4YG1 A;  3CLO A;  3M4O J;  1ON2 A;  3QYX A;  2YUS A;  1W1W E;  3ZRG A;  3P9K A;  1RI7 A;  2W85 A;  3OYH A;  1IRG A;  4A93 J;  3QYE A;  3WE3 A;  3CF5 F;  1H9G A;  3HSR A;  3OR2 C;  2XVC A;  1IRZ A;  3FF5 A;  3CCU I;  3CME I;  3S1Q J;  3F8C A;  3NWS A;  3LSK A;  5JR3 A;  1S8N A;  2DA1 A;  3HIF A;  4XOR A;  3K69 A;  1FOY A;  1YJW I;  2K40 A;  3FXO A;  2KL4 A;  1SC7 A;  4AYB N;  4Z58 A;  1MGT A;  1YFH A;  4EJV A;  2E19 A;  4DBQ A;  5K5O A;  1S5L C;  2X6Y A;  5LEJ A;  1B1B A;  1JKQ C;  1UB9 A;  2DXI A;  2IA2 A;  1K79 A;  4U0V A;  1J9I A;  2WIU B;  3ZQC A;  2X1E A;  3BOQ A;  3CCY A;  1BOA A;  2F4I A;  1ZYR F;  1X4P A;  1X3W B;  4YEJ A;  4RB0 A;  3G0T A;  4C3H J;  1RNL A;  4LIU A;  5IP6 A;  3NAR A;  4KIF A;  5DT2 A;  1FWZ A;  4MFD A;  1TZL A;  3HZJ A;  1O3S A;  1AOY A;  3QYF A;  4OAY A;  3RZD J;  3EUA A;  3MN2 A;  5FB2 A;  2EIN H;  2Y2Z A;  3RDI A;  2E7W A;  3ZGK A;  5D5V B;  2CS3 A;  2DFE A;  2Q2E B;  4D9J A;  3H1C A;  5ED4 A;  3IHU A;  2GZU A;  4HAM A;  5J3L A;  5BOX A;  3JRA A;  2A6T A;  1QRY A;  1ZN2 A;  4RB1 A;  3WTY C;  1JKO C;  5F04 A;  3O2P E;  4M3E A;  3NRO A;  1POG A;  2RNJ A;  1VQP I;  1YI2 I;  1QP4 A;  2RRE A;  2DTR A;  3L2R A;  3LMM A;  4P9U A;  1MMN A;  4RLF A;  2EIL H;  4BGD A;  1EFA A;  3GFL A;  1N77 A;  2XAH A;  2YU3 A;  4ENM A;  3W6J B;  1W5S A;  3PO3 J;  3LSI A;  2DA4 A;  2K7L A;  5J1R A;  3S1N J;  2ZBK A;  2GBY A;  2KHM A;  4M9S A;  3K4M A;  3WTW C;  2W82 A;  1LVA A;  1XTA A;  3CCL I;  2P0W A;  1S29 A;  3F8F A;  3LA3 A;  3R6S A;  3J7A O;  2FJR A;  2GRL A;  3KYL A;  4DOZ A;  5HNH A;  4ZTF A;  2V1U A;  3BQY A;  3ERE D;  2V1X A;  1QZE A;  2KRF A;  1X1B A;  2FFH A;  3BZC A;  4IVZ A;  4CIC A;  3BTL A;  3KZ3 A;  5LEK A;  3OP9 A;  2HU9 A;  5FKK A;  4BUP A;  3QPT A;  2EV6 A;  5LRS A;  1Y1V J;  2F4M B;  4ASN A;  1FY7 A;  2L1P A;  2LG4 A;  2Q1Z B;  3SZP A;  2AQE A;  1B72 A;  1K78 A;  3I53 A;  5GAH J;  2K9L A;  3FK7 A;  4CXF A;  1PDN C;  1XG1 A;  2M45 A;  3FBN B;  2CGP A;  2PUG A;  2BNM A;  2MD0 A;  4YG2 F;  4AID A;  5J4Y A;  2WUS R;  4J1X A;  4BEH A;  3SDG A;  2VUM J;  2X51 A;  5L3B A;  4A3E J;  1IUF A;  5LHI A;  3L00 A;  2COM A;  1KON A;  1BC8 C;  5DV5 A;  2NNN A;  4XRM A;  3GO5 A;  5DD4 A;  1UMQ A;  4PJJ A;  1O3T A;  3ISP A;  3FYM A;  2IJL A;  4L5J A;  5IPA A;  1LE8 B;  1PUF A;  1A36 A;  4YFK F;  2XV4 S;  4P1W A;  2E5N A;  2VKE A;  3G4S I;  3DU5 A;  3BR6 A;  4XKB A;  4PU7 A;  4A0Y A;  2BY1 A;  2WB1 A;  2ETH A;  5M5Y J;  4C9Y A;  3F21 A;  2DA5 A;  2KFD A;  2EF8 A;  4FAS D;  4ESB A;  4L5E A;  4A0X A;  2B0L A;  3BR5 A;  4CUG A;  1ZRE A;  2L2O A;  3H36 A;  3QWG A;  2CUJ A;  4G7O F;  1RPE L;  1FX7 A;  4X0G A;  1MBJ A;  3U1D A;  2HVS A;  1DPR A;  2XAS A;  3ZQF A;  2V79 A;  1DQU A;  3FXM A;  4UVA A;  4NHJ A;  1YG2 A;  4EAT A;  2OV7 A;  1KZH A;  4MQV A;  2K9M A;  4PJ0 C;  1H0M A;  1U3E M;  2BVL A;  1N75 A;  4NBQ A;  1D8K A;  2HSG A;  4F8D A;  5M3F J;  1IXC A;  3TQN A;  3UWP A;  3AFH A;  3I56 I;  2X1C A;  4NB5 A;  3GTL J;  3C3W A;  1JUS A;  1YE9 A;  4FX0 A;  3BD1 A;  2F6C A;  4MO7 A;  4YRV A;  1U78 A;  1F36 A;  2PUB A;  3OYE A;  2FUG 2;  1WJD A;  2VJJ A;  2V1N A;  3DLA A;  4A3I J;  1F1Z A;  1ZGJ A;  1NG6 A;  2LNB A;  3MKW B;  4RGX A;  2LMD A;  4BQO A;  1IGN A;  2CV2 A;  3G3Z A;  4XSZ F;  2O4A A;  2IVG A;  3EUH A;  2WWY A;  4W1U A;  2E2H J;  2VKD A;  1O4X A;  5CVV A;  3HXL A;  2DQR A;  3ABU A;  4KFC A;  2QVO A;  3E6M A;  3L2V A;  1RPW A;  2CYY A;  4MFE A;  2NOG A;  4BH9 A;  1RIO H;  4D5F A;  4BQA A;  1R1T A;  5L3F A;  2IVQ A;  2EB7 A;  4LK1 F;  2VBW A;  4BU2 A;  4M9X A;  4D7N A;  2JK3 A;  2XRO A;  1AU7 A;  1IXS B;  3S2D J;  5FLM J;  2XGC A;  4M72 A;  3WHC A;  1FIP A;  3QPH A;  3GBG A;  2J7U A;  2HKO A;  2QBY A;  1I50 J;  3QP5 A;  3KET A;  4AVZ A;  2NS0 A;  1T95 A;  2JVG A;  3OYM A;  4EQZ A;  3OQO A;  3EQL F;  1QQI A;  4X4H A;  4BJT A;  5DCM B;  1RR7 A;  3VDX A;  2O38 A;  1PNR A;  2COB A;  4MGR A;  2QM3 A;  3HRU A;  2XAU A;  2JA5 J;  3S1M J;  1RZR A;  2OAZ A;  2DJN A;  3JR9 A;  4ZYD A;  1L3L A;  2MYS A;  4O6J A;  4BY1 J;  4L9J A;  4RA2 A;  1PJR A;  1YIJ I;  2J7W A;  3H0G J;  1YHQ I;  3RIR A;  1QNT A;  2ZME B;  4EGZ A;  3PM1 A;  3PFI A;  1RUO A;  1K78 B;  1ORK A;  1J7K A;  1ZR4 A;  2WAE A;  2Y30 A;  3U2R A;  2FF4 A;  1GHC A;  4XRS A;  2BYV E;  2CFX A;  4BE0 A;  4RM3 A;  1X2M A;  3H35 A;  2CRG A;  3GWZ A;  2M0C A;  3BPX A;  3MZY A;  4G6T B;  2G7U A;  2M1B A;  2M7B A;  3AKZ A;  3FXL A;  3S3M A;  1DUL A;  1U2W A;  1QZX A;  3ZQG A;  4U7D A;  1UHW A;  3WG7 H;  2K4B A;  3R60 A;  4GFB A;  3JSP A;  1OCP A;  3FMS A;  5E8G A;  2LBF A;  2UV1 A;  4KUM A;  2XIU A;  1D1C A;  1RKW A;  5DTM A;  3KP4 A;  5EEH A;  2HIN A;  2VC1 A;  3VOD A;  3WG9 A;  2VOP A;  3K6G A;  5F0F A;  4UVC A;  3K4K A;  5FKO A;  2GXA A;  1VI0 A;  2F5D A;  2NS7 A;  2R7W A;  4UUV A;  2NVT J;  1LEA A;  5HS9 A;  2L4M A;  3H3U A;  2LSO A;  4GCV A;  4UXN A;  5CPR B;  4P96 A;  3QWL A;  1TL8 A;  2EZH A;  2LKP A;  2GQQ A;  2E5Z A;  3JRH A;  2DMQ A;  1LQ1 A;  3O9X A;  3LA7 A;  2HOA A;  3TBI A;  4BHB A;  5E3M A;  4NC6 A;  1OCT C;  4G8X A;  4FE7 A;  2FA5 A;  3UFD A;  2K02 A;  5F1R A;  1S72 I;  2ICP A;  1U5T B;  2PI0 A;  4KDP A;  3E5Q A;  5LD2 C;  1JWL A;  1YX5 A;  3PIO F;  2BXY A;  4EJU A;  2QQ8 A;  4HNU A;  4KYW A;  1X58 A;  1I1G A;  1P4W A;  1NEQ A;  1FNN A;  1FOW A;  3H5N A;  3I4M J;  2LLV A;  4PJL A;  4XR6 A;  1SD6 A;  3O6B B;  1YS7 A;  4E7J A;  4ITV A;  4XLE A;  3GZ5 A;  4N4O B;  2R7F A;  1Y6I A;  3MKZ A;  4R79 A;  1JFT A;  3L7W A;  1IN7 A;  2ZSI B;  3TOB A;  3O3K A;  1GXQ A;  2XB5 A;  1P6R A;  2AW6 A;  3CF2 A;  2G9W A;  5DYM A;  2DW4 A;  5GAE J;  4M71 A;  1UG0 A;  2ME0 A;  3BG7 A;  4EKG A;  3I9V 2;  2MAB A;  2PMZ N;  1Q1V A;  4DNC A;  1MIJ A;  4OAZ A;  1H89 C;  2ZXI A;  2F2E A;  2KRH A;  2R7T A;  4YIF A;  4ZDO A;  2KIF A;  4EJO A;  2NOJ B;  1MJ9 A;  4HX8 A;  1BW6 A;  1WH6 A;  4MIM A;  2DK5 A;  4NNJ A;  3QYB A;  4P5O A;  3CJT B;  4IX7 A;  1ON1 A;  2HCN A;  1BDI A;  4CCM A;  2EWN A;  4AWX B;  1J09 A;  1CGP A;  1YQA A;  4B44 A;  2CH0 A;  3ZQL A;  1ACI A;  1IV8 A;  2ZJP F;  1OCC H;  1ZR2 A;  2A6H F;  2FMY A;  2ADU A;  4J01 A;  1IV6 A;  2DK8 A;  1T08 B;  3QQA A;  3HL2 A;  2XIG A;  2D45 A;  1RIO A;  1TNS A;  4HEA 2;  1HKQ A;  2DQL A;  4AIK A;  4XN3 A;  3ML6 A;  4U7B A;  5DRY A;  4U0W A;  2BNO A;  3QOW A;  3HC7 A;  1V5G A;  2XAQ A;  1NTC A;  2IP2 A;  2AXT C;  5HDG A;  4CCK A;  1R71 A;  3L2C A;  4E7I A;  3GTG J;  3BZK A;  1ENH A;  1OLT A;  4HLY A;  5D4R A;  3QF3 A;  1T38 A;  5CQE A;  1NK2 P;  1D3Y A;  3LSR A;  2E1N A;  4XKW A;  2JN6 A;  1IRX A;  1O3R A;  2HDC A;  4PU4 C;  3HKZ A;  5IYD J;  4E4H A;  4Q5S F;  1EF4 A;  5DTD A;  3JRB A;  3SX0 A;  3H9J A;  5DEQ A;  2M2E A;  3R09 A;  3S93 A;  4U87 A;  2LYC A;  4XLN F;  3L09 A;  1QZY A;  1RRJ A;  2VC0 A;  3RPU A;  1MMD A;  1WWX A;  1SEU A;  1WCM J;  3FXU A;  2LBF B;  3CUO A;  1JT6 A;  2H1L A;  4ZYA A;  2CW7 A;  5JI6 A;  3BZ6 A;  1TW3 A;  5EG0 B;  2VQL A;  5TGT A;  5GAH i;  1PYV A;  2ID3 A;  1BW5 A;  2VEO A;  1LEB A;  3BG9 A;  2DDA A;  2MC3 A;  2VLA A;  2HDD A;  1JHF A;  3F23 A;  2NVQ J;  3CD6 I;  2O49 A;  4RMN A;  2VOO A;  1TP4 A;  2E1M B;  1NHA A;  4YII A;  4MHG A;  2KPM A;  3OOU A;  4Q2J A;  2DFI A;  2LRE A;  4IF4 A;  4Q47 A;  2Z33 A;  2JA7 J;  3PQK A;  4JCY A;  4XLH A;  5M5W J;  1PRV A;  2X0L A;  5C44 J;  5EGO B;  3BG3 A;  1QVU A;  2DLL A;  4JBA A;  3M7G A;  3TDU C;  4FTH A;  3TFL A;  3SZG A;  1BM9 A;  1X3U A;  2BW3 A;  2LD5 A;  4HF0 A;  2KEK A;  4E7H A;  1SFO J;  5H20 A;  5DD8 A;  2X6X A;  4A3L J;  3F6V A;  4QIW N;  1ZEL A;  4OU0 A;  4C30 A;  1KU2 A;  2IS4 A;  5DM7 F;  5FLX K;  4OIR F;  3DF8 A;  2QLZ A;  4Y42 A;  2FU4 A;  2BEO A;  1BIA A;  3B6C A;  2DT7 B;  3CP2 A;  4BE1 A;  3RQI A;  3M8J A;  4I99 C;  2R5Z A;  2DOA A;  5HS7 A;  1PVE A;  3LIS A;  1MSE C;  3PXP A;  1FBQ A;  2ZO4 A;  3M9L A;  4NC8 A;  4HDV A;  2GIV A;  3K10 A;  4LG0 B;  2M34 A;  2RAE A;  1MJA A;  1MW7 A;  4RAF A;  4UVB A;  1EA3 A;  4DZP A;  4E6K G;  1NK3 P;  4HF1 A;  3HB9 A;  3DPL C;  2HVR A;  4I6T A;  2FE3 A;  4B8X A;  3S15 J;  3P7N A;  1WRJ A;  4EM0 B;  3DQV C;  3M9A A;  3QOD A;  4IL6 C;  1V5F A;  5L3C A;  2GOX B;  2HZT A;  1BI3 A;  4PUS A;  3T1B A;  3LFP A;  1TBX A;  5B5E C;  4FQG A;  1XCV A;  5EZH A;  1EKE A;  3ZMD A;  2DOF A;  3J7Z I;  2VJI A;  4WXC A;  2VB6 A;  5D8K B;  2E71 A;  4BQQ A;  1HF0 A;  1Y1W J;  1M1E B;  3SZT A;  1DU6 A;  5FKM A;  4YAR A;  5KCM A;  5E3N A;  2Z5U A;  1PRA A;  3Q0W A;  2KZV A;  4A3C J;  1UZC A;  1CF7 B;  4WF2 A;  1JT0 A;  4CCL A;  3OYL A;  5HLI A;  4HX4 A;  1HLV A;  3I71 A;  1HW5 A;  2QYO A;  1HC8 A;  1RES A;  4FCY A;  3S17 J;  1FBS A;  3E0J B;  1RZS A;  2QSF X;  2VN2 A;  5E8I A;  2XAG A;  3BR3 A;  5H2F C;  2DTZ A;  2GIZ A;  4XON A;  5DUK A;  2XGX A;  4KT5 C;  2K5C A;  1JJ8 C;  1VQ6 I; 
#chains in the Genus database with same CATH homology
 3QPL A;  3JRA A;  2KZ8 A;  1QRY A;  2MGQ A;  1JKO C;  2HOS A;  5F04 A;  2LP0 A;  4M3E A;  4C3J J;  4CYC B;  4ABZ A;  1POG A;  2B63 J;  1QP4 A;  1WIZ A;  1BDH A;  3IV5 A;  1TWH J;  2O7O A;  4YBA A;  1VFC A;  4M3G A;  1EFA A;  5FJ8 J;  1FTT A;  1MBG A;  5IOY A;  3SCF A;  3SFI A;  2E2I J;  3GTM J;  3SCG A;  3TW6 A;  2JWT A;  1JTX A;  1ZZ6 A;  3RZZ A;  3KXA A;  3HBL A;  3MVP A;  2L9R A;  2DA4 A;  4JX5 A;  5J1R A;  3S1R J;  3PO3 J;  3S1N J;  2GBY A;  2GRM A;  2CUF A;  1CQT A;  4JX4 A;  1OFC X;  2CJJ A;  2GRL A;  1DW9 A;  2EH3 A;  2FJR A;  1JKR C;  1ZZ7 A;  2MSY A;  2KT0 A;  3BQY A;  2MG4 A;  1Z77 A;  1RET A;  2Y31 A;  1JKP C;  4D5C A;  4IVZ A;  2M9H A;  3BTL A;  3KZ3 A;  3OP9 A;  3ZKC A;  3LSG A;  4C3I J;  5FKK A;  1MBH A;  4JYK A;  3TED A;  4NDW A;  1Y1V J;  3W6V A;  3E7L A;  2XPW A;  1JUM A;  2AO9 A;  1B72 A;  1CJG A;  3Q0U A;  4X4E A;  1ETK A;  2IVB A;  3DNV B;  4M3B A;  1ZZC A;  2OPT A;  3FK7 A;  2AHQ A;  5IYC J;  1XG1 A;  3JRI A;  2PUG A;  2BNM A;  2WUS R;  1POU A;  1Y7Y A;  4J1X A;  2X6O A;  3K7A J;  3TW7 A;  2VUM J;  3SDG A;  3BDN A;  2ECB A;  1MH3 A;  2FX0 A;  1L1M A;  2L7F P;  4A3E J;  1IUF A;  3Q0V A;  2ZB9 A;  5IP7 J;  4XRM A;  1UMQ A;  1YSE A;  3SCH A;  1I3Q J;  3FYM A;  5C4X J;  2EZL A;  5IPA A;  1LE8 B;  2R5Y A;  1PUF A;  3OIO A;  2FD5 A;  3SJM A;  2VKE A;  3HKZ N;  3OMT A;  1FIA A;  3BR6 A;  4A3B J;  3ZHI A;  4XIC A;  1AKH B;  2OFY A;  4A3K J;  3RKQ A;  4PU7 A;  3EUS A;  5C4J J;  5M5Y J;  1AHD P;  3PO2 J;  2MQK A;  5M5X J;  3HGG A;  2DA5 A;  2EF8 A;  4Z59 A;  2IV1 A;  4L5E A;  3JRF A;  3BR5 A;  2LYQ A;  3QWG A;  1DWK A;  1GUU A;  1RPE L;  4JP0 A;  1MBJ A;  1ETY A;  3ZQF A;  3OSF A;  3LSP A;  4PU3 C;  1JGG A;  1LCD A;  2JA6 J;  4B3A A;  2HSG A;  4F8D A;  5M3F J;  4YG4 A;  1E3O C;  2D5V A;  1ZZ8 A;  4A3F J;  3FYA A;  3GTL J;  1RZR D;  1JUS A;  2L7Z A;  3BD1 A;  1VF9 A;  4MO7 A;  4BBR J;  1U78 A;  4Y7N J;  1F36 A;  2TCT A;  2PUB A;  1WH5 A;  3CLC A;  3ZOB A;  2KEI A;  1U9O A;  5GPC A;  4A3I J;  5JLX A;  3H3V K;  3GN5 A;  2JVL A;  4Z5D A;  2LTP A;  4OB4 A;  2XB0 X;  4QSH A;  2LYR A;  2XCJ A;  2LYS A;  1IGN A;  1QQA A;  1H88 C;  2DMN A;  4A3G J;  3BQZ A;  2O4A A;  1ITY A;  2IVG A;  3A03 A;  4A3M J;  1JH9 A;  4IHX A;  4W1U A;  3IH3 A;  2E2H J;  1O4X A;  1B72 B;  3BTI A;  2XGD A;  3Q3S A;  2K9S A;  5EF6 A;  1MSF C;  4W97 A;  2XJ3 A;  2CU7 A;  2ME6 A;  2DA3 A;  2YU9 J;  1X57 A;  4FBI A;  1RPW A;  4LOC A;  4MFE A;  2NOG A;  1ZZB A;  1G2H A;  3RZO J;  2NS8 A;  1JFS A;  2X9D A;  4D5F A;  5J1Y A;  4GQM A;  2IVQ A;  4D7N A;  2HXI A;  4Z5C A;  4DZJ A;  1MBE A;  1XC5 A;  2JK3 A;  3A01 B;  2MEZ A;  3JRE A;  4I6Z A;  1JUP A;  3TP3 A;  1AU7 A;  4D7M A;  3S2D J;  1T56 A;  5FLM J;  2XGC A;  3WHC A;  2WB1 N;  1FIP A;  3ZQH A;  3GBG A;  1QQB A;  1QP7 A;  1I50 J;  1B8I B;  1SAN A;  5EG0 A;  3HOW J;  1WH8 A;  3OQO A;  2R92 J;  2LYL A;  1I6H J;  4X4H A;  4M3D A;  2IU7 A;  4B1R A;  1IDY A;  1RR7 A;  4CYC A;  2O38 A;  1B8I A;  2COB A;  2JA5 J;  3S1M J;  2JCG A;  2R1J L;  1RZR A;  1PNR A;  2XI8 A;  3BS3 A;  1HDP A;  3S2H J;  2LY9 A;  1ZVV A;  1K61 A;  2DJN A;  3JR9 A;  3MKL A;  2HQ5 A;  1U8B A;  4BY1 J;  1LQC A;  2NVY J;  3H0G J;  1P7J A;  2IAI A;  3G1O A;  1VPW A;  3ZHM A;  3PM1 A;  1ORK A;  2PPX A;  5FKL A;  1ZR4 A;  2Y30 A;  4BY7 J;  1T33 A;  2EQR A;  1JJ6 C;  4XRS A;  5F08 A;  1X2M A;  3MLF A;  4X4D A;  1K83 J;  5A7L A;  4X1E A;  1ZTR A;  3O9X A;  1Z0X A;  2CRG A;  2M0C A;  2VKV A;  1UXC A;  4X4F A;  2KEJ A;  4XK4 A;  3H5T A;  1ETW A;  3ZQG A;  1D5Y A;  2HOT A;  3CRO L;  1ZQ3 P;  1PER L;  3LNQ A;  4GFB A;  2EBY A;  1OCP A;  2WAQ N;  2B5A A;  3GN5 B;  2XIU A;  1QPI A;  2TRT A;  1MH4 A;  3R1F A;  1RKW A;  4Z5H A;  2L0K A;  5E3L A;  3TP0 A;  2R93 J;  1XWR A;  4IEJ A;  4RDU A;  1ZUG A;  2HIN A;  2AXV A;  2LYJ A;  2XRL A;  4IA8 A;  1GV5 A;  2OR1 L;  2N8G A;  1H8A C;  2JJ7 A;  4DYC A;  1WET A;  5F0F A;  5FKO A;  1ADR A;  3VK0 A;  3JXD L;  4I6R A;  5IOZ A;  1VI0 A;  2DMT A;  3LOC A;  2NS7 A;  2NVT J;  4AC0 A;  2XPV A;  2K9Q A;  1GV2 A;  3I4N J;  2EZH A;  1ETV A;  3GTO J;  3FMY A;  2R5Z B;  4UUS B;  1BL0 A;  2KPJ A;  3JRH A;  4M6V A;  2DMQ A;  2EBI A;  4XID A;  1YRN A;  3WHB A;  2AXU A;  2HOA A;  2XGE A;  2Y9Y A;  3CQZ J;  1ZGW A;  2L7M P;  3OQM A;  5K7H A;  4V2F A;  5E3M A;  1MBF A;  5F27 A;  1OCT C;  2A6C A;  4FE7 A;  1TWG J;  3HOX J;  4X4G A;  2R7Z J;  3UFD A;  3FIS A;  2ICP A;  4JX6 A;  4M3F A;  3BR0 A;  1B0N A;  1JWL A;  1ZAY A;  2IUO A;  3KJX A;  1X58 A;  1MNM C;  2VPR A;  1WI3 A;  3A02 A;  1NEQ A;  2QF7 A;  1F43 A;  3I4M J;  1UHS A;  2CQX A;  9ANT A;  1WGX A;  3FK6 A;  3D1N I;  2IBD A;  3G1M A;  2JMW A;  2L49 A;  1ETO A;  4IWR A;  2DA2 A;  4BBS J;  3S8Q A;  1APL C;  1W0T A;  2OF7 A;  1OJL A;  1LLI A;  2NVX J;  5F0H A;  3FKI J;  3BR2 A;  2LLK A;  1HDD C;  4MLO A;  1JFT A;  5FLV A;  1NER A;  1VND A;  4Y52 J;  2YS9 A;  4JCX A;  2XB5 A;  2AW6 A;  3F0C A;  2ME0 A;  2P81 A;  3IVP A;  2PMZ N;  1Q1V A;  2AUW A;  2EZK A;  1MBK A;  1ZKG A;  3G7D A;  3K2A A;  1AKH A;  4A3J J;  1LMB 3;  1H89 C;  1QP0 A;  1ZK8 A;  2LKX A;  4I76 A;  1R9T J;  3F52 A;  3CDL A;  1IDZ A;  4X4B A;  1JTY A;  3L1P A;  1LFU P;  2QCO A;  2PIJ A;  1BW6 A;  1WH6 A;  4MIM A;  1YRN B;  3HDD A;  2X48 A;  2E2J J;  3VPR A;  3BG5 A;  3FIW A;  1BDI A;  2LYP A;  3G5G A;  2HXO A;  3ZQL A;  1PUF B;  1LFB A;  4XRS G;  1ZR2 A;  4I6U A;  1IV6 A;  3GTP J;  2BJC A;  2FJ1 A;  3QQA A;  2PUD A;  1RIO A;  1ZPQ A;  3HOU J;  2Y9Z A;  5EDN A;  3DCF A;  1TWF J;  4AUX A;  2CRO A;  2BNO A;  3DEW A;  5E3O A;  1DU0 A;  2L8N A;  5IP9 J;  3QQ6 A;  1OSL A;  1NTC A;  1UTX A;  1QVT A;  3GTK J;  1UG2 A;  3S16 J;  3IH4 A;  5GP9 A;  1SQ8 A;  2DMP A;  4A3D J;  3GTG J;  2R0Q C;  1ENH A;  5DS9 A;  1RKT A;  3QF3 A;  5M3M J;  3LSR A;  1NK2 P;  2KDZ A;  2CSF A;  2JN6 A;  1BJZ A;  5IYB J;  1IJW C;  5HOD A;  4PU4 C;  1IG7 A;  5IYD J;  1EF4 A;  2R5Y B;  2PUC A;  1ETQ A;  5DTD A;  3JRB A;  2M2E A;  2DN0 A;  2O8K A;  4UUT A;  1U9N A;  2DMU A;  4GHJ A;  1WPK A;  4B4C A;  4X4C A;  2LK2 A;  3F51 A;  1ETX A;  1FJL A;  1WCM J;  4QTR A;  4FE4 A;  1JT6 A;  1LE8 A;  1TC3 C;  2IEK A;  4HNV A;  4J1W A;  4IHV A;  3NAU A;  3OQN A;  1GT0 C;  5EG0 B;  5J1U A;  3O8H A;  2VI6 A;  5BNG A;  3A01 A;  2ID3 A;  4S0H B;  5EGO A;  1BW5 A;  3JRC A;  1TWA J;  2XPU A;  3BG9 A;  2HDD A;  1FTZ A;  4EEF G;  2BNN A;  3C2B A;  4NDL A;  1HOM A;  2GM4 A;  2NVQ J;  2O49 A;  3OSG A;  2EZI A;  2LVS A;  3GTJ J;  3OOU A;  5K7Z A;  2JA7 J;  4DYQ A;  2ECC A;  4JCY A;  2M8G X;  5M5W J;  1PRV A;  2O9L A;  2ID6 A;  5C44 J;  5F0C A;  5EGO B;  3BG3 A;  4C2M J;  1LCC A;  1QVU A;  4V2G A;  1Y9Q A;  4X4I A;  2MW8 A;  4FTH A;  2H8R A;  4BKX A;  2LYK A;  3UKG A;  2R63 A;  1HCR A;  3HEF A;  2LD5 A;  2KEK A;  1R69 A;  2AWI A;  1UXD A;  3GTQ J;  1SFO J;  3O8G A;  2PUA A;  4IHY A;  4BXX J;  2E1O A;  4A3L J;  3HOY J;  3JXC L;  4QIW N;  1GVD A;  5F1J A;  1ZS4 A;  2HI3 A;  1PRU A;  3B7H A;  3BT9 A;  4RBO A;  4DW6 A;  4MCT A;  4MCX A;  3GBF A;  3CEC A;  4Y42 A;  2K9N A;  2CUE A;  2HYJ A;  3B6C A;  4YG1 A;  4JQD A;  2JA8 J;  3M4O J;  3LSJ A;  3RQI A;  3QYX A;  2G0E A;  2YUS A;  4X6A J;  2PE5 A;  2R5Z A;  5EZG A;  2PUE A;  4YG7 B;  3LIS A;  1MSE C;  2CQQ A;  2DA7 A;  1W0U A;  3PXP A;  3U3W A;  4A69 C;  4I8T A;  3IH2 A;  2GLO A;  4A93 J;  2M34 A;  2RAE A;  2XSD C;  1TWC J;  1X2N A;  4DZP A;  1NK3 P;  3HB9 A;  1IRZ A;  2PUF A;  5GPA A;  2H1K A;  4I6T A;  4IHW A;  1A5J A;  3S15 J;  2WV1 A;  4FIS A;  3S1Q J;  2ICT A;  2DA1 A;  3HZI B;  1WH7 A;  2K40 A;  3JRG A;  4AYB N;  3G1L A;  3F6W A;  4Z58 A;  1QPZ A;  3LFP A;  2E19 A;  3TRB A;  5EZH A;  4O8B A;  4DYR A;  3B6A A;  1JKQ C;  3M3Y J;  5EYR A;  1X2L A;  3BTC A;  1A6I A;  2WIU B;  3HM5 A;  1BA5 A;  1GDT A;  1HF0 A;  3ZQC A;  1IC8 A;  1Y1W J;  5EEA A;  5JLW A;  3CCY A;  1DU6 A;  5FKM A;  4J19 A;  3BR1 A;  3JRD A;  3ZQI A;  4FN3 A;  1S7E A;  4UUS A;  5E3N A;  4YAR A;  4C3H J;  1FEX A;  3Q0W A;  1PRA A;  4A3C J;  2W48 A;  5IP6 A;  1JT0 A;  3NAR A;  2LR8 A;  4MFD A;  2Y0S N;  5FKN A;  1XS9 A;  3JXB C;  1HLV A;  5J3L A;  2AXZ A;  3HGY A;  1RES A;  4FCY A;  3RZD J;  2ELK A;  3S17 J;  1R63 A;  3MN2 A;  5K7F A;  2FQ4 A;  3CMY A;  1RZS A;  3S14 J;  2Y2Z A;  4PU8 A;  2EWT A;  5C3E J;  3BTJ A;  3HOV J;  1P7I A;  2DA6 A;  3QPS A;  2LFB A;  3BR3 A;  5K98 B;  4G12 A;  2DTZ A;  2LCV A;  2GZU A;  1ZZ9 A;  3HOZ J;  1JJ8 C;  2I10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...