1E3OC

Crystal structure of oct-1 pou dimer bound to more
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
160
structure length
132
Chain Sequence
b'EEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMSKLKPLLEKWLNDAEKRTSIETNIRVALEKSFMENQKPTSEDITLIAEQLNMEKEVIRVWFSNRRQKEKRIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*TP*GP*CP*AP*TP*GP*AP*GP*GP*A)-3'
publication title Differential Dimer Activities of the Transcription Factor Oct-1 by DNA-Induced Interface Swapping
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 44
structure length 132
sequence length 160
ec nomenclature
pdb deposition date 2000-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00046 Homeodomain Homeodomain
C PF00157 Pou Pou domain - N-terminal to homeobox domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1e3oC02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1e3oC01
3M3YJ 3JRAA 2VKVA 3G1LA 3LSJA 1QVUA 1QP0A 2GM4A 1H8AC 3JREA 2PUDA 3OQNA 4W1UA 3S17J 4D7NA 1RKWA 3FIWA 1OCTC 3Q0UA 2E1OA 3JRIA 1WH7A 2DMTA 2L49A 3PXPA 3OIOA 5A7LA 2DA3A 2XCJA 2XIUA 1FJLA 2JK3A 2Y2ZA 3W6VA 4I6UA 4DYQA 3B6CA 3HEFA 1Y7YA 2EF8A 2N8GA 1WGXA 2CUFA 5F08A 3BTIA 3HB9A 4X4IA 1MSEC 2NVTJ 3BTCA 3S8QA 1XC5A 1Y1WJ 3QPLA 1F43A 5IP6A 3BR5A 3M4OJ 4BXXJ 2MEZA 1MBFA 2HOAA 1WH5A 3MKLA 1DWKA 1LLIA 3E7LA 5C44J 3GBGA 4NDLA 3LFPA 5DS9A 2X9DA 1K61A 3SCHA 1ETKA 4I6TA 4X4HA 3F52A 2MW8A 3LSRA 4J1WA 1IDYA 1AU7A 5DTDA 5F27A 5JLWA 4M3DA 4GQMA 4G12A 4A69C 3FYAA 3L1PA 1MBEA 4A3JJ 3GTKJ 2PUBA 1ETXA 1X57A 1EF4A 1MNMC 2LCVA 2M2EA 4CYCA 3SCFA 1WIZA 2H1KA 5EGOB 3BDNA 1IJWC 1D5YA 2AWIA 4JYKA 2LYQA 2PIJA 1RZRA 1ZZCA 5E3LA 4Z5DA 3JXDL 1PRAA 3ZQGA 2NS7A 3F6WA 3F0CA 1IRZA 3KJXA 1WETA 2BNNA 1ZR2A 2LYLA 4S0HB 2JWTA 3HOYJ 2LP0A 2XPWA 1JFSA 2ID6A 3HKZN 3I4MJ 1ZZ6A 1VNDA 5EDNA 2HQ5A 3GN5A 3OP9A 4X4CA 3Q0VA 1MBJA 3OSFA 4L5EA 1T33A 3GTMJ 2DMUA 4GHJA 4BBSJ 1T56A 4A3FJ 1WH8A 2LKXA 1GV5A 2P81A 5J1UA 4FE4A 2KPJA 4OB4A 2E2JJ 3CQZJ 3IH3A 1F36A 2EZKA 2L0KA 4DW6A 1VFCA 4PU3C 2PE5A 3F51A 3H3VK 3D1NI 2DJNA 1PUFA 1RPEL 2MSYA 3BR0A 3LSPA 5HODA 1GT0C 5EG0B 4X4DA 2H8RA 3B6AA 1VI0A 2EQRA 2Y31A 5FJ8J 1YRNA 3HOZJ 2R5YB 3BQYA 4I6ZA 4J1XA 2RAEA 1ITYA 3RZDJ 4BY7J 5GP9A 3BTLA 1IG7A 1MSFC 3ZHIA 2LFBA 1BW5A 2DA4A 1JTYA 3EUSA 1RZRD 2IV1A 2LYSA 4XRMA 1B0NA 3QYXA 4JP0A 1DW9A 3HZIB 2COBA 3TEDA 3LOCA 2PUAA 2BJCA 3PO3J 3R1FA 5K7HA 1AKHB 4M6VA 2BNMA 2XJ3A 3CDLA 4C3JJ 3ZOBA 1ORKA 1TWGJ 5J1YA 2R5ZA 1RESA 9ANTA 2LD5A 4Z58A 2KEIA 1QQBA 3GBFA 2W48A 2NVQJ 2FJRA 2OPTA 3FISA 1IDZA 1POGA 1LCCA 1OJLA 4MCXA 1X2LA 4MIMA 4UUSB 4Y7NJ 2BNOA 1FTZA 1UHSA 1RKTA 1WI3A 1ADRA 4RBOA 3LISA 2L7ZA 2LY9A 1L1MA 3I4NJ 2FQ4A 3B7HA 3WHBA 2MGQA 3A02A 3O8HA 5FKNA 1QPIA 2HDDA 3FKIJ 3DEWA 4PU8A 2XRLA 3FK6A 2LR8A 2AHQA 4IHWA 2O4AA 3S1QJ 3H5TA 2LYPA 1TWHJ 2R0QC 1H88C 1ZUGA 1ETYA 2CQQA 4V2FA 2CSFA 1IV6A 3SCGA 3BR1A 3QWGA 2EZIA 2CUEA 1LE8A 5EYRA 2E2IJ 3PM1A 1NERA 3VK0A 2HXOA 2O7OA 4C3HJ 5F04A 1UXCA 4MFDA 4A3MJ 3IH2A 4M3FA 1BA5A 3G1MA 2DMPA 4I76A 5M5WJ 3ZQLA 2XPVA 1NEQA 3CROL 1U9OA 4BBRJ 2Y9ZA 5M5YJ 1B72B 4YG7B 2JJ7A 1JKQC 1U78A 4Z5HA 2PPXA 1Y9QA 4FISA 3ZQCA 2K40A 5C3EJ 1POUA 1ZVVA 1BW6A 3TP0A 2O9LA 3S1MJ 2B5AA 2Y30A 5FLMJ 4JX6A 1GUUA 3HBLA 2XB0X 4W97A 2OR1L 3UFDA 3GTLJ 5FLVA 3SJMA 1IUFA 3GTOJ 4IHYA 2DA5A 1ETOA 3TP3A 4AUXA 1ENHA 2IVQA 3HOUJ 3S16J 4A3BJ 4LOCA 2AW6A 3OQOA 3IVPA 3JRBA 3HOVJ 2R63A 4XRSG 2LTPA 5FKLA 2DTZA 3LSGA 1PNRA 1VF9A 1BJZA 1PERL 2TCTA 2VI6A 1FIAA 1NTCA 5C4XJ 1JGGA 4FBIA 2ICPA 1UTXA 1I50J 4DYRA 2XSDC 4YARA 2CRGA 3BG5A 2XB5A 1I6HJ 2AUWA 3LNQA 2CROA 2EWTA 2JVLA 4IEJA 1JT0A 1CQTA 1JJ8C 1JT6A 2IBDA 5JLXA 1SQ8A 4C3IJ 3SFIA 3CLCA 1DU0A 4XICA 1ETQA 2L7FP 1B8IA 1R9TJ 1EFAA 3QF3A 1QPZA 4Y52J 4M3GA 1BL0A 2IEKA 2XGCA 3A01A 4IVZA 1SFOJ 2R93J 2E19A 3A03A 5K7ZA 2EH3A 5FKMA 2ICTA 2MQKA 5IOYA 2PUCA 5EZGA 2YUSA 2D5VA 3RQIA 3O9XA 1H89C 3ZQHA 1UXDA 1GV2A 5J3LA 3GTQJ 4PU4C 1DU6A 3BTJA 2R1JL 4IHXA 2WV1A 3BT9A 2HXIA 2JN6A 3DCFA 2YU9J 3QQ6A 2TRTA 4X6AJ 2LYJA 2XGDA 4FCYA 5F1JA 1QP7A 3CCYA 3ZQIA 3S1RJ 1ZZ7A 1JFTA 2JMWA 1MH4A 5FKOA 2PMZN 3K2AA 1LQCA 2K9NA 3DNVB 2IVBA 1QVTA 1XS9A 1BDIA 1TC3C 2XGEA 1JUSA 2WB1N 3IH4A 4UUTA 4JX4A 5IYDJ 3OMTA 1ZKGA 2K9SA 3FK7A 4BKXA 1HF0A 4IWRA 3HGGA 2OF7A 2DA1A 4A3LJ 2FX0A 5IPAA 2NS8A 1JKPC 1LMB3 3G5GA 4RDUA 4J19A 2EZLA 2DMQA 3JXBC 5F0HA 1S7EA 3CMYA 3JR9A 2JA5J 3U3WA 2EBIA 4MFEA 2ID3A 3MVPA 4D7MA 5K98B 3G7DA 2AO9A 1JJ6C 2A6CA 1G2HA 4XK4A 2FJ1A 1HCRA 1JUMA 2K9QA 5EGOA 4I8TA 2WAQN 2PUEA 1TWAJ 4XIDA 1ZR4A 1I3QJ 2HOTA 4CYCB 4QSHA 3G1OA 2Y0SN 2L7MP 4QIWN 5E3NA 3UKGA 2LYRA 2ZB9A 1X58A 1P7IA 4FE7A 1TWCJ 4MLOA 1Y1VJ 5M3MJ 5E3OA 2I10A 3OSGA 4X4EA 3JXCL 2R92J 3WHCA 2M8GX 2HOSA 3GN5B 1B8IB 2KEKA 4HNVA 1O4XA 1WCMJ 3HGYA 4B3AA 3A01B 4BY1J 3BD1A 2Y9YA 2AXUA 2QCOA 4C2MJ 5EG0A 1HDPA 1PUFB 3S1NJ 2OFYA 1A5JA 2R5YA 2KT0A 4Z59A 1UMQA 2GRMA 3BR2A 5K7FA 1W0UA 3RKQA 3CECA 5F0FA 3MN2A 2GZUA 2XPUA 5F0CA 1NK3P 1YRNB 2GBYA 1OCPA 2DN0A 2VKEA 1U8BA 1FEXA 2LYKA 2KDZA 1ZZ9A 2HINA 4NDWA 4PU7A 2LK2A 2JA7J 3TW7A 1SANA 1MBKA 2O38A 4O8BA 4X4BA 1TWFJ 2NOGA 1FIPA 3NAUA 4X4FA 2LLKA 2CU7A 3ZQFA 5IYCJ 3TRBA 1JWLA 4Z5CA 4B1RA 1U9NA 1RIOA 1AKHA 2IAIA 3JRFA 2ME0A 5EF6A 1IC8A 1AHDP 2CQXA 3GTGJ 4D5CA 4A3CJ 1QQAA 2ME6A 3S2HJ 3RZZA 4YG1A 3HOWJ 3S2DJ 3VPRA 1PRVA 2PUFA 2O49A 5IP9J 4JCYA 1MH3A 2R5ZB 1ZTRA 1QP4A 2FD5A 1ZQ3P 3HM5A 4UUSA 2AXZA 1XWRA 1FTTA 4QTRA 2WUSR 2ECBA 1X2NA 4V2GA 1RZSA 3MLFA 4Y42A 1JUPA 2GRLA 3KZ3A 2M0CA 4D5FA 4IHVA 3ZKCA 1VPWA 2IU7A 1RETA 1IGNA 4M3BA 2KEJA 2HI3A 3BR6A 3JRGA 4X1EA 4XRSA 2AXVA 3BG3A 3Q0WA 5J1RA 2R7ZJ 1CJGA 3OQMA 1Z0XA 1JTXA 1HLVA 2L8NA 2G0EA 3HOXJ 1X2MA 3K7AJ 5M5XJ 2EBYA 2M34A 2X6OA 4AC0A 2LVSA 2CJJA 1PRUA 2X48A 4ABZA 4A3GJ 2MG4A 2YS9A 3JRCA 1MBHA 2DA2A 2NVYJ 4I6RA 3BG9A 2IUOA 3JRHA 1HDDC 1GVDA 5IP7J 1XG1A 1LE8B 2GLOA 4GFBA 3S14J 2EZHA 2L9RA 1R69A 5M3FJ 4YG4A 3JRDA 1WPKA 3NARA 1LFUP 2VPRA 4A3DJ 3ZHMA 1APLC 2NVXJ 2JA6J 1Z77A 5C4JJ 5GPAA 1W0TA 2QF7A 1ZAYA 4FN3A 3TW6A 1B72A 1ETVA 2O8KA 2XI8A 4M3EA 4JCXA 1ZPQA 3BS3A 5EZHA 1ZK8A 2KZ8A 2HYJA 1HOMA 2DA7A 3SDGA 1JKOC 1WH6A 1ZZBA 1ZS4A 4JX5A 3GTJJ 3O8GA 2ELKA 4A3IJ 2JA8J 1JKRC 4DYCA 4FTHA 1K83J 1A6IA 3H0GJ 2E2HJ 1LCDA 2HSGA 4JQDA 1JH9A 3QQAA 3BQZA 3HDDA 3OOUA 4A3EJ 2JCGA 2IVGA 1OFCX 1ZZ8A 3FYMA 3RZOJ 1OSLA 3FMYA 2VUMJ 3C2BA 3GTPJ 3QPSA 2ECCA 2DA6A 3KXAA 3Q3SA 4IA8A 2B63J 4DZPA 4A3KJ 1LFBA 4F8DA 5IYBJ 4X4GA 2DMNA 1RR7A 4DZJA 3IV5A 3PO2J 5BNGA 1NK2P 1P7JA 1R63A 1UG2A 3S15J 1ZGWA 5FKKA 5GPCA 1ETWA 2M9HA 1RPWA 2WIUB 2PUGA 3BR3A 1QRYA 4AYBN 4A93J 4MCTA 1E3OC 1Q1VA 1MBGA 1YSEA 5EEAA 1GDTA 1BDHA 5E3MA 4MO7A 5IOZA 4B4CA 4EEFG 4YBAA
chains in the Genus database with same CATH superfamily
3M3YJ 3JRAA 3LSJA 5DYMA 3TQNA 3FDYA 1MJ9A 3OQNA 4J01A 1OCTC 1SD5A 4XOTA 4OOIA 3REOA 1WH7A 3T0YA 2F4IA 1ZH5A 3OS2A 2CQNA 1KU7A 1FJLA 3GZDC 1LQ1A 3P9IA 1YS7A 3K70C 1T38A 1F1ZA 4HOBA 5F08A 1N75A 2OQRA 1VQNI 3OIPA 3FM3A 1MSEC 3ZMTA 2HTJA 1XC5A 2ZJ2A 4A0YA 5DM7F 1Y1WJ 4HDUA 3QFIA 1MMGA 1SC7A 1F43A 5IP6A 4HV5A 1V54H 4IRIA 1SD6A 3BR5A 3TELA 1G59A 1WRJA 4PGHA 1J09A 4BXXJ 4YELA 1JXSA 2MEZA 1MBFA 1FX7A 2PLYA 3F72A 2PXTA 2GOXB 5B1BH 3C1DA 2JT1A 3F21A 2F5FA 2HCSA 4I6TA 1E3HA 2VBWA 5F27A 2LNMA 4GXOA 3ULQB 4M3DA 5EJCA 3KZYA 4A69C 5F1RA 3L1PA 2VE8A 1W36C 2GOMA 3QRFF 3OWTA 1R58A 1SFKA 1EF4A 2VQGA 5B5EC 2RREA 2M2EA 2NNNA 1E17A 2IXSA 1SFUA 2JQEA 3BDNA 1GXPA 2PIJA 3A4CA 4F7ZA 1ZZCA 1XMKA 2ZMEA 5E3LA 4BDYA 1PRAA 3F6WA 3KJXA 3F0CA 2QBYA 1WETA 2WB1A 1T8IA 2LP0A 1R7JA 3ASOH 2PXKA 3DP7A 1R5GA 4EKGA 5EDNA 4UUVA 4EKIA 3QP6A 4L5EA 5KHDA 1T56A 1WH8A 4D0PA 1GV5A 2P81A 2K02A 1X4PA 3IH3A 4IRGA 2L0KA 3I71A 4L18B 2IRFG 1RPEL 2MSYA 4ER6A 4IHTA 3BROA 1BR4A 2VJJA 5HODA 1MDMB 1VQ6I 3OR1C 5TJJA 2J7UA 3B6AA 1VI0A 4JOMA 4AIHA 3DLAA 3OYLA 3CCRI 1R4NB 4I6ZA 4QLCU 2GQQA 3RZDJ 1MSFC 3BTLA 1T0FA 5LEKA 3M8FA 1BW5A 2PQ8A 3E3VA 5TGTA 3GX4X 1Z91A 5B1AH 4RLQA 2XSJC 3ZCOA 4XRMA 1B9MA 3QYXA 1IO2A 2DLLA 3CMAI 3HZIB 2COBA 4EJWA 1VQOI 3CCSI 2PUAA 1FYMA 2BJCA 1AKHB 4M6VA 5D5WB 2BNMA 3H36A 4C3JJ 4D1QA 1ORKA 1TWGJ 3BY6A 1ODDA 2R5ZA 2XDVA 2X1CA 3W2WA 1OCCH 2KEIA 4DE8A 3C18A 3ZXSA 2DI3A 5FRNA 2FJRA 4BQAA 3G2BA 4U88A 1IDZA 1POGA 3TO6A 4UUSB 2A6EF 1S3JA 4Y7NJ 4BE2A 3G0TA 3IL2A 5HNHA 2FBKA 1BOAA 1OCRH 3HSEA 3LISA 2LY9A 1L1MA 3K4CA 1TTYA 3IP4B 2F4MB 2WBMA 3FXLA 2X6YA 1U2ZA 3I9V2 2IS1A 2CFXA 2M5WA 3O8HA 4ZDLA 3FKIJ 1BI0A 4KT6A 3AG3H 3DEWA 2QA4I 2ZO4A 4M9ZA 3FF5A 5HS9A 2LYPA 2R0QC 2BBYA 1HXDA 2DK5A 1VQKI 2CQQA 5KAFC 2JQ7A 3ME5A 2J5OA 3SCGA 1IV6A 3ZGKA 3FXOA 2AS5F 2VBZA 1TQIA 4P9FA 1LE8A 5EYRA 1D1AA 1GHCA 4DE9A 3GLXA 2IVMA 3TDZC 2O7OA 5F04A 4A3MJ 3M9LA 4N9IA 2ETHA 1BA5A 3WU2C 3JTGA 1YW7A 3S8PA 1LB2A 3CROL 4PCQA 4B44A 3RDIA 4LLNA 1U9OA 3VB2A 1D8KA 1U78A 1BN5A 1BJAA 2G7UA 2HVQA 4U0VA 1Y9QA 2DAOA 1POUA 4NHJA 4HW0A 4KICA 4BHCA 2O9LA 4IKFA 3S1MJ 4EJTA 5AONA 3SQNA 5FLMJ 1IRFA 4JX6A 1GUUA 2DBBA 1QA6A 3SJMA 1ULYA 2MLGA 1YW9A 1DPRA 4E7JA 2WTEA 1NG6A 3S16J 4LOCA 3OQOA 2EILH 4NC7A 1VQ8I 2JSPA 1E2XA 4XRSG 2R63A 2KLOA 2LTPA 3KX2A 4P1WA 1V3FA 4FX4A 1L0OC 3TMOA 1PERL 2XF7A 4CZZA 5C4XJ 2LY1A 1JGGA 3WGGA 1I50J 2CROA 2CMPA 3L2UA 4KISA 2AUWA 2FF4A 2EWTA 3QOWA 1D0YA 4IEJA 5LGNA 1JT0A 1PDNC 2H27A 2K4BA 2LYCA 2IBDA 5JLXA 3LFUA 5CQEA 2PJPA 3LQXA 2MLKA 3CO7C 1KA8A 3CLCA 5FGMA 4XICA 4GYGA 2XAHA 1ETQA 2L7FP 2CFOA 3SZPA 3LAPA 4DBQA 4M3GA 4V19K 2IEKA 3ABLH 2LOOA 3GMEA 4IVZA 2E19A 1ZG5A 1K6OA 3M1CA 1WZ2A 3K2ZA 3R4KA 2MQKA 2KIQA 3RKYA 1K79A 1IXRC 4RAZA 2D5VA 1O57A 3C7JA 3QYFA 4ENNA 1B59A 4EGZA 2V79A 3ZQHA 1UXDA 4PUSA 3GTQJ 2R7UA 2BY1A 3GYHX 3V7SA 2R1JL 1XCVA 2J5PA 4IHXA 2FOWA 2WV1A 4C2TA 3K10A 1K78A 2YU9J 1XSVA 5E1ZB 3R6SA 1J59A 1FOXA 1R4MB 2EA4A 3CCYA 3RPUA 1YX3A 3ZQIA 2AQEA 4XLEA 1JFTA 4GYIA 5FKOA 2W25A 2PMZN 1WJ5A 5KVRA 4LK0F 2MH2A 1LJ9A 1XS9A 1TC3C 2FU4A 3KZZA 4AYBA 3OMTA 1HF0A 4IWRA 2OF7A 1HA8A 2L5QA 1WJFA 3FMQA 2NS8A 5IPAA 1TQPA 1WQ2A 3WTSC 3LA7A 3DPUA 2XXQA 4Z6YA 3V7CA 3HXLA 2M4KA 2EBIA 4ZC3A 2BXYA 3VYSB 1FBSA 1ZLJA 3MVPA 4D7MA 4EQQA 2AO9A 3BJAA 3DEUA 1KU2A 4XK4A 1HCRA 3LWFA 1S6LA 3A9YA 2K9QA 5EGOA 4I8TA 2PUEA 1H9GA 2HKOA 2KJCA 3LSTA 2HOTA 2MXDA 4CYCB 2XIGA 4ASNA 4QSHA 4XBFA 2L7MP 5E3NA 3VEPA 1X58A 4LJZF 2FRHA 2K9MA 4MLOA 5M3MJ 3F23A 1RUOA 4IVNA 4U87A 2LLVA 3A9XA 3E5XA 3OSGA 3GFJA 3GUUA 3RTRA 2KP6A 4QPOA 4HPQA 3BG7A 3AKZA 3SZGA 3HTSB 1MJAA 4NQWA 1NH3A 2FQ3A 2D1HA 2LMDA 2Z2SB 2KZVA 1AA7A 5KAIC 1A6QA 1Z6TA 1HSTA 2MC4A 1HDPA 4PJNA 4MHGA 3D0SA 3AG4H 3R60A 1A5JA 1M1EB 1IN4A 5K7FA 3LL7A 4CH7A 4OINF 3TFLA 3OR2C 2GBYA 4RMNA 3IAS2 4BACA 2D2WA 1UJ8A 2FE3A 2W57A 3NEUA 4KYWA 1U8BA 2M87A 1FEXA 2PXUA 3MKWB 2F48A 2E1CA 3TW7A 1SANA 1MBKA 2BVMA 4O8BA 1JHFA 3CP2A 1FIPA 1YE9A 2CU7A 4D9JA 5IOZA 2EV5A 4AWXB 4RM2A 2Z9OA 1RIOA 3WE3A 3HZJA 3JRFA 4RLFA 5E20A 1AHDP 3GTGJ 2Z99A 5ILSA 1QQAA 2TDXA 2XKOA 4XN0A 3PNTA 4YG1A 3EUKL 2FOKA 4PJMA 2WC2A 6PAXA 3LFKA 5GADJ 2O6GE 2JZYA 1G3WA 5IY5H 2ZXJA 5E79C 3CCQI 3BOQA 3HM5A 2AXZA 2RQQA 1XWRA 3E5QA 2PN6A 3PFYA 2HOEA 4UVCA 2JTVA 3HG9A 1YIOA 1FY7A 1NHAA 3IC7A 4XLFA 4LG3A 1P4WA 1KU3A 2H6CA 1WFXA 3D5LA 4A2UA 4D5FA 4S04A 4E7KA 3IUOA 1VPWA 3HSRA 4XN3A 2LSOA 2A69F 4LITA 3CJQB 3KEQA 3O3KA 3JRGA 4Y13A 1MJBA 5IT3A 2R7ZJ 2GZWA 2IW5A 3OQMA 1Z0XA 1SVMA 1JTXA 1HLVA 2EK5A 3HOXJ 1X2MA 4PFPA 4UB6C 1B6AA 2M34A 5GAHJ 2X48A 4RB1A 5D6EA 3JRCA 1PYVA 2DA2A 3ABMH 1R6RA 2LBFA 2M8EA 3BG9A 3FXJA 4I6RA 3JRHA 1U2WA 2PBIA 1SD7A 1ZGJA 2GLOA 3BJ6A 3F8MA 1VQ9I 2L9RA 3BP8A 5LHGA 1KGSA 3JRDA 3UWPA 1AWCA 2VPRA 5HLGA 5GTIC 3HYIA 1W0TA 3TW6A 2O8KA 2XI8A 3GWZA 4BHBA 1IN7A 4ENKA 3BCBA 2QQBA 2DA7A 1JKOC 3HTUA 3F8FA 3FMRA 3ZMUA 3GTJJ 3KIOA 1GVJA 3CF5F 4UVBA 3A0HC 3O8GA 2ELKA 4R1HA 1KQ8A 1FSHA 5DCMA 4KIGA 4A3IJ 4E7SA 2JA8J 1D8JA 2RNJA 5HDKA 3FZVA 3LAJA 1X1CA 4FTHA 3TO7A 3BC8A 3LQRA 2OCEA 5DTMA 3QQAA 3H92A 4LIVA 4GCVA 4ITVA 4ER3A 3HDDA 2QSGX 1ZREA 2JCGA 2VXZA 5L3FA 2ZJRF 3GW2A 2IVGA 5LD2C 5BOXA 4LIUA 2XAQA 3FYMA 3LMMA 1MFQC 1XPXA 3GTPJ 4DIQA 3FKJA 3CUQA 1P92A 3Q3SA 4IA8A 4CSWA 5ICFA 3H35A 2B63J 3S3NA 1FWZA 3MKZA 3CCVI 3Q5FA 1YITI 5IYBJ 2ACJA 2G9WA 3HPHA 4DZJA 1KONA 5BNGA 2VT3A 1MZBA 1IRXA 3LSHA 4B47A 1HBXG 3GZ5A 4ZYDA 2UUZA 4IJAA 3HOTA 2PUGA 2YX7A 3KZIC 4A93J 1Q1VA 2FEZA 1MW7A 2AXTC 1ON2A 1X1PA 3CLOA 2KRHA 4EEFG 1W7PD 2JPCA 3GZCA 1W5TA 2VKVA 2EIMH 3PL8A 5GAGJ 1AOYA 1QP0A 2K27A 2PUDA 4I99C 4XLNF 3A9ZA 3CTAA 3Q0UA 4GRIA 4MEYF 5AIQA 2DMTA 3J80Z 1IZ1A 5A7LA 4BE1A 1SD4A 2XCJA 2NNYA 4GDFA 2Y2ZA 4HRAA 3L9FA 2Q8KA 4DYQA 2FSWA 4NC6A 4BYYA 1WGXA 3HB9A 3BPVA 2VB6A 2NVTJ 2HNHA 3ZQ7A 3BTCA 1I6XA 2EB7A 3S8QA 3QPLA 2Q2EB 3ASNH 2L4AA 3HUGA 1WJBA 2ICWG 1S7AA 2O61A 1WH5A 3Q9SA 4N4NB 1DWKA 2AQFA 2QYOA 2VJ5A 3G73A 3GBGA 1EH6A 2BW3A 2VBXA 5LFAA 2X9DA 5FLXK 1K61A 4HBLA 3F52A 3LSRA 3F8CA 3I4PA 5DTDA 3WE2A 2HR3A 4G12A 3FYAA 2EV0A 4A3JJ 1X3UA 3GTKJ 4ENJA 4LG0A 1I27A 1X57A 3DU6A 3S2WA 4HX8A 1HQCA 1WIZA 2VQCA 4OAZA 5CVVA 4HNTA 2ADUA 1S29A 1D5YA 4KDPA 2E7XA 2LNBA 2ISYA 5L3GA 2QQ8A 3DXJF 2NS7A 3ABKH 2GWRA 1R49A 4RGUA 3E1SA 3WGHA 2ID6A 2IA1A 2VJIA 4XONA 1YFHA 2DU9A 1HSJA 3PIPF 1NG7A 4XKWA 2Z3YA 4E4HA 4WXDA 3JSOA 3Q0VA 4X4CA 4ZYGA 3OSFA 4HSTA 1YG2A 2DMUA 5L3EA 3MFKA 4KUMA 1UHMA 2KPJA 5J1UA 4OB4A 5D8KB 5DTRA 4OIRF 2EZKA 1LVAA 3H3VK 1PUFA 1I5ZA 3RKXA 3ZN0A 5EG0B 2ZFUA 2CO5A 2H8RA 2WAQA 5FJ8J 1WJCA 3RJPA 2R5YB 1T98A 2M45A 4XRFA 3ZHIA 3HOSA 4EGYA 4Y15A 1Y8QB 1A36A 3EUSA 4HX4A 4GO1A 5CVUA 1RZRD 2LYSA 2YPRA 1MMDA 3KP6A 1YHQI 2KRCA 1JI8A 2CYYA 2NAZA 5BQTA 1EKEA 1LDJA 2EPFA 2VC1A 1S7OA 3LOCA 3MCZA 3TEDA 2XGXA 4IO9F 4Y3OA 1BR1A 2GXAA 3PSFA 3FXUA 1RESA 4P5OA 4XSZF 2NVQJ 3OL4A 3FISA 4BUPA 1LCCA 4RGRA 1OJLA 5L3BA 4M71A 1FBQA 1BM9A 3NXHA 2BNOA 2XUBA 1UHSA 1WI3A 1RNLA 1U5TB 4DJAA 4BEHA 5JHFA 3K4KA 2IPQX 2NS0A 2BY0A 4OAYA 3U21A 4CICA 1QPIA 2OZUA 1TP4A 2E34A 4PJ0C 2L9SA 1BOBA 4IXAA 4RAYA 3AG2H 4RS8A 3G3ZA 4JK1X 1TWHJ 4DBRA 3OYGA 2MABA 2QBYB 2R7QA 1O7FA 5HS8A 4HQEA 1H88C 2KJBA 2KQRA 3KE2A 3MKYB 2LG4A 4P55A 3BR1A 4P9UA 4B3XA 2GA1A 2NVUB 4O3MA 1NERA 3VK0A 3LSMA 2HXOA 4M3FA 1DGWY 3G1MA 4Q47A 3TDUC 2DMPA 2A05A 2OJED 1XCBA 3V8LA 1I1GA 4M74A 4PJJA 2L01A 4Y33A 4EM1A 5M5YJ 4U7DA 1B72B 4PGGA 1X3ZB 3ZQQA 4OMYA 5DUKA 4G6QA 2EINH 2X6XA 3C2GA 5FD6A 3HHGA 2QWWA 1BW6A 3MWMA 3TP0A 2JRTA 4F55A 3GO5A 2QM3A 2PMUA 4W97A 1OMIA 2XB0X 1U5TC 2OR1L 2Z1DA 4AU7A 4HNUA 5TRDA 2IGOA 4CHUA 1U8RA 1IUFA 3GTOJ 1ETOA 4IPAA 4AUXA 4HAMA 1ENHA 2NYXA 4A3BJ 3OS0A 2AW6A 4WWCA 2OZ6A 2W4SA 4YIFA 4WVLA 3H1CA 1MIJA 3CDHA 1PNRA 1VF9A 1X1BA 1BJZA 4L9JA 3I5UA 3I58A 2P7CB 3KETA 2C6YA 1IUYA 2ZFWA 1FIAA 1NTCA 1ZVVA 2E5ZA 1UTXA 4YARA 1O3TA 4EK9A 3I53A 3OS1A 3LNQA 3OYCA 1QZZA 5EEHA 1JJ8C 1SQ8A 1TT5B 5L3DA 1XGMA 1YTYA 1JHHA 1DU0A 3FBNB 4KNYA 1B8IA 1QPZA 3CD6I 4Y52J 1TBXA 1LPQA 1E3PA 2V1UA 2V3CC 2STWA 3O6BB 1SFOJ 2R93J 3DM5A 2BEOA 4AIJA 2EH3A 5FKMA 2B7EA 3D5RC 5IOYA 1OYWA 1ZELA 1W4MA 3MD2A 4OWRB 2UV1A 2PJRA 4AVZA 1W5SA 2M7AA 4G6TB 4KN4X 5H6RA 2V6EA 1DU6A 2ELHA 2DPDA 5ED4A 3OKZA 4YIRX 2Y0SA 3KP4A 4XKBA 1LKXA 1T0FC 2HXIA 2JN6A 2P5VA 3DCFA 3JW4A 2HDWA 4I01A 4RB0A 3VSKA 3QQ6A 2TRTA 3QOPA 2K5CA 2CV2A 2XGDA 3KYCB 4FCYA 4XM3A 5F1JA 2ESHA 1QP7A 3TOAA 5ICCA 4Q5SF 1ZZ7A 4AD9A 1WVRA 1QVTA 5CYVA 1BDIA 2DPUA 2QENA 2WB1N 4OIOF 2A6HF 4JX4A 4HLYA 5IYDJ 3EETA 3FK7A 2ZXIA 3F9KA 4CCMA 1QGPA 1QO0D 4HLXA 4RGSA 3E6CC 1YW8A 3V42A 3QPHA 3S3OA 1VQ5I 4J19A 3E97A 2EZLA 5E1XA 3ERED 2R7FA 3JXBC 4LK1F 4UV9A 4BJ6C 4BHPA 2K7LA 4N9HA 3U3WA 4MFEA 4X0GA 3G7DA 3EQLF 1JJ6C 3CC7I 3CCUI 4A5MA 2DTRA 3GCMA 2VONA 4BQQA 3WTVC 2HPMA 1ZRDA 4XIDA 5FLXZ 1ZR4A 1K4TA 4MEXF 4Q48A 4DOZA 3G1OA 2Y0SN 2CQ7A 4N0BA 1YJNI 4I0AA 5E3OA 2MFZA 2I10A 3T8TA 3OWQA 1G3SA 2OAZA 2V1NA 4JBAA 4MTDA 4WF2A 1Y56A 3KLOA 2HOSA 3PQJA 3GN5B 1OR7C 1FP2A 3E5UA 4ZZLA 1WCMJ 4CDGA 4BQNA 3H5NA 1WWXA 4B3AA 3QWLA 5BPIA 3DKYA 1MDMA 2E35A 2B0LA 2OFYA 4Z59A 3H9GA 3RKQA 4MQVA 3CECA 2BGCA 2GZUA 2XPUA 3EUAA 1YRNB 2HYFA 2DN0A 1ZGAA 1XDUA 2HINA 1WSUA 2JA7J 2O38A 1P2FA 4X4BA 1SMYF 1TWFJ 1WJAA 3NAUA 2HKXA 2LLKA 4X4FA 3K6GA 1WI9A 1G8XA 1PUEE 4NC8A 3GFMA 4IZZA 4Z5CA 2XAFA 3PNYA 4BU2A 1AKHA 2IAIA 2RQPA 3HRMA 3KP2A 5EF6A 1ZARA 2ME6A 3UR3C 1QHGA 2PUFA 1PRVA 1R1VA 4MTEA 2R7VA 3ZN1A 1X1AA 4G7ZF 1ZQ3P 4UUSA 2L7KA 3A0BC 1NW3A 2JUCA 1G3YA 2ECBA 2WUSR 3L09A 1HW1A 4Y42A 3HRTA 2E5NA 3FXKA 2XASA 3WTTC 2YU3A 3RCOA 3IHUA 4IHVA 3ZPXA 1SAXA 2MYSA 1TZLA 5D5VB 4QWQA 5L3CA 1FT9A 3J80K 3BR6A 3NRVA 2L3DA 1CJGA 2O8XA 2E71A 3COAC 3K70D 1IRGA 2A61A 4LD5A 3K7AJ 2D45A 3DFGA 2EBYA 2LVSA 3EUHC 5ILVA 2CJJA 2F5DA 2KFDA 5E8IA 4ABZA 4A3GJ 2MG4A 3ESWB 4A6DA 2NVYJ 4IQJA 1VQPI 2LLWA 1BI1A 2GIZA 4XR6A 4BE0A 4M6XA 5HS7A 5IP7J 5K5OA 1LDDA 1R5ID 1QQIA 5CKTA 1ERDA 3RYRA 4NQWB 3DTIA 4UNOA 1L3LA 3NARA 2PI0A 4B09A 2UXNA 4A3DJ 3GFIA 1APLC 2NVXJ 2JA6J 3VFZA 5C4JJ 1EH7A 1XB4A 5GPAA 4JCXA 2KHMA 4M3EA 4ZYHA 1W5CC 5EZHA 1UHWA 1W36D 3H5RA 4E7LA 1WH6A 1FYKA 2HFHA 1ZS4A 1QNTA 2BV6A 3K1MA 2EIJH 3NROA 4XLAA 3V8JA 2QEXI 1JKRC 1A6IA 1W7PA 3H0GJ 2E2HJ 3DTEA 1JH9A 2XHKA 4Y17A 4II2A 1KQ0A 3HC7A 3OOUA 4KMUX 4ESFA 5DV5A 1OFCX 1ZZ8A 1QPMA 4A6EA 3RZOJ 1OSLA 2BXZA 4IOCF 2ECCA 3FMSA 1VQ7I 3WG7H 4A3KJ 2LKSA 3ZMZA 2WY7Q 1G3TA 2EJRA 2ESNA 2HGCA 4F8DA 1TLHB 3EYYA 4XL9A 3U9GA 4BS9A 3IV5A 1F9NA 3DU5A 4C9YA 1C0WA 3JSPA 2L2OA 3KYDB 3BR3A 2BY3A 4AYBN 4BAYA 1QZYA 3UNGC 1E3OC 1IW7F 5EEAA 4PSWA 5E3MA 1GDTA 1QU3A 4MO7A 4B4CA 3R09A 2VLAA 3H9QA 3TBIA 3PIOF 1KYZA 1Z7LA 3PFIA 1QVUA 4RGXA 4HDVA 1UCRA 2GM4A 5LEJA 2EV6A 3JREA 1H8AC 3MZ8A 2XKPA 3S17J 2F5EA 1RKWA 1HW5A 3EDPA 3FIWA 2UZKA 2P5LC 3QAHA 2E1OA 3LSIA 5DM6F 2LF7A 3J7AY 2DOFA 2HCNA 2L02A 2LKPA 3KEYA 3PXPA 2DA3A 4R8HA 2LBFB 1Z21A 4I6UA 3W6VA 2DW4A 3B6CA 2WADA 3HEFA 4O6JA 2N8GA 2EF8A 2CUFA 2DODA 2DOEA 3BTIA 1HKTA 4X4IA 5H6QA 1FMVA 4G7OF 2CV0A 2O5RA 3CDIA 1V5FA 3SZTA 4OU0A 3BZCA 1RIOH 2XV4S 3L2RA 2HOAA 4CO8A 3MKLA 1LLIA 5C44J 2Y75A 4U0WA 2M3AA 3BPXA 5DS9A 1D5VA 2QLZA 5E17F 5DCMB 4X4HA 2MW8A 4KT5C 1IDYA 1X1DA 1USSA 5JLWA 2LY2A 1FSEA 3M07A 1MBEA 2BY2A 2DJIA 1WJEA 3GEZA 2PUBA 1MMSA 1HKSA 2WY8Q 3I0TA 2DQLA 3MZHA 2LCVA 3SCFA 4CYCA 4UB8C 5DDGA 3LSKA 2E7WA 1IJWC 2OTLI 4JYKA 2LYQA 1O3QA 1YJ9I 1RZRA 3CUQB 5A2QZ 4Z5DA 1D3YA 1K7AA 5BPDA 2BNNA 5KK1A 1ZR2A 2WWYA 4S0HB 1BIBA 3HOYJ 2XPWA 3OIQA 5DRTA 1JFSA 3I4MJ 3KL4A 5DD8A 1Z05A 2VXDA 3R0JA 4I09A 2XF5A 2L9VA 4GHJA 3ZPLA 1VZ0A 1SAUA 2A07F 4BBSJ 1YLFA 2LKXA 5H20A 5CVIA 4IHSA 3CQZJ 2EFNA 2BE5F 3CCLI 1UELB 3M9AA 1VFCA 1Y8RB 4PU3C 3F51A 3D1NI 1YOVB 3BR0A 4E7IA 1GT0C 3SX0A 2QQAA 2R7DA 4X4DA 4F92B 4JQFA 3HOZJ 1U6GA 1N78A 4J1XA 4YFNF 2PXEA 4ETSA 1Z9CA 1ITYA 3U2RA 4BY7J 5GP9A 1IG7A 2VOPA 2DA4A 3RKWA 4WCGA 4YRVA 4L9VA 1DW9A 1MNDA 3I59A 2OD5A 4FETA 3QYEA 1B1BA 3I54A 1R36A 1UG0A 3CDLA 2Z33A 4BDZA 2DFHA 2W82A 5LRRA 9ANTA 4ER7A 3C3WA 3HUGB 3N4MA 3GBFA 2W48A 3S32A 3TGNA 2OPTA 2P5KA 2F5VA 3HPGA 3T1BA 3W6KB 3M7GA 1KU9A 3ISPA 4MIMA 3ZMVA 5LLQA 4PU7A 2M1BA 1FTZA 2LRDA 3BLYA 4LFUA 1FP1D 1MD0A 2R7OA 2QSFX 4IF4A 2L7ZA 4EM2A 1I3AA 1FLIA 1FBUA 1EV7A 3I4NJ 2FQ4A 2ZJPF 2FNPA 2MGQA 2L54A 3CJRB 2XVCA 3WTYC 2Z16A 2ZCWA 4PZJA 1CF7B 3AFHA 2XRLA 3C2HA 3L00A 1J9IA 2AHQA 4WK8F 2A3SA 2DT6A 4EMSA 3H5TA 2W7NA 4A0XA 4RM3A 2Y0MA 3KFWX 2HZDA 3OYAA 4HA8A 2IA2A 1ZUGA 4Q4ZF 2YBDA 1ZN2A 2CSFA 2VOOA 4NNJA 3P5JA 2CUEA 3M8EA 2OCCH 3PM1A 1TNSA 2RKHA 2UWMA 1STZA 2ZXHA 2EIKH 4Z2YA 3WODF 4I76A 5M5WJ 4MQ9F 2XPVA 1NEQA 2F5CA 5H2FC 3WU0A 4ZYEA 4ZYAA 2E1MB 1P9QC 4AM3A 3ML6A 2HU9A 1FYLA 2JJ7A 1JKQC 2KL4A 3QOXA 4Z5HA 3GZ6A 4FISA 2XXPA 5KCMA 2K40A 5C3EJ 4C2UA 3WTXC 1R1UA 1LEBA 1QBJA 5FROA 3ERMA 4EQZA 3HBLA 1R71A 3QOEA 1KZHA 3CZ6A 3GTLJ 4IHYA 1F4KA 2DA5A 1OKRA 3TP3A 3QYBA 2R7XA 5LGUA 2Z5UA 1T39A 1VQ4I 1IN5A 1IN8A 2B9SA 3HOUJ 2ZNYA 1ZRCA 4CCNA 5TISC 3I3LA 3IVPA 1RC9A 2X51A 2DDAA 5FKLA 2DTZA 2KPMA 3LSGA 4CCLA 4ON0A 4BL0B 3CMEI 4FBIA 2ICPA 4I98B 4DYRA 2CRGA 3BG5A 2XB5A 4PK4A 5F64A 4IOAF 4M9XA 3T8RA 1LDKB 3OYDA 4E70A 2IS4A 2A68F 3F6OA 2NOJB 1J7KA 3RPQA 3QF3A 4BEHB 1OCZH 3Q9VA 4I7HA 1BL0A 1J5YA 2HTSA 3R61A 3G6EI 4ESBA 2H09A 2XGCA 3A01A 3HJEA 2RGVA 2ICTA 1R00A 3IKVA 4G7HF 2PUCA 2PFBA 3WTWC 2E1MC 3RQIA 3O9XA 2VJ4A 4RB2C 1H89C 3W6JB 5FFXA 3GXOA 3PUFA 4B48A 1GV2A 2CSOA 2M30A 2O3FA 2VC0A 2X85A 3HRUA 1Q1HA 4IQ4A 3FHNA 1IXSB 2LC2A 3BT9A 1TQMA 2IP2A 5D8LB 2CQKA 2P8TA 2IGNA 2LYJA 2HQNA 2IA0A 3F8BA 2PXVA 2LH9A 1TL8A 3SYTA 3QPTA 3DKXA 3ECOA 3FXRA 4XKVA 2HQAA 2ZNZA 3ONQA 4RAFA 2HWVA 5DEQA 2K9NA 3DNVB 2IVBA 4CCOA 3WG9A 3KLNA 2XGEA 1JUSA 2V7FA 3IH4A 4UUTA 3MEXA 3M8JA 3ZR8X 4C30A 2DA1A 4A3LJ 1ZG3A 2V6CA 2FX0A 1U3EM 4KFCA 1LMB3 2CWEA 1FOWA 5GAHi 3I55I 1Y0NA 1W1WE 4PSXA 2I8DA 2K85A 5B66C 5HNFA 1OQYA 4H0EA 2ID3A 5K98B 5D6FA 2OV7A 2RN7A 2W84A 1G2HA 4BJTA 3DLLF 1BC7C 2WAQN 1D1CA 3OMYA 1I3QJ 4CYDA 4I0BA 5JVTA 5FO5A 4WXHA 4FQGA 5JVGF 1DPUA 4LB6B 1I39A 4QIWN 2VQLA 3UKGA 2ZB9A 1TWCJ 2PX9A 2ZMEB 3P9CA 5J6XA 1Y1VJ 1O3RA 1CGPA 1HW2A 2L1PA 4UY8I 5DT2A 2PXQA 2EFOA 5EEGA 3ZRGA 4X4EA 5HLTA 2BYVE 2BHYA 2LF8A 2STTA 1FMWA 1O3SA 2R92J 3WTZA 3AG1H 2F4OB 5LHIA 2XROA 4DQ2A 1B8IB 4HNVA 3J7AO 4O5VA 2KEKA 4II3A 1O4XA 3A1YA 3HGYA 3EPZA 4BY1J 2AXUA 1MMNA 2GXGA 4IX7A 4Y4RA 5EG0A 2JSCA 4KITB 5ICEA 2R5YA 2KT0A 1UMQA 1W0UA 5F0FA 2JVGA 1KQ9A 3MN2A 2F6CA 2WAFA 5F0CA 2X1DA 1QHHD 4M9SA 2PJRB 1OCPA 2PXLA 2VKEA 1WHUA 1VTNC 4IL6C 2LYKA 2KDZA 3HL2A 2ZKZA 1K4SA 3GZNB 1TW2A 2X1EA 3OYNA 3ROUA 2V1DA 1WKMA 1XX5A 2H8WA 4BJ5C 4AVPA 3MMYB 2DFIA 3GZDA 2VN2A 2NOGA 2DDBA 3B02A 3ZQFA 2FXAA 4F91B 4B1RA 2XXAA 5IT9K 1U9NA 4L5IA 2PXPA 1IC8A 4EM0B 4EV0A 3CJTB 4D5CA 4ER0A 3S2HJ 4HSRA 3DBLB 1Z6RA 2Q0OA 3VPRA 1Y6IA 1Z67A 5B3SH 3JAMZ 2M0MA 2RVCA 2R7SA 5FD5A 5IP9J 2ZMEC 3K1NA 3PUBA 5GAGi 1MH3A 3IRQA 3D5SC 2R5ZB 1ZTRA 4JCYA 3HIFA 3RQ4A 4HF1A 1FTTA 4QTRA 1ZG1A 1U5TA 1X2NA 3MQ0A 4V2GA 3MLFA 5D4SA 4HYEA 4U0YA 4RB3C 3BJOA 2GRLA 2M0CA 5HDNA 3K0LA 3CC4I 3ZKCA 4YG2F 3CC2I 5ICGA 4EATA 4M3BA 2Y48A 5CVRA 2ZJQF 2CV1A 4LMYA 1XMAA 3Q0WA 2KISA 2L8NA 3LA2A 1R5HA 3DBHB 3L7WA 5M5XJ 3WU1B 1A31A 2X6OA 3QODA 1XD7A 4AC0A 3DPTA 3NDBB 2FBIA 1QZXA 1HDDC 1GVDA 3W2AA 1XG1A 1LE8B 4GFBA 3S14J 2EZHA 5M3FJ 4G8XA 4L0YB 1WPKA 5J4YA 3M1EA 4OIQF 3BCAA 5HOOA 3ZHMA 5J40A 2HYGD 2XF6A 2EWNA 1Z77A 5E18F 2MC3A 5LGTA 2P6TA 2QF7A 1PVEA 3CCJI 1B72A 1ZAYA 3BS3A 1LEAA 1ZK8A 3J7YJ 5HLIA 2A6TA 3OYMA 1U0JA 2VQHA 1XGSA 3K4LA 5KNLA 1GXQA 2OTJI 1E0EA 3BG6A 3PQKA 1SFEA 1SVOA 4L5JA 1ZZ9A 3BDDA 3G71I 1MKMA 2KIUA 1XTAA 5A2QK 1P6RA 1LCDA 2M4GA 5DTQA 4JQDA 3K4JA 4ZH4F 4CCJA 4LB5A 2K86A 3SR4A 4A3EJ 3GF2A 3L2QA 2IT0A 1D1BA 4YEJA 3PNVA 1HKQA 4DGWB 4HRIA 3E6BA 3OY9A 3OL3A 1V55H 1JE8A 3L2WA 4EVIA 3CESA 4R79A 5K1YA 3IWZA 3O2PE 2VEOA 1QZEA 1SMTA 2G7HA 2P7VB 2A5YB 4G9YA 1S72I 1RR7A 4QPQA 3RSNA 5F6FA 1NK2P 3TKYA 1P7JA 4CXFA 1J2XA 1X3WB 2V26A 5LHHA 1ZGWA 4UVAA 2RDPA 5FKKA 1MMAA 5GPCA 1RZ4A 2M9HA 2IJLA 3V7RA 3OYEA 3B73A 3FHZA 1YSEA 3F3XA 3GVAA 4P96A 4YBAA 4ZJZA 4BQOA 3G1LA 4A0ZA 2VT2A 3CUOA 2NXNB 4XQFA 3JTHA 4DNCA 4W1UA 4D7NA 2P6SA 4I02A 5JR3A 2D1VA 4CUGA 3WGIA 3JRIA 1VQMI 2L49A 1K78B 3OIOA 3EYIA 2R7WA 2XIUA 2FMYA 1OR7A 2JK3A 3HKZA 3VYRB 3I64A 3HHHA 1Y7YA 3A2KA 2GIVA 3CMMA 3AL0B 1SFXA 2JPBA 2V9VA 4HEA2 3RYPA 1D0XA 1BI3A 2DFFA 2W1OA 3J81Z 2Q1ZB 2XAUA 4M73A 5E1WA 3M4OJ 2XAJA 1V4RA 4OBMA 2CW0F 3E7LA 2H6BA 3SHFA 4NDLA 3H3UA 3LFPA 3OYBA 2DO7A 3SCHA 1ETKA 3J7ZI 4J1WA 4OMZA 1AU7A 5HLHA 4BNCA 1ACIA 1W7PB 4GQMA 3ABTA 4KJZA 3CF2A 3E0JB 5DD4A 2HVSA 2V4JC 2X4HA 1ETXA 3CCEI 2P0WA 1MNMC 1UZCA 3VWSA 2K3FA 2H1KA 1YX5A 5EGOB 1K6YA 3CLQA 4M72A 2AWIA 5JI6A 3S93A 1S9HA 3MEJA 2PMZA 3F22A 4KA4A 1RI7A 3ZQGA 2QUFA 1H0MA 3JXDL 1IRZA 1B9NA 2H1LA 4OIPF 2LYLA 1V5EA 2JWTA 1IAWA 2MA3A 3HKZN 2GA2A 1ZZ6A 1VNDA 2HQ5A 3F6VA 1J75A 4A5NA 4CCKA 3GN5A 3CO6C 3OP9A 5AIPA 3PSIA 4UXNA 5JUWA 1MBJA 1T33A 3GTMJ 3K4BA 4HF0A 4A3FJ 4XSXF 3WTUC 4A12A 1DGRM 4FE4A 3AL0C 3H9JA 1UB9A 2HFZA 2E2JJ 4ZTJA 1F36A 4DW6A 2PE5A 2DJNA 2VASA 4L9NA 3LSPA 2O03A 1DUXC 3PE5A 3GUDA 1Z3YA 3E6DA 4LLLA 2RNGA 2Y31A 2EQRA 4WX9A 1YRNA 3W3CA 3BQYA 2PEXA 2KIFA 2RAEA 1IV8A 3EUHA 4NBQA 3KEOA 5CJ9A 1H9TA 4BXUA 1YS6A 2LFBA 1DDNA 1JTYA 5J47A 1WJDA 2R7RA 2IV1A 1B0NA 4E7HA 1EA3A 1OCOH 4JP0A 3S3MA 3L2VA 1ZRFA 1DP7P 1YI2I 2IGMA 1ZLKA 3VOEA 3LQQA 2L4MA 3PO3J 3R1FA 5K7HA 2IGKA 1N25A 2XJ3A 1UFMA 3QU3A 3ZOBA 5CQGA 1EJ9A 2V1XA 4F93B 3NQOA 3CJNA 5J1YA 1A35A 2LD5A 4Z58A 1QQBA 3DQVC 4XKCA 2X6WA 4AIKA 4MCXA 1X2LA 5IT9Z 3OYIA 1LNWA 1RKTA 2WAEA 3DTKA 5D4RA 3RIRA 1OISA 2LDUA 1ADRA 4RBOA 2RV8A 2COMA 2GAUA 1JGSA 3DKWA 2QKMB 4UV8A 1BBYA 4S05A 3B7HA 3WHBA 3SXYA 4HV6A 2VBYA 3A02A 1LUJB 5FKNA 2ZXWH 4G94A 2HDDA 4ANJA 4PU8A 3VDXA 3FK6A 2CS3A 1N77A 2LR8A 2CUJA 1XGOA 2PXBA 4IHWA 2O4AA 3S1QJ 3H3ZA 5CLSA 4UHTA 1HC8A 2HVRA 4XMYA 2OBPA 3H0DA 1EH8A 2CGPA 1X4OA 3DPLC 2A5WA 3SEZA 1ETYA 2DYSH 5K5RA 4KIBA 4HG2A 5JFRA 5K5QA 4V2FA 1P4XA 1OPCA 5GTHC 2EZIA 3QWGA 1IXCA 2E2IJ 4EJVA 5D5XB 2P4WA 4B43A 2KIMA 4C3HJ 1UXCA 4MFDA 5FFZA 3IH2A 4KMFA 2R4GA 5CPRB 2W85A 4XOPA 1B4AA 3ZQLA 2PMHA 3DF8A 3AAFA 2KRFA 5ERIA 3DEEA 2VIXA 2XRNA 4BBRJ 2Y9ZA 1FNNA 4YG7B 2PPXA 3T5XA 2XAGA 5DRYA 5BMZA 3ZQCA 3K4NA 3P7NA 3BZKA 2B5AA 2Y30A 4U7BA 2W00A 3H5AA 3UFDA 3LA3A 4F52A 4RAGA 1Z7UA 5FLVA 2IS2A 2L9NA 5LRSA 3TL4X 3KP5A 3BZ6A 4MNUA 1USTA 2IVQA 3I59B 4GGGA 3KYLA 4NB5A 2AXLA 3KP7A 3OYHA 3JRBA 3HOVJ 3N05A 2H94A 2ZSIB 1T08B 2RC4A 2TCTA 2VI6A 4F3QA 2CG4A 2XSDC 1VQLI 2BVLA 1I6HJ 2O0YA 2JVLA 2OA4A 2MH9A 1CQTA 3G4SI 4KN7X 1JT6A 4C3IJ 2CUZA 3SFIA 2MD5A 2DT5A 4WXCA 2F2EA 3IWFA 3FM5A 1R9TJ 1EFAA 1YYVA 3K4MA 4HX7A 1SVLA 4ZTFA 2PXFA 1XSDA 5DCFA 2BOLA 2MD0A 1Y39A 2FNAA 1FOKA 5K7ZA 3A03A 2HEOA 3MZYA 3V4GA 1IN6A 1FOYA 5EZGA 2YUSA 1G6NA 1A04A 4B8XA 1LVKA 3IKTA 2UXXA 3RI4A 1P4AA 5J3LA 4PU4C 3BTJA 4FX0A 3FXMA 2DYRH 2V9PA 2BHZA 2I5UA 3QU6A 3ZP5A 1S5LC 3ECHA 3CCMI 1RRJA 3SFZA 3U1DA 4X6AJ 3JAMK 4CA0A 3VWBA 5DSXA 2HDCA 4CZCA 4KIFA 3MAJA 4YFXF 3S1RJ 3SEQA 2VE9A 1Z1DA 1YO5C 2JMWA 1MH4A 5J8FA 3ZMSA 3K2AA 3IRRA 2DXIA 1LQCA 5J4VA 3IAM2 1OYIA 4ZZDA 3OV8A 5JHUA 4PJLA 5CVJA 2QZ8A 1ZKGA 2K9SA 3CUQC 4BKXA 4HF2A 3HGGA 1T95A 1UAAA 2VKDA 1JKPC 1YJWI 3G5GA 4AIDA 2BW3B 4RDUA 1FPQA 1SEUA 4XNFA 2DMQA 2JVHA 3K69A 5F0HA 4YIIA 1S7EA 3CMYA 2R7TA 4IRHA 3JR9A 2JA5J 2QVOA 2HZTA 4XORA 2DFEA 2EFQA 1RR8C 1Z3XA 4L0ZB 4BH9A 2FJ1A 2A6CA 1JUMA 2M4HA 4LG0B 2R3SA 1YQAA 1TWAJ 2WV0A 1X19A 4XLHA 2DOAA 2LYRA 4HZFA 1RUNA 2CH0A 2X0LA 1PP7U 1P7IA 3DBRB 4FE7A 3RPUD 1XGNA 4FHTA 4PFOA 1LFPA 3NZLA 4LLGF 2FBHA 4E6KG 3PJRA 1OLTA 2K9LA 4H4KC 2HQRA 3JCUC 3JXCL 1O7LA 4ER5A 2E60A 3WHCA 2M8GX 5J8CA 2J7WA 2QSHX 5FRMA 2YX4A 4EZIA 1R23A 2BZTA 2HPIA 4TV7A 1MGTA 2KZGA 2E36A 3L2CA 3A01B 1GLNA 2Y9YA 3BD1A 2DCEA 2QCOA 4C2MJ 2OUMA 2PXDA 2K4JA 1BIAA 2FA5A 1PUFB 3S1NJ 2JRMA 1REPC 1V5GA 4ESJA 4N4OB 2W24A 4RA2A 3BR2A 2GRMA 3FBIB 3GLLA 5ILUA 4K2EA 2DK8A 1NK3P 3FWEA 2CW8A 4YFKF 2FMLA 3P9KA 4NDWA 2ELJA 1BR2A 4M6YA 2LK2A 4BXFA 4BGDA 3VODA 4LGWA 2DT7B 4EJUA 2GXBA 3FXQA 4J00A 3VSLA 2FFHA 1DP3A 4EJOA 2VODA 5IYCJ 2EFPA 1ZHFA 1TT0A 3K1PA 3TRBA 1JWLA 4HQMA 2LREA 5FB2A 2ME0A 5LBQA 3I56I 2CQXA 4A3CJ 3V8KA 3RZZA 2E1NA 1FZPB 2DQRA 3U1KA 3HOWJ 3S2DJ 3KP3A 2VPLA 2O49A 2IS6A 3ZMDA 2NRAC 1QP4A 2FD5A 4ZDPA 3OYJA 4ENMA 3VYUB 2QGUA 1S8NA 1DQUA 3SDBA 3DWLE 3W2VA 2WA0A 2VKHA 1RZSA 1JUPA 2K3PA 3KZ3A 3OYKA 5HVQC 1PJRA 4G6DA 5D5UB 4FT8A 2FUG2 2IU7A 1RETA 1XDSA 2KKOA 1CF7A 1IGNA 3KPHA 2YR2A 2KEJA 2HS5A 4I2OA 1IF1A 2HI3A 3OYFA 4X1EA 4XRSA 3FX3A 3BG3A 5J1RA 3X2QH 4E7ZA 1TW3A 4XLPF 2AXVA 2G0EA 4L9TA 1T6SA 3BWGA 1PRUA 1XSXA 2YS9A 3CP8A 1MBHA 3OOPA 3J81K 1TNTA 2IUOA 2OU2A 3R0AA 2KMUA 3TEPA 1R69A 1XN7A 4YG4A 1G4DA 2Y69H 4PDKA 2XC7A 3ELKA 1LFUP 1BC8C 4ZDOA 1ONVA 3NWSA 3TOBA 2CW7A 1BI2A 2Q2EA 4XLCA 1OYYA 1MNEA 4FN3A 1ETVA 1ZPQA 3DV8A 2VL8A 5E8GA 2KZ8A 2HYJA 3GFLA 1HOMA 4CGZA 2ISZA 3SDGA 1ZYRF 1ZZBA 2ZBKA 4JX5A 3N97A 1FC3A 3TO9A 2QKLB 1DULA 1HQ1A 2MBFA 3VYTB 5BS6A 4DYCA 3F8NA 1K83J 3QP5A 2ZC2A 2HSGA 4Q2JA 2ODRD 3BQZA 3ABUA 1I1SA 2KDOA 1KYWA 1XMXA 2OC6A 2QQ9A 2JUGA 3NWTA 3FMYA 2VUMJ 4FASD 1PP8F 3C2BA 5DUIA 1R1TA 2OQGA 3KCCA 3QPSA 5GAEJ 2DA6A 3KXAA 2M7BA 3K9TA 3HRSA 1Y0UA 5HDGA 4DZPA 1LFBA 2V9KA 2YSRA 4X4GA 4NUBA 2ZSHB 1ON1A 2DMNA 1QB2A 1YIJI 4MGRA 1F5TA 3PO2J 1R22A 2EFWA 1R63A 1J0RA 1UG2A 3S15J 1D0ZA 2EA2A 1ETWA 2WIUB 1RPWA 2PG4A 2JA2A 1QRYA 4MCTA 1MBGA 3E6MA 1ZAOA 1BDHA 3HSFA 1T2KA
chains in the Genus database with same CATH topology
3M3YJ 3JRAA 2VKVA 3G1LA 3LSJA 1QVUA 1QP0A 2GM4A 1H8AC 3JREA 2PUDA 3OQNA 4W1UA 3S17J 4D7NA 1RKWA 3FIWA 1OCTC 3Q0UA 2E1OA 3JRIA 1WH7A 2DMTA 2L49A 3PXPA 3OIOA 5A7LA 2DA3A 2XCJA 2XIUA 1FJLA 2JK3A 2Y2ZA 3W6VA 4I6UA 4DYQA 3B6CA 3HEFA 1Y7YA 2EF8A 2N8GA 1WGXA 2CUFA 5F08A 3BTIA 3HB9A 4X4IA 1MSEC 2NVTJ 3BTCA 3S8QA 1XC5A 1Y1WJ 3QPLA 1F43A 5IP6A 3BR5A 3M4OJ 4BXXJ 2MEZA 1MBFA 2HOAA 1WH5A 3MKLA 1DWKA 1LLIA 3E7LA 5C44J 3GBGA 4NDLA 3LFPA 5DS9A 2X9DA 1K61A 3SCHA 1ETKA 4I6TA 4X4HA 3F52A 2MW8A 3LSRA 4J1WA 1IDYA 1AU7A 5DTDA 5F27A 5JLWA 4M3DA 4GQMA 4G12A 4A69C 3FYAA 3L1PA 1MBEA 4A3JJ 3GTKJ 2PUBA 1ETXA 1X57A 1EF4A 1MNMC 2LCVA 2M2EA 4CYCA 3SCFA 1WIZA 2H1KA 5EGOB 3BDNA 1IJWC 1D5YA 2AWIA 4JYKA 2LYQA 2PIJA 1RZRA 1ZZCA 5E3LA 4Z5DA 3JXDL 1PRAA 3ZQGA 2NS7A 3F6WA 3F0CA 1IRZA 3KJXA 1WETA 2BNNA 1ZR2A 2LYLA 4S0HB 2JWTA 3HOYJ 2LP0A 2XPWA 1JFSA 2ID6A 3HKZN 3I4MJ 1ZZ6A 1VNDA 5EDNA 2HQ5A 3GN5A 3OP9A 4X4CA 3Q0VA 1MBJA 3OSFA 4L5EA 1T33A 3GTMJ 2DMUA 4GHJA 4BBSJ 1T56A 4A3FJ 1WH8A 2LKXA 1GV5A 2P81A 5J1UA 4FE4A 2KPJA 4OB4A 2E2JJ 3CQZJ 3IH3A 1F36A 2EZKA 2L0KA 4DW6A 1VFCA 4PU3C 2PE5A 3F51A 3H3VK 3D1NI 2DJNA 1PUFA 1RPEL 2MSYA 3BR0A 3LSPA 5HODA 1GT0C 5EG0B 4X4DA 2H8RA 3B6AA 1VI0A 2EQRA 2Y31A 5FJ8J 1YRNA 3HOZJ 2R5YB 3BQYA 4I6ZA 4J1XA 2RAEA 1ITYA 3RZDJ 4BY7J 5GP9A 3BTLA 1IG7A 1MSFC 3ZHIA 2LFBA 1BW5A 2DA4A 1JTYA 3EUSA 1RZRD 2IV1A 2LYSA 4XRMA 1B0NA 3QYXA 4JP0A 1DW9A 3HZIB 2COBA 3TEDA 3LOCA 2PUAA 2BJCA 3PO3J 3R1FA 5K7HA 1AKHB 4M6VA 2BNMA 2XJ3A 3CDLA 4C3JJ 3ZOBA 1ORKA 1TWGJ 5J1YA 2R5ZA 1RESA 9ANTA 2LD5A 4Z58A 2KEIA 1QQBA 3GBFA 2W48A 2NVQJ 2FJRA 2OPTA 3FISA 1IDZA 1POGA 1LCCA 1OJLA 4MCXA 1X2LA 4MIMA 4UUSB 4Y7NJ 2BNOA 1FTZA 1UHSA 1RKTA 1WI3A 1ADRA 4RBOA 3LISA 2L7ZA 2LY9A 1L1MA 3I4NJ 2FQ4A 3B7HA 3WHBA 2MGQA 3A02A 3O8HA 5FKNA 1QPIA 2HDDA 3FKIJ 3DEWA 4PU8A 2XRLA 3FK6A 2LR8A 2AHQA 4IHWA 2O4AA 3S1QJ 3H5TA 2LYPA 1TWHJ 2R0QC 1H88C 1ZUGA 1ETYA 2CQQA 4V2FA 2CSFA 1IV6A 3SCGA 3BR1A 3QWGA 2EZIA 2CUEA 1LE8A 5EYRA 2E2IJ 3PM1A 1NERA 3VK0A 2HXOA 2O7OA 4C3HJ 5F04A 1UXCA 4MFDA 4A3MJ 3IH2A 4M3FA 1BA5A 3G1MA 2DMPA 4I76A 5M5WJ 3ZQLA 2XPVA 1NEQA 3CROL 1U9OA 4BBRJ 2Y9ZA 5M5YJ 1B72B 4YG7B 2JJ7A 1JKQC 1U78A 4Z5HA 2PPXA 1Y9QA 4FISA 3ZQCA 2K40A 5C3EJ 1POUA 1ZVVA 1BW6A 3TP0A 2O9LA 3S1MJ 2B5AA 2Y30A 5FLMJ 4JX6A 1GUUA 3HBLA 2XB0X 4W97A 2OR1L 3UFDA 3GTLJ 5FLVA 3SJMA 1IUFA 3GTOJ 4IHYA 2DA5A 1ETOA 3TP3A 4AUXA 1ENHA 2IVQA 3HOUJ 3S16J 4A3BJ 4LOCA 2AW6A 3OQOA 3IVPA 3JRBA 3HOVJ 2R63A 4XRSG 2LTPA 5FKLA 2DTZA 3LSGA 1PNRA 1VF9A 1BJZA 1PERL 2TCTA 2VI6A 1FIAA 1NTCA 5C4XJ 1JGGA 4FBIA 2ICPA 1UTXA 1I50J 4DYRA 2XSDC 4YARA 2CRGA 3BG5A 2XB5A 1I6HJ 2AUWA 3LNQA 2CROA 2EWTA 2JVLA 4IEJA 1JT0A 1CQTA 1JJ8C 1JT6A 2IBDA 5JLXA 1SQ8A 4C3IJ 3SFIA 3CLCA 1DU0A 4XICA 1ETQA 2L7FP 1B8IA 1R9TJ 1EFAA 3QF3A 1QPZA 4Y52J 4M3GA 1BL0A 2IEKA 2XGCA 3A01A 4IVZA 1SFOJ 2R93J 2E19A 3A03A 5K7ZA 2EH3A 5FKMA 2ICTA 2MQKA 5IOYA 2PUCA 5EZGA 2YUSA 2D5VA 3RQIA 3O9XA 1H89C 3ZQHA 1UXDA 1GV2A 5J3LA 3GTQJ 4PU4C 1DU6A 3BTJA 2R1JL 4IHXA 2WV1A 3BT9A 2HXIA 2JN6A 3DCFA 2YU9J 3QQ6A 2TRTA 4X6AJ 2LYJA 2XGDA 4FCYA 5F1JA 1QP7A 3CCYA 3ZQIA 3S1RJ 1ZZ7A 1JFTA 2JMWA 1MH4A 5FKOA 2PMZN 3K2AA 1LQCA 2K9NA 3DNVB 2IVBA 1QVTA 1XS9A 1BDIA 1TC3C 2XGEA 1JUSA 2WB1N 3IH4A 4UUTA 4JX4A 5IYDJ 3OMTA 1ZKGA 2K9SA 3FK7A 4BKXA 1HF0A 4IWRA 3HGGA 2OF7A 2DA1A 4A3LJ 2FX0A 5IPAA 2NS8A 1JKPC 1LMB3 3G5GA 4RDUA 4J19A 2EZLA 2DMQA 3JXBC 5F0HA 1S7EA 3CMYA 3JR9A 2JA5J 3U3WA 2EBIA 4MFEA 2ID3A 3MVPA 4D7MA 5K98B 3G7DA 2AO9A 1JJ6C 2A6CA 1G2HA 4XK4A 2FJ1A 1HCRA 1JUMA 2K9QA 5EGOA 4I8TA 2WAQN 2PUEA 1TWAJ 4XIDA 1ZR4A 1I3QJ 2HOTA 4CYCB 4QSHA 3G1OA 2Y0SN 2L7MP 4QIWN 5E3NA 3UKGA 2LYRA 2ZB9A 1X58A 1P7IA 4FE7A 1TWCJ 4MLOA 1Y1VJ 5M3MJ 5E3OA 2I10A 3OSGA 4X4EA 3JXCL 2R92J 3WHCA 2M8GX 2HOSA 3GN5B 1B8IB 2KEKA 4HNVA 1O4XA 1WCMJ 3HGYA 4B3AA 3A01B 4BY1J 3BD1A 2Y9YA 2AXUA 2QCOA 4C2MJ 5EG0A 1HDPA 1PUFB 3S1NJ 2OFYA 1A5JA 2R5YA 2KT0A 4Z59A 1UMQA 2GRMA 3BR2A 5K7FA 1W0UA 3RKQA 3CECA 5F0FA 3MN2A 2GZUA 2XPUA 5F0CA 1NK3P 1YRNB 2GBYA 1OCPA 2DN0A 2VKEA 1U8BA 1FEXA 2LYKA 2KDZA 1ZZ9A 2HINA 4NDWA 4PU7A 2LK2A 2JA7J 3TW7A 1SANA 1MBKA 2O38A 4O8BA 4X4BA 1TWFJ 2NOGA 1FIPA 3NAUA 4X4FA 2LLKA 2CU7A 3ZQFA 5IYCJ 3TRBA 1JWLA 4Z5CA 4B1RA 1U9NA 1RIOA 1AKHA 2IAIA 3JRFA 2ME0A 5EF6A 1IC8A 1AHDP 2CQXA 3GTGJ 4D5CA 4A3CJ 1QQAA 2ME6A 3S2HJ 3RZZA 4YG1A 3HOWJ 3S2DJ 3VPRA 1PRVA 2PUFA 2O49A 5IP9J 4JCYA 1MH3A 2R5ZB 1ZTRA 1QP4A 2FD5A 1ZQ3P 3HM5A 4UUSA 2AXZA 1XWRA 1FTTA 4QTRA 2WUSR 2ECBA 1X2NA 4V2GA 1RZSA 3MLFA 4Y42A 1JUPA 2GRLA 3KZ3A 2M0CA 4D5FA 4IHVA 3ZKCA 1VPWA 2IU7A 1RETA 1IGNA 4M3BA 2KEJA 2HI3A 3BR6A 3JRGA 4X1EA 4XRSA 2AXVA 3BG3A 3Q0WA 5J1RA 2R7ZJ 1CJGA 3OQMA 1Z0XA 1JTXA 1HLVA 2L8NA 2G0EA 3HOXJ 1X2MA 3K7AJ 5M5XJ 2EBYA 2M34A 2X6OA 4AC0A 2LVSA 2CJJA 1PRUA 2X48A 4ABZA 4A3GJ 2MG4A 2YS9A 3JRCA 1MBHA 2DA2A 2NVYJ 4I6RA 3BG9A 2IUOA 3JRHA 1HDDC 1GVDA 5IP7J 1XG1A 1LE8B 2GLOA 4GFBA 3S14J 2EZHA 2L9RA 1R69A 5M3FJ 4YG4A 3JRDA 1WPKA 3NARA 1LFUP 2VPRA 4A3DJ 3ZHMA 1APLC 2NVXJ 2JA6J 1Z77A 5C4JJ 5GPAA 1W0TA 2QF7A 1ZAYA 4FN3A 3TW6A 1B72A 1ETVA 2O8KA 2XI8A 4M3EA 4JCXA 1ZPQA 3BS3A 5EZHA 1ZK8A 2KZ8A 2HYJA 1HOMA 2DA7A 3SDGA 1JKOC 1WH6A 1ZZBA 1ZS4A 4JX5A 3GTJJ 3O8GA 2ELKA 4A3IJ 2JA8J 1JKRC 4DYCA 4FTHA 1K83J 1A6IA 3H0GJ 2E2HJ 1LCDA 2HSGA 4JQDA 1JH9A 3QQAA 3BQZA 3HDDA 3OOUA 4A3EJ 2JCGA 2IVGA 1OFCX 1ZZ8A 3FYMA 3RZOJ 1OSLA 3FMYA 2VUMJ 3C2BA 3GTPJ 3QPSA 2ECCA 2DA6A 3KXAA 3Q3SA 4IA8A 2B63J 4DZPA 4A3KJ 1LFBA 4F8DA 5IYBJ 4X4GA 2DMNA 1RR7A 4DZJA 3IV5A 3PO2J 5BNGA 1NK2P 1P7JA 1R63A 1UG2A 3S15J 1ZGWA 5FKKA 5GPCA 1ETWA 2M9HA 1RPWA 2WIUB 2PUGA 3BR3A 1QRYA 4AYBN 4A93J 4MCTA 1E3OC 1Q1VA 1MBGA 1YSEA 5EEAA 1GDTA 1BDHA 5E3MA 4MO7A 5IOZA 4B4CA 4EEFG 4YBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M3Y J;  3JRA A;  2VKV A;  3G1L A;  3LSJ A;  1QVU A;  1QP0 A;  2GM4 A;  1H8A C;  3JRE A;  2PUD A;  3OQN A;  4W1U A;  3S17 J;  4D7N A;  1RKW A;  3FIW A;  1OCT C;  3Q0U A;  2E1O A;  3JRI A;  1WH7 A;  2DMT A;  2L49 A;  3PXP A;  3OIO A;  5A7L A;  2DA3 A;  2XCJ A;  2XIU A;  1FJL A;  2JK3 A;  2Y2Z A;  3W6V A;  4I6U A;  4DYQ A;  3B6C A;  3HEF A;  1Y7Y A;  2EF8 A;  2N8G A;  1WGX A;  2CUF A;  5F08 A;  3BTI A;  3HB9 A;  4X4I A;  1MSE C;  2NVT J;  3BTC A;  3S8Q A;  1XC5 A;  1Y1W J;  3QPL A;  1F43 A;  5IP6 A;  3BR5 A;  3M4O J;  4BXX J;  2MEZ A;  1MBF A;  2HOA A;  1WH5 A;  3MKL A;  1DWK A;  1LLI A;  3E7L A;  5C44 J;  3GBG A;  4NDL A;  3LFP A;  5DS9 A;  2X9D A;  1K61 A;  3SCH A;  1ETK A;  4I6T A;  4X4H A;  3F52 A;  2MW8 A;  3LSR A;  4J1W A;  1IDY A;  1AU7 A;  5DTD A;  5F27 A;  5JLW A;  4M3D A;  4GQM A;  4G12 A;  4A69 C;  3FYA A;  3L1P A;  1MBE A;  4A3J J;  3GTK J;  2PUB A;  1ETX A;  1X57 A;  1EF4 A;  1MNM C;  2LCV A;  2M2E A;  4CYC A;  3SCF A;  1WIZ A;  2H1K A;  5EGO B;  3BDN A;  1IJW C;  1D5Y A;  2AWI A;  4JYK A;  2LYQ A;  2PIJ A;  1RZR A;  1ZZC A;  5E3L A;  4Z5D A;  3JXD L;  1PRA A;  3ZQG A;  2NS7 A;  3F6W A;  3F0C A;  1IRZ A;  3KJX A;  1WET A;  2BNN A;  1ZR2 A;  2LYL A;  4S0H B;  2JWT A;  3HOY J;  2LP0 A;  2XPW A;  1JFS A;  2ID6 A;  3HKZ N;  3I4M J;  1ZZ6 A;  1VND A;  5EDN A;  2HQ5 A;  3GN5 A;  3OP9 A;  4X4C A;  3Q0V A;  1MBJ A;  3OSF A;  4L5E A;  1T33 A;  3GTM J;  2DMU A;  4GHJ A;  4BBS J;  1T56 A;  4A3F J;  1WH8 A;  2LKX A;  1GV5 A;  2P81 A;  5J1U A;  4FE4 A;  2KPJ A;  4OB4 A;  2E2J J;  3CQZ J;  3IH3 A;  1F36 A;  2EZK A;  2L0K A;  4DW6 A;  1VFC A;  4PU3 C;  2PE5 A;  3F51 A;  3H3V K;  3D1N I;  2DJN A;  1PUF A;  1RPE L;  2MSY A;  3BR0 A;  3LSP A;  5HOD A;  1GT0 C;  5EG0 B;  4X4D A;  2H8R A;  3B6A A;  1VI0 A;  2EQR A;  2Y31 A;  5FJ8 J;  1YRN A;  3HOZ J;  2R5Y B;  3BQY A;  4I6Z A;  4J1X A;  2RAE A;  1ITY A;  3RZD J;  4BY7 J;  5GP9 A;  3BTL A;  1IG7 A;  1MSF C;  3ZHI A;  2LFB A;  1BW5 A;  2DA4 A;  1JTY A;  3EUS A;  1RZR D;  2IV1 A;  2LYS A;  4XRM A;  1B0N A;  3QYX A;  4JP0 A;  1DW9 A;  3HZI B;  2COB A;  3TED A;  3LOC A;  2PUA A;  2BJC A;  3PO3 J;  3R1F A;  5K7H A;  1AKH B;  4M6V A;  2BNM A;  2XJ3 A;  3CDL A;  4C3J J;  3ZOB A;  1ORK A;  1TWG J;  5J1Y A;  2R5Z A;  1RES A;  9ANT A;  2LD5 A;  4Z58 A;  2KEI A;  1QQB A;  3GBF A;  2W48 A;  2NVQ J;  2FJR A;  2OPT A;  3FIS A;  1IDZ A;  1POG A;  1LCC A;  1OJL A;  4MCX A;  1X2L A;  4MIM A;  4UUS B;  4Y7N J;  2BNO A;  1FTZ A;  1UHS A;  1RKT A;  1WI3 A;  1ADR A;  4RBO A;  3LIS A;  2L7Z A;  2LY9 A;  1L1M A;  3I4N J;  2FQ4 A;  3B7H A;  3WHB A;  2MGQ A;  3A02 A;  3O8H A;  5FKN A;  1QPI A;  2HDD A;  3FKI J;  3DEW A;  4PU8 A;  2XRL A;  3FK6 A;  2LR8 A;  2AHQ A;  4IHW A;  2O4A A;  3S1Q J;  3H5T A;  2LYP A;  1TWH J;  2R0Q C;  1H88 C;  1ZUG A;  1ETY A;  2CQQ A;  4V2F A;  2CSF A;  1IV6 A;  3SCG A;  3BR1 A;  3QWG A;  2EZI A;  2CUE A;  1LE8 A;  5EYR A;  2E2I J;  3PM1 A;  1NER A;  3VK0 A;  2HXO A;  2O7O A;  4C3H J;  5F04 A;  1UXC A;  4MFD A;  4A3M J;  3IH2 A;  4M3F A;  1BA5 A;  3G1M A;  2DMP A;  4I76 A;  5M5W J;  3ZQL A;  2XPV A;  1NEQ A;  3CRO L;  1U9O A;  4BBR J;  2Y9Z A;  5M5Y J;  1B72 B;  4YG7 B;  2JJ7 A;  1JKQ C;  1U78 A;  4Z5H A;  2PPX A;  1Y9Q A;  4FIS A;  3ZQC A;  2K40 A;  5C3E J;  1POU A;  1ZVV A;  1BW6 A;  3TP0 A;  2O9L A;  3S1M J;  2B5A A;  2Y30 A;  5FLM J;  4JX6 A;  1GUU A;  3HBL A;  2XB0 X;  4W97 A;  2OR1 L;  3UFD A;  3GTL J;  5FLV A;  3SJM A;  1IUF A;  3GTO J;  4IHY A;  2DA5 A;  1ETO A;  3TP3 A;  4AUX A;  1ENH A;  2IVQ A;  3HOU J;  3S16 J;  4A3B J;  4LOC A;  2AW6 A;  3OQO A;  3IVP A;  3JRB A;  3HOV J;  2R63 A;  4XRS G;  2LTP A;  5FKL A;  2DTZ A;  3LSG A;  1PNR A;  1VF9 A;  1BJZ A;  1PER L;  2TCT A;  2VI6 A;  1FIA A;  1NTC A;  5C4X J;  1JGG A;  4FBI A;  2ICP A;  1UTX A;  1I50 J;  4DYR A;  2XSD C;  4YAR A;  2CRG A;  3BG5 A;  2XB5 A;  1I6H J;  2AUW A;  3LNQ A;  2CRO A;  2EWT A;  2JVL A;  4IEJ A;  1JT0 A;  1CQT A;  1JJ8 C;  1JT6 A;  2IBD A;  5JLX A;  1SQ8 A;  4C3I J;  3SFI A;  3CLC A;  1DU0 A;  4XIC A;  1ETQ A;  2L7F P;  1B8I A;  1R9T J;  1EFA A;  3QF3 A;  1QPZ A;  4Y52 J;  4M3G A;  1BL0 A;  2IEK A;  2XGC A;  3A01 A;  4IVZ A;  1SFO J;  2R93 J;  2E19 A;  3A03 A;  5K7Z A;  2EH3 A;  5FKM A;  2ICT A;  2MQK A;  5IOY A;  2PUC A;  5EZG A;  2YUS A;  2D5V A;  3RQI A;  3O9X A;  1H89 C;  3ZQH A;  1UXD A;  1GV2 A;  5J3L A;  3GTQ J;  4PU4 C;  1DU6 A;  3BTJ A;  2R1J L;  4IHX A;  2WV1 A;  3BT9 A;  2HXI A;  2JN6 A;  3DCF A;  2YU9 J;  3QQ6 A;  2TRT A;  4X6A J;  2LYJ A;  2XGD A;  4FCY A;  5F1J A;  1QP7 A;  3CCY A;  3ZQI A;  3S1R J;  1ZZ7 A;  1JFT A;  2JMW A;  1MH4 A;  5FKO A;  2PMZ N;  3K2A A;  1LQC A;  2K9N A;  3DNV B;  2IVB A;  1QVT A;  1XS9 A;  1BDI A;  1TC3 C;  2XGE A;  1JUS A;  2WB1 N;  3IH4 A;  4UUT A;  4JX4 A;  5IYD J;  3OMT A;  1ZKG A;  2K9S A;  3FK7 A;  4BKX A;  1HF0 A;  4IWR A;  3HGG A;  2OF7 A;  2DA1 A;  4A3L J;  2FX0 A;  5IPA A;  2NS8 A;  1JKP C;  1LMB 3;  3G5G A;  4RDU A;  4J19 A;  2EZL A;  2DMQ A;  3JXB C;  5F0H A;  1S7E A;  3CMY A;  3JR9 A;  2JA5 J;  3U3W A;  2EBI A;  4MFE A;  2ID3 A;  3MVP A;  4D7M A;  5K98 B;  3G7D A;  2AO9 A;  1JJ6 C;  2A6C A;  1G2H A;  4XK4 A;  2FJ1 A;  1HCR A;  1JUM A;  2K9Q A;  5EGO A;  4I8T A;  2WAQ N;  2PUE A;  1TWA J;  4XID A;  1ZR4 A;  1I3Q J;  2HOT A;  4CYC B;  4QSH A;  3G1O A;  2Y0S N;  2L7M P;  4QIW N;  5E3N A;  3UKG A;  2LYR A;  2ZB9 A;  1X58 A;  1P7I A;  4FE7 A;  1TWC J;  4MLO A;  1Y1V J;  5M3M J;  5E3O A;  2I10 A;  3OSG A;  4X4E A;  3JXC L;  2R92 J;  3WHC A;  2M8G X;  2HOS A;  3GN5 B;  1B8I B;  2KEK A;  4HNV A;  1O4X A;  1WCM J;  3HGY A;  4B3A A;  3A01 B;  4BY1 J;  3BD1 A;  2Y9Y A;  2AXU A;  2QCO A;  4C2M J;  5EG0 A;  1HDP A;  1PUF B;  3S1N J;  2OFY A;  1A5J A;  2R5Y A;  2KT0 A;  4Z59 A;  1UMQ A;  2GRM A;  3BR2 A;  5K7F A;  1W0U A;  3RKQ A;  3CEC A;  5F0F A;  3MN2 A;  2GZU A;  2XPU A;  5F0C A;  1NK3 P;  1YRN B;  2GBY A;  1OCP A;  2DN0 A;  2VKE A;  1U8B A;  1FEX A;  2LYK A;  2KDZ A;  1ZZ9 A;  2HIN A;  4NDW A;  4PU7 A;  2LK2 A;  2JA7 J;  3TW7 A;  1SAN A;  1MBK A;  2O38 A;  4O8B A;  4X4B A;  1TWF J;  2NOG A;  1FIP A;  3NAU A;  4X4F A;  2LLK A;  2CU7 A;  3ZQF A;  5IYC J;  3TRB A;  1JWL A;  4Z5C A;  4B1R A;  1U9N A;  1RIO A;  1AKH A;  2IAI A;  3JRF A;  2ME0 A;  5EF6 A;  1IC8 A;  1AHD P;  2CQX A;  3GTG J;  4D5C A;  4A3C J;  1QQA A;  2ME6 A;  3S2H J;  3RZZ A;  4YG1 A;  3HOW J;  3S2D J;  3VPR A;  1PRV A;  2PUF A;  2O49 A;  5IP9 J;  4JCY A;  1MH3 A;  2R5Z B;  1ZTR A;  1QP4 A;  2FD5 A;  1ZQ3 P;  3HM5 A;  4UUS A;  2AXZ A;  1XWR A;  1FTT A;  4QTR A;  2WUS R;  2ECB A;  1X2N A;  4V2G A;  1RZS A;  3MLF A;  4Y42 A;  1JUP A;  2GRL A;  3KZ3 A;  2M0C A;  4D5F A;  4IHV A;  3ZKC A;  1VPW A;  2IU7 A;  1RET A;  1IGN A;  4M3B A;  2KEJ A;  2HI3 A;  3BR6 A;  3JRG A;  4X1E A;  4XRS A;  2AXV A;  3BG3 A;  3Q0W A;  5J1R A;  2R7Z J;  1CJG A;  3OQM A;  1Z0X A;  1JTX A;  1HLV A;  2L8N A;  2G0E A;  3HOX J;  1X2M A;  3K7A J;  5M5X J;  2EBY A;  2M34 A;  2X6O A;  4AC0 A;  2LVS A;  2CJJ A;  1PRU A;  2X48 A;  4ABZ A;  4A3G J;  2MG4 A;  2YS9 A;  3JRC A;  1MBH A;  2DA2 A;  2NVY J;  4I6R A;  3BG9 A;  2IUO A;  3JRH A;  1HDD C;  1GVD A;  5IP7 J;  1XG1 A;  1LE8 B;  2GLO A;  4GFB A;  3S14 J;  2EZH A;  2L9R A;  1R69 A;  5M3F J;  4YG4 A;  3JRD A;  1WPK A;  3NAR A;  1LFU P;  2VPR A;  4A3D J;  3ZHM A;  1APL C;  2NVX J;  2JA6 J;  1Z77 A;  5C4J J;  5GPA A;  1W0T A;  2QF7 A;  1ZAY A;  4FN3 A;  3TW6 A;  1B72 A;  1ETV A;  2O8K A;  2XI8 A;  4M3E A;  4JCX A;  1ZPQ A;  3BS3 A;  5EZH A;  1ZK8 A;  2KZ8 A;  2HYJ A;  1HOM A;  2DA7 A;  3SDG A;  1JKO C;  1WH6 A;  1ZZB A;  1ZS4 A;  4JX5 A;  3GTJ J;  3O8G A;  2ELK A;  4A3I J;  2JA8 J;  1JKR C;  4DYC A;  4FTH A;  1K83 J;  1A6I A;  3H0G J;  2E2H J;  1LCD A;  2HSG A;  4JQD A;  1JH9 A;  3QQA A;  3BQZ A;  3HDD A;  3OOU A;  4A3E J;  2JCG A;  2IVG A;  1OFC X;  1ZZ8 A;  3FYM A;  3RZO J;  1OSL A;  3FMY A;  2VUM J;  3C2B A;  3GTP J;  3QPS A;  2ECC A;  2DA6 A;  3KXA A;  3Q3S A;  4IA8 A;  2B63 J;  4DZP A;  4A3K J;  1LFB A;  4F8D A;  5IYB J;  4X4G A;  2DMN A;  1RR7 A;  4DZJ A;  3IV5 A;  3PO2 J;  5BNG A;  1NK2 P;  1P7J A;  1R63 A;  1UG2 A;  3S15 J;  1ZGW A;  5FKK A;  5GPC A;  1ETW A;  2M9H A;  1RPW A;  2WIU B;  2PUG A;  3BR3 A;  1QRY A;  4AYB N;  4A93 J;  4MCT A;  1E3O C;  1Q1V A;  1MBG A;  1YSE A;  5EEA A;  1GDT A;  1BDH A;  5E3M A;  4MO7 A;  5IOZ A;  4B4C A;  4EEF G;  4YBA A; 
#chains in the Genus database with same CATH topology
 3M3Y J;  3JRA A;  3LSJ A;  5DYM A;  3TQN A;  3FDY A;  1MJ9 A;  3OQN A;  4J01 A;  1OCT C;  1SD5 A;  4XOT A;  4OOI A;  3REO A;  1WH7 A;  3T0Y A;  2F4I A;  1ZH5 A;  3OS2 A;  2CQN A;  1KU7 A;  1FJL A;  3GZD C;  1LQ1 A;  3P9I A;  1YS7 A;  3K70 C;  1T38 A;  1F1Z A;  4HOB A;  5F08 A;  1N75 A;  2OQR A;  1VQN I;  3OIP A;  3FM3 A;  1MSE C;  3ZMT A;  2HTJ A;  1XC5 A;  2ZJ2 A;  4A0Y A;  5DM7 F;  1Y1W J;  4HDU A;  3QFI A;  1MMG A;  1SC7 A;  1F43 A;  5IP6 A;  4HV5 A;  1V54 H;  4IRI A;  1SD6 A;  3BR5 A;  3TEL A;  1G59 A;  1WRJ A;  4PGH A;  1J09 A;  4BXX J;  4YEL A;  1JXS A;  2MEZ A;  1MBF A;  1FX7 A;  2PLY A;  3F72 A;  2PXT A;  2GOX B;  5B1B H;  3C1D A;  2JT1 A;  3F21 A;  2F5F A;  2HCS A;  4I6T A;  1E3H A;  2VBW A;  5F27 A;  2LNM A;  4GXO A;  3ULQ B;  4M3D A;  5EJC A;  3KZY A;  4A69 C;  5F1R A;  3L1P A;  2VE8 A;  1W36 C;  2GOM A;  3QRF F;  3OWT A;  1R58 A;  1SFK A;  1EF4 A;  2VQG A;  5B5E C;  2RRE A;  2M2E A;  2NNN A;  1E17 A;  2IXS A;  1SFU A;  2JQE A;  3BDN A;  1GXP A;  2PIJ A;  3A4C A;  4F7Z A;  1ZZC A;  1XMK A;  2ZME A;  5E3L A;  4BDY A;  1PRA A;  3F6W A;  3KJX A;  3F0C A;  2QBY A;  1WET A;  2WB1 A;  1T8I A;  2LP0 A;  1R7J A;  3ASO H;  2PXK A;  3DP7 A;  1R5G A;  4EKG A;  5EDN A;  4UUV A;  4EKI A;  3QP6 A;  4L5E A;  5KHD A;  1T56 A;  1WH8 A;  4D0P A;  1GV5 A;  2P81 A;  2K02 A;  1X4P A;  3IH3 A;  4IRG A;  2L0K A;  3I71 A;  4L18 B;  2IRF G;  1RPE L;  2MSY A;  4ER6 A;  4IHT A;  3BRO A;  1BR4 A;  2VJJ A;  5HOD A;  1MDM B;  1VQ6 I;  3OR1 C;  5TJJ A;  2J7U A;  3B6A A;  1VI0 A;  4JOM A;  4AIH A;  3DLA A;  3OYL A;  3CCR I;  1R4N B;  4I6Z A;  4QLC U;  2GQQ A;  3RZD J;  1MSF C;  3BTL A;  1T0F A;  5LEK A;  3M8F A;  1BW5 A;  2PQ8 A;  3E3V A;  5TGT A;  3GX4 X;  1Z91 A;  5B1A H;  4RLQ A;  2XSJ C;  3ZCO A;  4XRM A;  1B9M A;  3QYX A;  1IO2 A;  2DLL A;  3CMA I;  3HZI B;  2COB A;  4EJW A;  1VQO I;  3CCS I;  2PUA A;  1FYM A;  2BJC A;  1AKH B;  4M6V A;  5D5W B;  2BNM A;  3H36 A;  4C3J J;  4D1Q A;  1ORK A;  1TWG J;  3BY6 A;  1ODD A;  2R5Z A;  2XDV A;  2X1C A;  3W2W A;  1OCC H;  2KEI A;  4DE8 A;  3C18 A;  3ZXS A;  2DI3 A;  5FRN A;  2FJR A;  4BQA A;  3G2B A;  4U88 A;  1IDZ A;  1POG A;  3TO6 A;  4UUS B;  2A6E F;  1S3J A;  4Y7N J;  4BE2 A;  3G0T A;  3IL2 A;  5HNH A;  2FBK A;  1BOA A;  1OCR H;  3HSE A;  3LIS A;  2LY9 A;  1L1M A;  3K4C A;  1TTY A;  3IP4 B;  2F4M B;  2WBM A;  3FXL A;  2X6Y A;  1U2Z A;  3I9V 2;  2IS1 A;  2CFX A;  2M5W A;  3O8H A;  4ZDL A;  3FKI J;  1BI0 A;  4KT6 A;  3AG3 H;  3DEW A;  2QA4 I;  2ZO4 A;  4M9Z A;  3FF5 A;  5HS9 A;  2LYP A;  2R0Q C;  2BBY A;  1HXD A;  2DK5 A;  1VQK I;  2CQQ A;  5KAF C;  2JQ7 A;  3ME5 A;  2J5O A;  3SCG A;  1IV6 A;  3ZGK A;  3FXO A;  2AS5 F;  2VBZ A;  1TQI A;  4P9F A;  1LE8 A;  5EYR A;  1D1A A;  1GHC A;  4DE9 A;  3GLX A;  2IVM A;  3TDZ C;  2O7O A;  5F04 A;  4A3M J;  3M9L A;  4N9I A;  2ETH A;  1BA5 A;  3WU2 C;  3JTG A;  1YW7 A;  3S8P A;  1LB2 A;  3CRO L;  4PCQ A;  4B44 A;  3RDI A;  4LLN A;  1U9O A;  3VB2 A;  1D8K A;  1U78 A;  1BN5 A;  1BJA A;  2G7U A;  2HVQ A;  4U0V A;  1Y9Q A;  2DAO A;  1POU A;  4NHJ A;  4HW0 A;  4KIC A;  4BHC A;  2O9L A;  4IKF A;  3S1M J;  4EJT A;  5AON A;  3SQN A;  5FLM J;  1IRF A;  4JX6 A;  1GUU A;  2DBB A;  1QA6 A;  3SJM A;  1ULY A;  2MLG A;  1YW9 A;  1DPR A;  4E7J A;  2WTE A;  1NG6 A;  3S16 J;  4LOC A;  3OQO A;  2EIL H;  4NC7 A;  1VQ8 I;  2JSP A;  1E2X A;  4XRS G;  2R63 A;  2KLO A;  2LTP A;  3KX2 A;  4P1W A;  1V3F A;  4FX4 A;  1L0O C;  3TMO A;  1PER L;  2XF7 A;  4CZZ A;  5C4X J;  2LY1 A;  1JGG A;  3WGG A;  1I50 J;  2CRO A;  2CMP A;  3L2U A;  4KIS A;  2AUW A;  2FF4 A;  2EWT A;  3QOW A;  1D0Y A;  4IEJ A;  5LGN A;  1JT0 A;  1PDN C;  2H27 A;  2K4B A;  2LYC A;  2IBD A;  5JLX A;  3LFU A;  5CQE A;  2PJP A;  3LQX A;  2MLK A;  3CO7 C;  1KA8 A;  3CLC A;  5FGM A;  4XIC A;  4GYG A;  2XAH A;  1ETQ A;  2L7F P;  2CFO A;  3SZP A;  3LAP A;  4DBQ A;  4M3G A;  4V19 K;  2IEK A;  3ABL H;  2LOO A;  3GME A;  4IVZ A;  2E19 A;  1ZG5 A;  1K6O A;  3M1C A;  1WZ2 A;  3K2Z A;  3R4K A;  2MQK A;  2KIQ A;  3RKY A;  1K79 A;  1IXR C;  4RAZ A;  2D5V A;  1O57 A;  3C7J A;  3QYF A;  4ENN A;  1B59 A;  4EGZ A;  2V79 A;  3ZQH A;  1UXD A;  4PUS A;  3GTQ J;  2R7U A;  2BY1 A;  3GYH X;  3V7S A;  2R1J L;  1XCV A;  2J5P A;  4IHX A;  2FOW A;  2WV1 A;  4C2T A;  3K10 A;  1K78 A;  2YU9 J;  1XSV A;  5E1Z B;  3R6S A;  1J59 A;  1FOX A;  1R4M B;  2EA4 A;  3CCY A;  3RPU A;  1YX3 A;  3ZQI A;  2AQE A;  4XLE A;  1JFT A;  4GYI A;  5FKO A;  2W25 A;  2PMZ N;  1WJ5 A;  5KVR A;  4LK0 F;  2MH2 A;  1LJ9 A;  1XS9 A;  1TC3 C;  2FU4 A;  3KZZ A;  4AYB A;  3OMT A;  1HF0 A;  4IWR A;  2OF7 A;  1HA8 A;  2L5Q A;  1WJF A;  3FMQ A;  2NS8 A;  5IPA A;  1TQP A;  1WQ2 A;  3WTS C;  3LA7 A;  3DPU A;  2XXQ A;  4Z6Y A;  3V7C A;  3HXL A;  2M4K A;  2EBI A;  4ZC3 A;  2BXY A;  3VYS B;  1FBS A;  1ZLJ A;  3MVP A;  4D7M A;  4EQQ A;  2AO9 A;  3BJA A;  3DEU A;  1KU2 A;  4XK4 A;  1HCR A;  3LWF A;  1S6L A;  3A9Y A;  2K9Q A;  5EGO A;  4I8T A;  2PUE A;  1H9G A;  2HKO A;  2KJC A;  3LST A;  2HOT A;  2MXD A;  4CYC B;  2XIG A;  4ASN A;  4QSH A;  4XBF A;  2L7M P;  5E3N A;  3VEP A;  1X58 A;  4LJZ F;  2FRH A;  2K9M A;  4MLO A;  5M3M J;  3F23 A;  1RUO A;  4IVN A;  4U87 A;  2LLV A;  3A9X A;  3E5X A;  3OSG A;  3GFJ A;  3GUU A;  3RTR A;  2KP6 A;  4QPO A;  4HPQ A;  3BG7 A;  3AKZ A;  3SZG A;  3HTS B;  1MJA A;  4NQW A;  1NH3 A;  2FQ3 A;  2D1H A;  2LMD A;  2Z2S B;  2KZV A;  1AA7 A;  5KAI C;  1A6Q A;  1Z6T A;  1HST A;  2MC4 A;  1HDP A;  4PJN A;  4MHG A;  3D0S A;  3AG4 H;  3R60 A;  1A5J A;  1M1E B;  1IN4 A;  5K7F A;  3LL7 A;  4CH7 A;  4OIN F;  3TFL A;  3OR2 C;  2GBY A;  4RMN A;  3IAS 2;  4BAC A;  2D2W A;  1UJ8 A;  2FE3 A;  2W57 A;  3NEU A;  4KYW A;  1U8B A;  2M87 A;  1FEX A;  2PXU A;  3MKW B;  2F48 A;  2E1C A;  3TW7 A;  1SAN A;  1MBK A;  2BVM A;  4O8B A;  1JHF A;  3CP2 A;  1FIP A;  1YE9 A;  2CU7 A;  4D9J A;  5IOZ A;  2EV5 A;  4AWX B;  4RM2 A;  2Z9O A;  1RIO A;  3WE3 A;  3HZJ A;  3JRF A;  4RLF A;  5E20 A;  1AHD P;  3GTG J;  2Z99 A;  5ILS A;  1QQA A;  2TDX A;  2XKO A;  4XN0 A;  3PNT A;  4YG1 A;  3EUK L;  2FOK A;  4PJM A;  2WC2 A;  6PAX A;  3LFK A;  5GAD J;  2O6G E;  2JZY A;  1G3W A;  5IY5 H;  2ZXJ A;  5E79 C;  3CCQ I;  3BOQ A;  3HM5 A;  2AXZ A;  2RQQ A;  1XWR A;  3E5Q A;  2PN6 A;  3PFY A;  2HOE A;  4UVC A;  2JTV A;  3HG9 A;  1YIO A;  1FY7 A;  1NHA A;  3IC7 A;  4XLF A;  4LG3 A;  1P4W A;  1KU3 A;  2H6C A;  1WFX A;  3D5L A;  4A2U A;  4D5F A;  4S04 A;  4E7K A;  3IUO A;  1VPW A;  3HSR A;  4XN3 A;  2LSO A;  2A69 F;  4LIT A;  3CJQ B;  3KEQ A;  3O3K A;  3JRG A;  4Y13 A;  1MJB A;  5IT3 A;  2R7Z J;  2GZW A;  2IW5 A;  3OQM A;  1Z0X A;  1SVM A;  1JTX A;  1HLV A;  2EK5 A;  3HOX J;  1X2M A;  4PFP A;  4UB6 C;  1B6A A;  2M34 A;  5GAH J;  2X48 A;  4RB1 A;  5D6E A;  3JRC A;  1PYV A;  2DA2 A;  3ABM H;  1R6R A;  2LBF A;  2M8E A;  3BG9 A;  3FXJ A;  4I6R A;  3JRH A;  1U2W A;  2PBI A;  1SD7 A;  1ZGJ A;  2GLO A;  3BJ6 A;  3F8M A;  1VQ9 I;  2L9R A;  3BP8 A;  5LHG A;  1KGS A;  3JRD A;  3UWP A;  1AWC A;  2VPR A;  5HLG A;  5GTI C;  3HYI A;  1W0T A;  3TW6 A;  2O8K A;  2XI8 A;  3GWZ A;  4BHB A;  1IN7 A;  4ENK A;  3BCB A;  2QQB A;  2DA7 A;  1JKO C;  3HTU A;  3F8F A;  3FMR A;  3ZMU A;  3GTJ J;  3KIO A;  1GVJ A;  3CF5 F;  4UVB A;  3A0H C;  3O8G A;  2ELK A;  4R1H A;  1KQ8 A;  1FSH A;  5DCM A;  4KIG A;  4A3I J;  4E7S A;  2JA8 J;  1D8J A;  2RNJ A;  5HDK A;  3FZV A;  3LAJ A;  1X1C A;  4FTH A;  3TO7 A;  3BC8 A;  3LQR A;  2OCE A;  5DTM A;  3QQA A;  3H92 A;  4LIV A;  4GCV A;  4ITV A;  4ER3 A;  3HDD A;  2QSG X;  1ZRE A;  2JCG A;  2VXZ A;  5L3F A;  2ZJR F;  3GW2 A;  2IVG A;  5LD2 C;  5BOX A;  4LIU A;  2XAQ A;  3FYM A;  3LMM A;  1MFQ C;  1XPX A;  3GTP J;  4DIQ A;  3FKJ A;  3CUQ A;  1P92 A;  3Q3S A;  4IA8 A;  4CSW A;  5ICF A;  3H35 A;  2B63 J;  3S3N A;  1FWZ A;  3MKZ A;  3CCV I;  3Q5F A;  1YIT I;  5IYB J;  2ACJ A;  2G9W A;  3HPH A;  4DZJ A;  1KON A;  5BNG A;  2VT3 A;  1MZB A;  1IRX A;  3LSH A;  4B47 A;  1HBX G;  3GZ5 A;  4ZYD A;  2UUZ A;  4IJA A;  3HOT A;  2PUG A;  2YX7 A;  3KZI C;  4A93 J;  1Q1V A;  2FEZ A;  1MW7 A;  2AXT C;  1ON2 A;  1X1P A;  3CLO A;  2KRH A;  4EEF G;  1W7P D;  2JPC A;  3GZC A;  1W5T A;  2VKV A;  2EIM H;  3PL8 A;  5GAG J;  1AOY A;  1QP0 A;  2K27 A;  2PUD A;  4I99 C;  4XLN F;  3A9Z A;  3CTA A;  3Q0U A;  4GRI A;  4MEY F;  5AIQ A;  2DMT A;  3J80 Z;  1IZ1 A;  5A7L A;  4BE1 A;  1SD4 A;  2XCJ A;  2NNY A;  4GDF A;  2Y2Z A;  4HRA A;  3L9F A;  2Q8K A;  4DYQ A;  2FSW A;  4NC6 A;  4BYY A;  1WGX A;  3HB9 A;  3BPV A;  2VB6 A;  2NVT J;  2HNH A;  3ZQ7 A;  3BTC A;  1I6X A;  2EB7 A;  3S8Q A;  3QPL A;  2Q2E B;  3ASN H;  2L4A A;  3HUG A;  1WJB A;  2ICW G;  1S7A A;  2O61 A;  1WH5 A;  3Q9S A;  4N4N B;  1DWK A;  2AQF A;  2QYO A;  2VJ5 A;  3G73 A;  3GBG A;  1EH6 A;  2BW3 A;  2VBX A;  5LFA A;  2X9D A;  5FLX K;  1K61 A;  4HBL A;  3F52 A;  3LSR A;  3F8C A;  3I4P A;  5DTD A;  3WE2 A;  2HR3 A;  4G12 A;  3FYA A;  2EV0 A;  4A3J J;  1X3U A;  3GTK J;  4ENJ A;  4LG0 A;  1I27 A;  1X57 A;  3DU6 A;  3S2W A;  4HX8 A;  1HQC A;  1WIZ A;  2VQC A;  4OAZ A;  5CVV A;  4HNT A;  2ADU A;  1S29 A;  1D5Y A;  4KDP A;  2E7X A;  2LNB A;  2ISY A;  5L3G A;  2QQ8 A;  3DXJ F;  2NS7 A;  3ABK H;  2GWR A;  1R49 A;  4RGU A;  3E1S A;  3WGH A;  2ID6 A;  2IA1 A;  2VJI A;  4XON A;  1YFH A;  2DU9 A;  1HSJ A;  3PIP F;  1NG7 A;  4XKW A;  2Z3Y A;  4E4H A;  4WXD A;  3JSO A;  3Q0V A;  4X4C A;  4ZYG A;  3OSF A;  4HST A;  1YG2 A;  2DMU A;  5L3E A;  3MFK A;  4KUM A;  1UHM A;  2KPJ A;  5J1U A;  4OB4 A;  5D8K B;  5DTR A;  4OIR F;  2EZK A;  1LVA A;  3H3V K;  1PUF A;  1I5Z A;  3RKX A;  3ZN0 A;  5EG0 B;  2ZFU A;  2CO5 A;  2H8R A;  2WAQ A;  5FJ8 J;  1WJC A;  3RJP A;  2R5Y B;  1T98 A;  2M45 A;  4XRF A;  3ZHI A;  3HOS A;  4EGY A;  4Y15 A;  1Y8Q B;  1A36 A;  3EUS A;  4HX4 A;  4GO1 A;  5CVU A;  1RZR D;  2LYS A;  2YPR A;  1MMD A;  3KP6 A;  1YHQ I;  2KRC A;  1JI8 A;  2CYY A;  2NAZ A;  5BQT A;  1EKE A;  1LDJ A;  2EPF A;  2VC1 A;  1S7O A;  3LOC A;  3MCZ A;  3TED A;  2XGX A;  4IO9 F;  4Y3O A;  1BR1 A;  2GXA A;  3PSF A;  3FXU A;  1RES A;  4P5O A;  4XSZ F;  2NVQ J;  3OL4 A;  3FIS A;  4BUP A;  1LCC A;  4RGR A;  1OJL A;  5L3B A;  4M71 A;  1FBQ A;  1BM9 A;  3NXH A;  2BNO A;  2XUB A;  1UHS A;  1WI3 A;  1RNL A;  1U5T B;  4DJA A;  4BEH A;  5JHF A;  3K4K A;  2IPQ X;  2NS0 A;  2BY0 A;  4OAY A;  3U21 A;  4CIC A;  1QPI A;  2OZU A;  1TP4 A;  2E34 A;  4PJ0 C;  2L9S A;  1BOB A;  4IXA A;  4RAY A;  3AG2 H;  4RS8 A;  3G3Z A;  4JK1 X;  1TWH J;  4DBR A;  3OYG A;  2MAB A;  2QBY B;  2R7Q A;  1O7F A;  5HS8 A;  4HQE A;  1H88 C;  2KJB A;  2KQR A;  3KE2 A;  3MKY B;  2LG4 A;  4P55 A;  3BR1 A;  4P9U A;  4B3X A;  2GA1 A;  2NVU B;  4O3M A;  1NER A;  3VK0 A;  3LSM A;  2HXO A;  4M3F A;  1DGW Y;  3G1M A;  4Q47 A;  3TDU C;  2DMP A;  2A05 A;  2OJE D;  1XCB A;  3V8L A;  1I1G A;  4M74 A;  4PJJ A;  2L01 A;  4Y33 A;  4EM1 A;  5M5Y J;  4U7D A;  1B72 B;  4PGG A;  1X3Z B;  3ZQQ A;  4OMY A;  5DUK A;  4G6Q A;  2EIN H;  2X6X A;  3C2G A;  5FD6 A;  3HHG A;  2QWW A;  1BW6 A;  3MWM A;  3TP0 A;  2JRT A;  4F55 A;  3GO5 A;  2QM3 A;  2PMU A;  4W97 A;  1OMI A;  2XB0 X;  1U5T C;  2OR1 L;  2Z1D A;  4AU7 A;  4HNU A;  5TRD A;  2IGO A;  4CHU A;  1U8R A;  1IUF A;  3GTO J;  1ETO A;  4IPA A;  4AUX A;  4HAM A;  1ENH A;  2NYX A;  4A3B J;  3OS0 A;  2AW6 A;  4WWC A;  2OZ6 A;  2W4S A;  4YIF A;  4WVL A;  3H1C A;  1MIJ A;  3CDH A;  1PNR A;  1VF9 A;  1X1B A;  1BJZ A;  4L9J A;  3I5U A;  3I58 A;  2P7C B;  3KET A;  2C6Y A;  1IUY A;  2ZFW A;  1FIA A;  1NTC A;  1ZVV A;  2E5Z A;  1UTX A;  4YAR A;  1O3T A;  4EK9 A;  3I53 A;  3OS1 A;  3LNQ A;  3OYC A;  1QZZ A;  5EEH A;  1JJ8 C;  1SQ8 A;  1TT5 B;  5L3D A;  1XGM A;  1YTY A;  1JHH A;  1DU0 A;  3FBN B;  4KNY A;  1B8I A;  1QPZ A;  3CD6 I;  4Y52 J;  1TBX A;  1LPQ A;  1E3P A;  2V1U A;  2V3C C;  2STW A;  3O6B B;  1SFO J;  2R93 J;  3DM5 A;  2BEO A;  4AIJ A;  2EH3 A;  5FKM A;  2B7E A;  3D5R C;  5IOY A;  1OYW A;  1ZEL A;  1W4M A;  3MD2 A;  4OWR B;  2UV1 A;  2PJR A;  4AVZ A;  1W5S A;  2M7A A;  4G6T B;  4KN4 X;  5H6R A;  2V6E A;  1DU6 A;  2ELH A;  2DPD A;  5ED4 A;  3OKZ A;  4YIR X;  2Y0S A;  3KP4 A;  4XKB A;  1LKX A;  1T0F C;  2HXI A;  2JN6 A;  2P5V A;  3DCF A;  3JW4 A;  2HDW A;  4I01 A;  4RB0 A;  3VSK A;  3QQ6 A;  2TRT A;  3QOP A;  2K5C A;  2CV2 A;  2XGD A;  3KYC B;  4FCY A;  4XM3 A;  5F1J A;  2ESH A;  1QP7 A;  3TOA A;  5ICC A;  4Q5S F;  1ZZ7 A;  4AD9 A;  1WVR A;  1QVT A;  5CYV A;  1BDI A;  2DPU A;  2QEN A;  2WB1 N;  4OIO F;  2A6H F;  4JX4 A;  4HLY A;  5IYD J;  3EET A;  3FK7 A;  2ZXI A;  3F9K A;  4CCM A;  1QGP A;  1QO0 D;  4HLX A;  4RGS A;  3E6C C;  1YW8 A;  3V42 A;  3QPH A;  3S3O A;  1VQ5 I;  4J19 A;  3E97 A;  2EZL A;  5E1X A;  3ERE D;  2R7F A;  3JXB C;  4LK1 F;  4UV9 A;  4BJ6 C;  4BHP A;  2K7L A;  4N9H A;  3U3W A;  4MFE A;  4X0G A;  3G7D A;  3EQL F;  1JJ6 C;  3CC7 I;  3CCU I;  4A5M A;  2DTR A;  3GCM A;  2VON A;  4BQQ A;  3WTV C;  2HPM A;  1ZRD A;  4XID A;  5FLX Z;  1ZR4 A;  1K4T A;  4MEX F;  4Q48 A;  4DOZ A;  3G1O A;  2Y0S N;  2CQ7 A;  4N0B A;  1YJN I;  4I0A A;  5E3O A;  2MFZ A;  2I10 A;  3T8T A;  3OWQ A;  1G3S A;  2OAZ A;  2V1N A;  4JBA A;  4MTD A;  4WF2 A;  1Y56 A;  3KLO A;  2HOS A;  3PQJ A;  3GN5 B;  1OR7 C;  1FP2 A;  3E5U A;  4ZZL A;  1WCM J;  4CDG A;  4BQN A;  3H5N A;  1WWX A;  4B3A A;  3QWL A;  5BPI A;  3DKY A;  1MDM A;  2E35 A;  2B0L A;  2OFY A;  4Z59 A;  3H9G A;  3RKQ A;  4MQV A;  3CEC A;  2BGC A;  2GZU A;  2XPU A;  3EUA A;  1YRN B;  2HYF A;  2DN0 A;  1ZGA A;  1XDU A;  2HIN A;  1WSU A;  2JA7 J;  2O38 A;  1P2F A;  4X4B A;  1SMY F;  1TWF J;  1WJA A;  3NAU A;  2HKX A;  2LLK A;  4X4F A;  3K6G A;  1WI9 A;  1G8X A;  1PUE E;  4NC8 A;  3GFM A;  4IZZ A;  4Z5C A;  2XAF A;  3PNY A;  4BU2 A;  1AKH A;  2IAI A;  2RQP A;  3HRM A;  3KP2 A;  5EF6 A;  1ZAR A;  2ME6 A;  3UR3 C;  1QHG A;  2PUF A;  1PRV A;  1R1V A;  4MTE A;  2R7V A;  3ZN1 A;  1X1A A;  4G7Z F;  1ZQ3 P;  4UUS A;  2L7K A;  3A0B C;  1NW3 A;  2JUC A;  1G3Y A;  2ECB A;  2WUS R;  3L09 A;  1HW1 A;  4Y42 A;  3HRT A;  2E5N A;  3FXK A;  2XAS A;  3WTT C;  2YU3 A;  3RCO A;  3IHU A;  4IHV A;  3ZPX A;  1SAX A;  2MYS A;  1TZL A;  5D5V B;  4QWQ A;  5L3C A;  1FT9 A;  3J80 K;  3BR6 A;  3NRV A;  2L3D A;  1CJG A;  2O8X A;  2E71 A;  3COA C;  3K70 D;  1IRG A;  2A61 A;  4LD5 A;  3K7A J;  2D45 A;  3DFG A;  2EBY A;  2LVS A;  3EUH C;  5ILV A;  2CJJ A;  2F5D A;  2KFD A;  5E8I A;  4ABZ A;  4A3G J;  2MG4 A;  3ESW B;  4A6D A;  2NVY J;  4IQJ A;  1VQP I;  2LLW A;  1BI1 A;  2GIZ A;  4XR6 A;  4BE0 A;  4M6X A;  5HS7 A;  5IP7 J;  5K5O A;  1LDD A;  1R5I D;  1QQI A;  5CKT A;  1ERD A;  3RYR A;  4NQW B;  3DTI A;  4UNO A;  1L3L A;  3NAR A;  2PI0 A;  4B09 A;  2UXN A;  4A3D J;  3GFI A;  1APL C;  2NVX J;  2JA6 J;  3VFZ A;  5C4J J;  1EH7 A;  1XB4 A;  5GPA A;  4JCX A;  2KHM A;  4M3E A;  4ZYH A;  1W5C C;  5EZH A;  1UHW A;  1W36 D;  3H5R A;  4E7L A;  1WH6 A;  1FYK A;  2HFH A;  1ZS4 A;  1QNT A;  2BV6 A;  3K1M A;  2EIJ H;  3NRO A;  4XLA A;  3V8J A;  2QEX I;  1JKR C;  1A6I A;  1W7P A;  3H0G J;  2E2H J;  3DTE A;  1JH9 A;  2XHK A;  4Y17 A;  4II2 A;  1KQ0 A;  3HC7 A;  3OOU A;  4KMU X;  4ESF A;  5DV5 A;  1OFC X;  1ZZ8 A;  1QPM A;  4A6E A;  3RZO J;  1OSL A;  2BXZ A;  4IOC F;  2ECC A;  3FMS A;  1VQ7 I;  3WG7 H;  4A3K J;  2LKS A;  3ZMZ A;  2WY7 Q;  1G3T A;  2EJR A;  2ESN A;  2HGC A;  4F8D A;  1TLH B;  3EYY A;  4XL9 A;  3U9G A;  4BS9 A;  3IV5 A;  1F9N A;  3DU5 A;  4C9Y A;  1C0W A;  3JSP A;  2L2O A;  3KYD B;  3BR3 A;  2BY3 A;  4AYB N;  4BAY A;  1QZY A;  3UNG C;  1E3O C;  1IW7 F;  5EEA A;  4PSW A;  5E3M A;  1GDT A;  1QU3 A;  4MO7 A;  4B4C A;  3R09 A;  2VLA A;  3H9Q A;  3TBI A;  3PIO F;  1KYZ A;  1Z7L A;  3PFI A;  1QVU A;  4RGX A;  4HDV A;  1UCR A;  2GM4 A;  5LEJ A;  2EV6 A;  3JRE A;  1H8A C;  3MZ8 A;  2XKP A;  3S17 J;  2F5E A;  1RKW A;  1HW5 A;  3EDP A;  3FIW A;  2UZK A;  2P5L C;  3QAH A;  2E1O A;  3LSI A;  5DM6 F;  2LF7 A;  3J7A Y;  2DOF A;  2HCN A;  2L02 A;  2LKP A;  3KEY A;  3PXP A;  2DA3 A;  4R8H A;  2LBF B;  1Z21 A;  4I6U A;  3W6V A;  2DW4 A;  3B6C A;  2WAD A;  3HEF A;  4O6J A;  2N8G A;  2EF8 A;  2CUF A;  2DOD A;  2DOE A;  3BTI A;  1HKT A;  4X4I A;  5H6Q A;  1FMV A;  4G7O F;  2CV0 A;  2O5R A;  3CDI A;  1V5F A;  3SZT A;  4OU0 A;  3BZC A;  1RIO H;  2XV4 S;  3L2R A;  2HOA A;  4CO8 A;  3MKL A;  1LLI A;  5C44 J;  2Y75 A;  4U0W A;  2M3A A;  3BPX A;  5DS9 A;  1D5V A;  2QLZ A;  5E17 F;  5DCM B;  4X4H A;  2MW8 A;  4KT5 C;  1IDY A;  1X1D A;  1USS A;  5JLW A;  2LY2 A;  1FSE A;  3M07 A;  1MBE A;  2BY2 A;  2DJI A;  1WJE A;  3GEZ A;  2PUB A;  1MMS A;  1HKS A;  2WY8 Q;  3I0T A;  2DQL A;  3MZH A;  2LCV A;  3SCF A;  4CYC A;  4UB8 C;  5DDG A;  3LSK A;  2E7W A;  1IJW C;  2OTL I;  4JYK A;  2LYQ A;  1O3Q A;  1YJ9 I;  1RZR A;  3CUQ B;  5A2Q Z;  4Z5D A;  1D3Y A;  1K7A A;  5BPD A;  2BNN A;  5KK1 A;  1ZR2 A;  2WWY A;  4S0H B;  1BIB A;  3HOY J;  2XPW A;  3OIQ A;  5DRT A;  1JFS A;  3I4M J;  3KL4 A;  5DD8 A;  1Z05 A;  2VXD A;  3R0J A;  4I09 A;  2XF5 A;  2L9V A;  4GHJ A;  3ZPL A;  1VZ0 A;  1SAU A;  2A07 F;  4BBS J;  1YLF A;  2LKX A;  5H20 A;  5CVI A;  4IHS A;  3CQZ J;  2EFN A;  2BE5 F;  3CCL I;  1UEL B;  3M9A A;  1VFC A;  1Y8R B;  4PU3 C;  3F51 A;  3D1N I;  1YOV B;  3BR0 A;  4E7I A;  1GT0 C;  3SX0 A;  2QQA A;  2R7D A;  4X4D A;  4F92 B;  4JQF A;  3HOZ J;  1U6G A;  1N78 A;  4J1X A;  4YFN F;  2PXE A;  4ETS A;  1Z9C A;  1ITY A;  3U2R A;  4BY7 J;  5GP9 A;  1IG7 A;  2VOP A;  2DA4 A;  3RKW A;  4WCG A;  4YRV A;  4L9V A;  1DW9 A;  1MND A;  3I59 A;  2OD5 A;  4FET A;  3QYE A;  1B1B A;  3I54 A;  1R36 A;  1UG0 A;  3CDL A;  2Z33 A;  4BDZ A;  2DFH A;  2W82 A;  5LRR A;  9ANT A;  4ER7 A;  3C3W A;  3HUG B;  3N4M A;  3GBF A;  2W48 A;  3S32 A;  3TGN A;  2OPT A;  2P5K A;  2F5V A;  3HPG A;  3T1B A;  3W6K B;  3M7G A;  1KU9 A;  3ISP A;  4MIM A;  3ZMV A;  5LLQ A;  4PU7 A;  2M1B A;  1FTZ A;  2LRD A;  3BLY A;  4LFU A;  1FP1 D;  1MD0 A;  2R7O A;  2QSF X;  4IF4 A;  2L7Z A;  4EM2 A;  1I3A A;  1FLI A;  1FBU A;  1EV7 A;  3I4N J;  2FQ4 A;  2ZJP F;  2FNP A;  2MGQ A;  2L54 A;  3CJR B;  2XVC A;  3WTY C;  2Z16 A;  2ZCW A;  4PZJ A;  1CF7 B;  3AFH A;  2XRL A;  3C2H A;  3L00 A;  1J9I A;  2AHQ A;  4WK8 F;  2A3S A;  2DT6 A;  4EMS A;  3H5T A;  2W7N A;  4A0X A;  4RM3 A;  2Y0M A;  3KFW X;  2HZD A;  3OYA A;  4HA8 A;  2IA2 A;  1ZUG A;  4Q4Z F;  2YBD A;  1ZN2 A;  2CSF A;  2VOO A;  4NNJ A;  3P5J A;  2CUE A;  3M8E A;  2OCC H;  3PM1 A;  1TNS A;  2RKH A;  2UWM A;  1STZ A;  2ZXH A;  2EIK H;  4Z2Y A;  3WOD F;  4I76 A;  5M5W J;  4MQ9 F;  2XPV A;  1NEQ A;  2F5C A;  5H2F C;  3WU0 A;  4ZYE A;  4ZYA A;  2E1M B;  1P9Q C;  4AM3 A;  3ML6 A;  2HU9 A;  1FYL A;  2JJ7 A;  1JKQ C;  2KL4 A;  3QOX A;  4Z5H A;  3GZ6 A;  4FIS A;  2XXP A;  5KCM A;  2K40 A;  5C3E J;  4C2U A;  3WTX C;  1R1U A;  1LEB A;  1QBJ A;  5FRO A;  3ERM A;  4EQZ A;  3HBL A;  1R71 A;  3QOE A;  1KZH A;  3CZ6 A;  3GTL J;  4IHY A;  1F4K A;  2DA5 A;  1OKR A;  3TP3 A;  3QYB A;  2R7X A;  5LGU A;  2Z5U A;  1T39 A;  1VQ4 I;  1IN5 A;  1IN8 A;  2B9S A;  3HOU J;  2ZNY A;  1ZRC A;  4CCN A;  5TIS C;  3I3L A;  3IVP A;  1RC9 A;  2X51 A;  2DDA A;  5FKL A;  2DTZ A;  2KPM A;  3LSG A;  4CCL A;  4ON0 A;  4BL0 B;  3CME I;  4FBI A;  2ICP A;  4I98 B;  4DYR A;  2CRG A;  3BG5 A;  2XB5 A;  4PK4 A;  5F64 A;  4IOA F;  4M9X A;  3T8R A;  1LDK B;  3OYD A;  4E70 A;  2IS4 A;  2A68 F;  3F6O A;  2NOJ B;  1J7K A;  3RPQ A;  3QF3 A;  4BEH B;  1OCZ H;  3Q9V A;  4I7H A;  1BL0 A;  1J5Y A;  2HTS A;  3R61 A;  3G6E I;  4ESB A;  2H09 A;  2XGC A;  3A01 A;  3HJE A;  2RGV A;  2ICT A;  1R00 A;  3IKV A;  4G7H F;  2PUC A;  2PFB A;  3WTW C;  2E1M C;  3RQI A;  3O9X A;  2VJ4 A;  4RB2 C;  1H89 C;  3W6J B;  5FFX A;  3GXO A;  3PUF A;  4B48 A;  1GV2 A;  2CSO A;  2M30 A;  2O3F A;  2VC0 A;  2X85 A;  3HRU A;  1Q1H A;  4IQ4 A;  3FHN A;  1IXS B;  2LC2 A;  3BT9 A;  1TQM A;  2IP2 A;  5D8L B;  2CQK A;  2P8T A;  2IGN A;  2LYJ A;  2HQN A;  2IA0 A;  3F8B A;  2PXV A;  2LH9 A;  1TL8 A;  3SYT A;  3QPT A;  3DKX A;  3ECO A;  3FXR A;  4XKV A;  2HQA A;  2ZNZ A;  3ONQ A;  4RAF A;  2HWV A;  5DEQ A;  2K9N A;  3DNV B;  2IVB A;  4CCO A;  3WG9 A;  3KLN A;  2XGE A;  1JUS A;  2V7F A;  3IH4 A;  4UUT A;  3MEX A;  3M8J A;  3ZR8 X;  4C30 A;  2DA1 A;  4A3L J;  1ZG3 A;  2V6C A;  2FX0 A;  1U3E M;  4KFC A;  1LMB 3;  2CWE A;  1FOW A;  5GAH i;  3I55 I;  1Y0N A;  1W1W E;  4PSX A;  2I8D A;  2K85 A;  5B66 C;  5HNF A;  1OQY A;  4H0E A;  2ID3 A;  5K98 B;  5D6F A;  2OV7 A;  2RN7 A;  2W84 A;  1G2H A;  4BJT A;  3DLL F;  1BC7 C;  2WAQ N;  1D1C A;  3OMY A;  1I3Q J;  4CYD A;  4I0B A;  5JVT A;  5FO5 A;  4WXH A;  4FQG A;  5JVG F;  1DPU A;  4LB6 B;  1I39 A;  4QIW N;  2VQL A;  3UKG A;  2ZB9 A;  1TWC J;  2PX9 A;  2ZME B;  3P9C A;  5J6X A;  1Y1V J;  1O3R A;  1CGP A;  1HW2 A;  2L1P A;  4UY8 I;  5DT2 A;  2PXQ A;  2EFO A;  5EEG A;  3ZRG A;  4X4E A;  5HLT A;  2BYV E;  2BHY A;  2LF8 A;  2STT A;  1FMW A;  1O3S A;  2R92 J;  3WTZ A;  3AG1 H;  2F4O B;  5LHI A;  2XRO A;  4DQ2 A;  1B8I B;  4HNV A;  3J7A O;  4O5V A;  2KEK A;  4II3 A;  1O4X A;  3A1Y A;  3HGY A;  3EPZ A;  4BY1 J;  2AXU A;  1MMN A;  2GXG A;  4IX7 A;  4Y4R A;  5EG0 A;  2JSC A;  4KIT B;  5ICE A;  2R5Y A;  2KT0 A;  1UMQ A;  1W0U A;  5F0F A;  2JVG A;  1KQ9 A;  3MN2 A;  2F6C A;  2WAF A;  5F0C A;  2X1D A;  1QHH D;  4M9S A;  2PJR B;  1OCP A;  2PXL A;  2VKE A;  1WHU A;  1VTN C;  4IL6 C;  2LYK A;  2KDZ A;  3HL2 A;  2ZKZ A;  1K4S A;  3GZN B;  1TW2 A;  2X1E A;  3OYN A;  3ROU A;  2V1D A;  1WKM A;  1XX5 A;  2H8W A;  4BJ5 C;  4AVP A;  3MMY B;  2DFI A;  3GZD A;  2VN2 A;  2NOG A;  2DDB A;  3B02 A;  3ZQF A;  2FXA A;  4F91 B;  4B1R A;  2XXA A;  5IT9 K;  1U9N A;  4L5I A;  2PXP A;  1IC8 A;  4EM0 B;  4EV0 A;  3CJT B;  4D5C A;  4ER0 A;  3S2H J;  4HSR A;  3DBL B;  1Z6R A;  2Q0O A;  3VPR A;  1Y6I A;  1Z67 A;  5B3S H;  3JAM Z;  2M0M A;  2RVC A;  2R7S A;  5FD5 A;  5IP9 J;  2ZME C;  3K1N A;  3PUB A;  5GAG i;  1MH3 A;  3IRQ A;  3D5S C;  2R5Z B;  1ZTR A;  4JCY A;  3HIF A;  3RQ4 A;  4HF1 A;  1FTT A;  4QTR A;  1ZG1 A;  1U5T A;  1X2N A;  3MQ0 A;  4V2G A;  3MLF A;  5D4S A;  4HYE A;  4U0Y A;  4RB3 C;  3BJO A;  2GRL A;  2M0C A;  5HDN A;  3K0L A;  3CC4 I;  3ZKC A;  4YG2 F;  3CC2 I;  5ICG A;  4EAT A;  4M3B A;  2Y48 A;  5CVR A;  2ZJQ F;  2CV1 A;  4LMY A;  1XMA A;  3Q0W A;  2KIS A;  2L8N A;  3LA2 A;  1R5H A;  3DBH B;  3L7W A;  5M5X J;  3WU1 B;  1A31 A;  2X6O A;  3QOD A;  1XD7 A;  4AC0 A;  3DPT A;  3NDB B;  2FBI A;  1QZX A;  1HDD C;  1GVD A;  3W2A A;  1XG1 A;  1LE8 B;  4GFB A;  3S14 J;  2EZH A;  5M3F J;  4G8X A;  4L0Y B;  1WPK A;  5J4Y A;  3M1E A;  4OIQ F;  3BCA A;  5HOO A;  3ZHM A;  5J40 A;  2HYG D;  2XF6 A;  2EWN A;  1Z77 A;  5E18 F;  2MC3 A;  5LGT A;  2P6T A;  2QF7 A;  1PVE A;  3CCJ I;  1B72 A;  1ZAY A;  3BS3 A;  1LEA A;  1ZK8 A;  3J7Y J;  5HLI A;  2A6T A;  3OYM A;  1U0J A;  2VQH A;  1XGS A;  3K4L A;  5KNL A;  1GXQ A;  2OTJ I;  1E0E A;  3BG6 A;  3PQK A;  1SFE A;  1SVO A;  4L5J A;  1ZZ9 A;  3BDD A;  3G71 I;  1MKM A;  2KIU A;  1XTA A;  5A2Q K;  1P6R A;  1LCD A;  2M4G A;  5DTQ A;  4JQD A;  3K4J A;  4ZH4 F;  4CCJ A;  4LB5 A;  2K86 A;  3SR4 A;  4A3E J;  3GF2 A;  3L2Q A;  2IT0 A;  1D1B A;  4YEJ A;  3PNV A;  1HKQ A;  4DGW B;  4HRI A;  3E6B A;  3OY9 A;  3OL3 A;  1V55 H;  1JE8 A;  3L2W A;  4EVI A;  3CES A;  4R79 A;  5K1Y A;  3IWZ A;  3O2P E;  2VEO A;  1QZE A;  1SMT A;  2G7H A;  2P7V B;  2A5Y B;  4G9Y A;  1S72 I;  1RR7 A;  4QPQ A;  3RSN A;  5F6F A;  1NK2 P;  3TKY A;  1P7J A;  4CXF A;  1J2X A;  1X3W B;  2V26 A;  5LHH A;  1ZGW A;  4UVA A;  2RDP A;  5FKK A;  1MMA A;  5GPC A;  1RZ4 A;  2M9H A;  2IJL A;  3V7R A;  3OYE A;  3B73 A;  3FHZ A;  1YSE A;  3F3X A;  3GVA A;  4P96 A;  4YBA A;  4ZJZ A;  4BQO A;  3G1L A;  4A0Z A;  2VT2 A;  3CUO A;  2NXN B;  4XQF A;  3JTH A;  4DNC A;  4W1U A;  4D7N A;  2P6S A;  4I02 A;  5JR3 A;  2D1V A;  4CUG A;  3WGI A;  3JRI A;  1VQM I;  2L49 A;  1K78 B;  3OIO A;  3EYI A;  2R7W A;  2XIU A;  2FMY A;  1OR7 A;  2JK3 A;  3HKZ A;  3VYR B;  3I64 A;  3HHH A;  1Y7Y A;  3A2K A;  2GIV A;  3CMM A;  3AL0 B;  1SFX A;  2JPB A;  2V9V A;  4HEA 2;  3RYP A;  1D0X A;  1BI3 A;  2DFF A;  2W1O A;  3J81 Z;  2Q1Z B;  2XAU A;  4M73 A;  5E1W A;  3M4O J;  2XAJ A;  1V4R A;  4OBM A;  2CW0 F;  3E7L A;  2H6B A;  3SHF A;  4NDL A;  3H3U A;  3LFP A;  3OYB A;  2DO7 A;  3SCH A;  1ETK A;  3J7Z I;  4J1W A;  4OMZ A;  1AU7 A;  5HLH A;  4BNC A;  1ACI A;  1W7P B;  4GQM A;  3ABT A;  4KJZ A;  3CF2 A;  3E0J B;  5DD4 A;  2HVS A;  2V4J C;  2X4H A;  1ETX A;  3CCE I;  2P0W A;  1MNM C;  1UZC A;  3VWS A;  2K3F A;  2H1K A;  1YX5 A;  5EGO B;  1K6Y A;  3CLQ A;  4M72 A;  2AWI A;  5JI6 A;  3S93 A;  1S9H A;  3MEJ A;  2PMZ A;  3F22 A;  4KA4 A;  1RI7 A;  3ZQG A;  2QUF A;  1H0M A;  3JXD L;  1IRZ A;  1B9N A;  2H1L A;  4OIP F;  2LYL A;  1V5E A;  2JWT A;  1IAW A;  2MA3 A;  3HKZ N;  2GA2 A;  1ZZ6 A;  1VND A;  2HQ5 A;  3F6V A;  1J75 A;  4A5N A;  4CCK A;  3GN5 A;  3CO6 C;  3OP9 A;  5AIP A;  3PSI A;  4UXN A;  5JUW A;  1MBJ A;  1T33 A;  3GTM J;  3K4B A;  4HF0 A;  4A3F J;  4XSX F;  3WTU C;  4A12 A;  1DGR M;  4FE4 A;  3AL0 C;  3H9J A;  1UB9 A;  2HFZ A;  2E2J J;  4ZTJ A;  1F36 A;  4DW6 A;  2PE5 A;  2DJN A;  2VAS A;  4L9N A;  3LSP A;  2O03 A;  1DUX C;  3PE5 A;  3GUD A;  1Z3Y A;  3E6D A;  4LLL A;  2RNG A;  2Y31 A;  2EQR A;  4WX9 A;  1YRN A;  3W3C A;  3BQY A;  2PEX A;  2KIF A;  2RAE A;  1IV8 A;  3EUH A;  4NBQ A;  3KEO A;  5CJ9 A;  1H9T A;  4BXU A;  1YS6 A;  2LFB A;  1DDN A;  1JTY A;  5J47 A;  1WJD A;  2R7R A;  2IV1 A;  1B0N A;  4E7H A;  1EA3 A;  1OCO H;  4JP0 A;  3S3M A;  3L2V A;  1ZRF A;  1DP7 P;  1YI2 I;  2IGM A;  1ZLK A;  3VOE A;  3LQQ A;  2L4M A;  3PO3 J;  3R1F A;  5K7H A;  2IGK A;  1N25 A;  2XJ3 A;  1UFM A;  3QU3 A;  3ZOB A;  5CQG A;  1EJ9 A;  2V1X A;  4F93 B;  3NQO A;  3CJN A;  5J1Y A;  1A35 A;  2LD5 A;  4Z58 A;  1QQB A;  3DQV C;  4XKC A;  2X6W A;  4AIK A;  4MCX A;  1X2L A;  5IT9 Z;  3OYI A;  1LNW A;  1RKT A;  2WAE A;  3DTK A;  5D4R A;  3RIR A;  1OIS A;  2LDU A;  1ADR A;  4RBO A;  2RV8 A;  2COM A;  2GAU A;  1JGS A;  3DKW A;  2QKM B;  4UV8 A;  1BBY A;  4S05 A;  3B7H A;  3WHB A;  3SXY A;  4HV6 A;  2VBY A;  3A02 A;  1LUJ B;  5FKN A;  2ZXW H;  4G94 A;  2HDD A;  4ANJ A;  4PU8 A;  3VDX A;  3FK6 A;  2CS3 A;  1N77 A;  2LR8 A;  2CUJ A;  1XGO A;  2PXB A;  4IHW A;  2O4A A;  3S1Q J;  3H3Z A;  5CLS A;  4UHT A;  1HC8 A;  2HVR A;  4XMY A;  2OBP A;  3H0D A;  1EH8 A;  2CGP A;  1X4O A;  3DPL C;  2A5W A;  3SEZ A;  1ETY A;  2DYS H;  5K5R A;  4KIB A;  4HG2 A;  5JFR A;  5K5Q A;  4V2F A;  1P4X A;  1OPC A;  5GTH C;  2EZI A;  3QWG A;  1IXC A;  2E2I J;  4EJV A;  5D5X B;  2P4W A;  4B43 A;  2KIM A;  4C3H J;  1UXC A;  4MFD A;  5FFZ A;  3IH2 A;  4KMF A;  2R4G A;  5CPR B;  2W85 A;  4XOP A;  1B4A A;  3ZQL A;  2PMH A;  3DF8 A;  3AAF A;  2KRF A;  5ERI A;  3DEE A;  2VIX A;  2XRN A;  4BBR J;  2Y9Z A;  1FNN A;  4YG7 B;  2PPX A;  3T5X A;  2XAG A;  5DRY A;  5BMZ A;  3ZQC A;  3K4N A;  3P7N A;  3BZK A;  2B5A A;  2Y30 A;  4U7B A;  2W00 A;  3H5A A;  3UFD A;  3LA3 A;  4F52 A;  4RAG A;  1Z7U A;  5FLV A;  2IS2 A;  2L9N A;  5LRS A;  3TL4 X;  3KP5 A;  3BZ6 A;  4MNU A;  1UST A;  2IVQ A;  3I59 B;  4GGG A;  3KYL A;  4NB5 A;  2AXL A;  3KP7 A;  3OYH A;  3JRB A;  3HOV J;  3N05 A;  2H94 A;  2ZSI B;  1T08 B;  2RC4 A;  2TCT A;  2VI6 A;  4F3Q A;  2CG4 A;  2XSD C;  1VQL I;  2BVL A;  1I6H J;  2O0Y A;  2JVL A;  2OA4 A;  2MH9 A;  1CQT A;  3G4S I;  4KN7 X;  1JT6 A;  4C3I J;  2CUZ A;  3SFI A;  2MD5 A;  2DT5 A;  4WXC A;  2F2E A;  3IWF A;  3FM5 A;  1R9T J;  1EFA A;  1YYV A;  3K4M A;  4HX7 A;  1SVL A;  4ZTF A;  2PXF A;  1XSD A;  5DCF A;  2BOL A;  2MD0 A;  1Y39 A;  2FNA A;  1FOK A;  5K7Z A;  3A03 A;  2HEO A;  3MZY A;  3V4G A;  1IN6 A;  1FOY A;  5EZG A;  2YUS A;  1G6N A;  1A04 A;  4B8X A;  1LVK A;  3IKT A;  2UXX A;  3RI4 A;  1P4A A;  5J3L A;  4PU4 C;  3BTJ A;  4FX0 A;  3FXM A;  2DYR H;  2V9P A;  2BHZ A;  2I5U A;  3QU6 A;  3ZP5 A;  1S5L C;  3ECH A;  3CCM I;  1RRJ A;  3SFZ A;  3U1D A;  4X6A J;  3JAM K;  4CA0 A;  3VWB A;  5DSX A;  2HDC A;  4CZC A;  4KIF A;  3MAJ A;  4YFX F;  3S1R J;  3SEQ A;  2VE9 A;  1Z1D A;  1YO5 C;  2JMW A;  1MH4 A;  5J8F A;  3ZMS A;  3K2A A;  3IRR A;  2DXI A;  1LQC A;  5J4V A;  3IAM 2;  1OYI A;  4ZZD A;  3OV8 A;  5JHU A;  4PJL A;  5CVJ A;  2QZ8 A;  1ZKG A;  2K9S A;  3CUQ C;  4BKX A;  4HF2 A;  3HGG A;  1T95 A;  1UAA A;  2VKD A;  1JKP C;  1YJW I;  3G5G A;  4AID A;  2BW3 B;  4RDU A;  1FPQ A;  1SEU A;  4XNF A;  2DMQ A;  2JVH A;  3K69 A;  5F0H A;  4YII A;  1S7E A;  3CMY A;  2R7T A;  4IRH A;  3JR9 A;  2JA5 J;  2QVO A;  2HZT A;  4XOR A;  2DFE A;  2EFQ A;  1RR8 C;  1Z3X A;  4L0Z B;  4BH9 A;  2FJ1 A;  2A6C A;  1JUM A;  2M4H A;  4LG0 B;  2R3S A;  1YQA A;  1TWA J;  2WV0 A;  1X19 A;  4XLH A;  2DOA A;  2LYR A;  4HZF A;  1RUN A;  2CH0 A;  2X0L A;  1PP7 U;  1P7I A;  3DBR B;  4FE7 A;  3RPU D;  1XGN A;  4FHT A;  4PFO A;  1LFP A;  3NZL A;  4LLG F;  2FBH A;  4E6K G;  3PJR A;  1OLT A;  2K9L A;  4H4K C;  2HQR A;  3JCU C;  3JXC L;  1O7L A;  4ER5 A;  2E60 A;  3WHC A;  2M8G X;  5J8C A;  2J7W A;  2QSH X;  5FRM A;  2YX4 A;  4EZI A;  1R23 A;  2BZT A;  2HPI A;  4TV7 A;  1MGT A;  2KZG A;  2E36 A;  3L2C A;  3A01 B;  1GLN A;  2Y9Y A;  3BD1 A;  2DCE A;  2QCO A;  4C2M J;  2OUM A;  2PXD A;  2K4J A;  1BIA A;  2FA5 A;  1PUF B;  3S1N J;  2JRM A;  1REP C;  1V5G A;  4ESJ A;  4N4O B;  2W24 A;  4RA2 A;  3BR2 A;  2GRM A;  3FBI B;  3GLL A;  5ILU A;  4K2E A;  2DK8 A;  1NK3 P;  3FWE A;  2CW8 A;  4YFK F;  2FML A;  3P9K A;  4NDW A;  2ELJ A;  1BR2 A;  4M6Y A;  2LK2 A;  4BXF A;  4BGD A;  3VOD A;  4LGW A;  2DT7 B;  4EJU A;  2GXB A;  3FXQ A;  4J00 A;  3VSL A;  2FFH A;  1DP3 A;  4EJO A;  2VOD A;  5IYC J;  2EFP A;  1ZHF A;  1TT0 A;  3K1P A;  3TRB A;  1JWL A;  4HQM A;  2LRE A;  5FB2 A;  2ME0 A;  5LBQ A;  3I56 I;  2CQX A;  4A3C J;  3V8K A;  3RZZ A;  2E1N A;  1FZP B;  2DQR A;  3U1K A;  3HOW J;  3S2D J;  3KP3 A;  2VPL A;  2O49 A;  2IS6 A;  3ZMD A;  2NRA C;  1QP4 A;  2FD5 A;  4ZDP A;  3OYJ A;  4ENM A;  3VYU B;  2QGU A;  1S8N A;  1DQU A;  3SDB A;  3DWL E;  3W2V A;  2WA0 A;  2VKH A;  1RZS A;  1JUP A;  2K3P A;  3KZ3 A;  3OYK A;  5HVQ C;  1PJR A;  4G6D A;  5D5U B;  4FT8 A;  2FUG 2;  2IU7 A;  1RET A;  1XDS A;  2KKO A;  1CF7 A;  1IGN A;  3KPH A;  2YR2 A;  2KEJ A;  2HS5 A;  4I2O A;  1IF1 A;  2HI3 A;  3OYF A;  4X1E A;  4XRS A;  3FX3 A;  3BG3 A;  5J1R A;  3X2Q H;  4E7Z A;  1TW3 A;  4XLP F;  2AXV A;  2G0E A;  4L9T A;  1T6S A;  3BWG A;  1PRU A;  1XSX A;  2YS9 A;  3CP8 A;  1MBH A;  3OOP A;  3J81 K;  1TNT A;  2IUO A;  2OU2 A;  3R0A A;  2KMU A;  3TEP A;  1R69 A;  1XN7 A;  4YG4 A;  1G4D A;  2Y69 H;  4PDK A;  2XC7 A;  3ELK A;  1LFU P;  1BC8 C;  4ZDO A;  1ONV A;  3NWS A;  3TOB A;  2CW7 A;  1BI2 A;  2Q2E A;  4XLC A;  1OYY A;  1MNE A;  4FN3 A;  1ETV A;  1ZPQ A;  3DV8 A;  2VL8 A;  5E8G A;  2KZ8 A;  2HYJ A;  3GFL A;  1HOM A;  4CGZ A;  2ISZ A;  3SDG A;  1ZYR F;  1ZZB A;  2ZBK A;  4JX5 A;  3N97 A;  1FC3 A;  3TO9 A;  2QKL B;  1DUL A;  1HQ1 A;  2MBF A;  3VYT B;  5BS6 A;  4DYC A;  3F8N A;  1K83 J;  3QP5 A;  2ZC2 A;  2HSG A;  4Q2J A;  2ODR D;  3BQZ A;  3ABU A;  1I1S A;  2KDO A;  1KYW A;  1XMX A;  2OC6 A;  2QQ9 A;  2JUG A;  3NWT A;  3FMY A;  2VUM J;  4FAS D;  1PP8 F;  3C2B A;  5DUI A;  1R1T A;  2OQG A;  3KCC A;  3QPS A;  5GAE J;  2DA6 A;  3KXA A;  2M7B A;  3K9T A;  3HRS A;  1Y0U A;  5HDG A;  4DZP A;  1LFB A;  2V9K A;  2YSR A;  4X4G A;  4NUB A;  2ZSH B;  1ON1 A;  2DMN A;  1QB2 A;  1YIJ I;  4MGR A;  1F5T A;  3PO2 J;  1R22 A;  2EFW A;  1R63 A;  1J0R A;  1UG2 A;  3S15 J;  1D0Z A;  2EA2 A;  1ETW A;  2WIU B;  1RPW A;  2PG4 A;  2JA2 A;  1QRY A;  4MCT A;  1MBG A;  3E6M A;  1ZAO A;  1BDH A;  3HSF A;  1T2K A; 
#chains in the Genus database with same CATH homology
 3M3Y J;  3JRA A;  2VKV A;  3G1L A;  3LSJ A;  1QVU A;  1QP0 A;  2GM4 A;  1H8A C;  3JRE A;  2PUD A;  3OQN A;  4W1U A;  3S17 J;  4D7N A;  1RKW A;  3FIW A;  1OCT C;  3Q0U A;  2E1O A;  3JRI A;  1WH7 A;  2DMT A;  2L49 A;  3PXP A;  3OIO A;  5A7L A;  2DA3 A;  2XCJ A;  2XIU A;  1FJL A;  2JK3 A;  2Y2Z A;  3W6V A;  4I6U A;  4DYQ A;  3B6C A;  3HEF A;  1Y7Y A;  2EF8 A;  2N8G A;  1WGX A;  2CUF A;  5F08 A;  3BTI A;  3HB9 A;  4X4I A;  1MSE C;  2NVT J;  3BTC A;  3S8Q A;  1XC5 A;  1Y1W J;  3QPL A;  1F43 A;  5IP6 A;  3BR5 A;  3M4O J;  4BXX J;  2MEZ A;  1MBF A;  2HOA A;  1WH5 A;  3MKL A;  1DWK A;  1LLI A;  3E7L A;  5C44 J;  3GBG A;  4NDL A;  3LFP A;  5DS9 A;  2X9D A;  1K61 A;  3SCH A;  1ETK A;  4I6T A;  4X4H A;  3F52 A;  2MW8 A;  3LSR A;  4J1W A;  1IDY A;  1AU7 A;  5DTD A;  5F27 A;  5JLW A;  4M3D A;  4GQM A;  4G12 A;  4A69 C;  3FYA A;  3L1P A;  1MBE A;  4A3J J;  3GTK J;  2PUB A;  1ETX A;  1X57 A;  1EF4 A;  1MNM C;  2LCV A;  2M2E A;  4CYC A;  3SCF A;  1WIZ A;  2H1K A;  5EGO B;  3BDN A;  1IJW C;  1D5Y A;  2AWI A;  4JYK A;  2LYQ A;  2PIJ A;  1RZR A;  1ZZC A;  5E3L A;  4Z5D A;  3JXD L;  1PRA A;  3ZQG A;  2NS7 A;  3F6W A;  3F0C A;  1IRZ A;  3KJX A;  1WET A;  2BNN A;  1ZR2 A;  2LYL A;  4S0H B;  2JWT A;  3HOY J;  2LP0 A;  2XPW A;  1JFS A;  2ID6 A;  3HKZ N;  3I4M J;  1ZZ6 A;  1VND A;  5EDN A;  2HQ5 A;  3GN5 A;  3OP9 A;  4X4C A;  3Q0V A;  1MBJ A;  3OSF A;  4L5E A;  1T33 A;  3GTM J;  2DMU A;  4GHJ A;  4BBS J;  1T56 A;  4A3F J;  1WH8 A;  2LKX A;  1GV5 A;  2P81 A;  5J1U A;  4FE4 A;  2KPJ A;  4OB4 A;  2E2J J;  3CQZ J;  3IH3 A;  1F36 A;  2EZK A;  2L0K A;  4DW6 A;  1VFC A;  4PU3 C;  2PE5 A;  3F51 A;  3H3V K;  3D1N I;  2DJN A;  1PUF A;  1RPE L;  2MSY A;  3BR0 A;  3LSP A;  5HOD A;  1GT0 C;  5EG0 B;  4X4D A;  2H8R A;  3B6A A;  1VI0 A;  2EQR A;  2Y31 A;  5FJ8 J;  1YRN A;  3HOZ J;  2R5Y B;  3BQY A;  4I6Z A;  4J1X A;  2RAE A;  1ITY A;  3RZD J;  4BY7 J;  5GP9 A;  3BTL A;  1IG7 A;  1MSF C;  3ZHI A;  2LFB A;  1BW5 A;  2DA4 A;  1JTY A;  3EUS A;  1RZR D;  2IV1 A;  2LYS A;  4XRM A;  1B0N A;  3QYX A;  4JP0 A;  1DW9 A;  3HZI B;  2COB A;  3TED A;  3LOC A;  2PUA A;  2BJC A;  3PO3 J;  3R1F A;  5K7H A;  1AKH B;  4M6V A;  2BNM A;  2XJ3 A;  3CDL A;  4C3J J;  3ZOB A;  1ORK A;  1TWG J;  5J1Y A;  2R5Z A;  1RES A;  9ANT A;  2LD5 A;  4Z58 A;  2KEI A;  1QQB A;  3GBF A;  2W48 A;  2NVQ J;  2FJR A;  2OPT A;  3FIS A;  1IDZ A;  1POG A;  1LCC A;  1OJL A;  4MCX A;  1X2L A;  4MIM A;  4UUS B;  4Y7N J;  2BNO A;  1FTZ A;  1UHS A;  1RKT A;  1WI3 A;  1ADR A;  4RBO A;  3LIS A;  2L7Z A;  2LY9 A;  1L1M A;  3I4N J;  2FQ4 A;  3B7H A;  3WHB A;  2MGQ A;  3A02 A;  3O8H A;  5FKN A;  1QPI A;  2HDD A;  3FKI J;  3DEW A;  4PU8 A;  2XRL A;  3FK6 A;  2LR8 A;  2AHQ A;  4IHW A;  2O4A A;  3S1Q J;  3H5T A;  2LYP A;  1TWH J;  2R0Q C;  1H88 C;  1ZUG A;  1ETY A;  2CQQ A;  4V2F A;  2CSF A;  1IV6 A;  3SCG A;  3BR1 A;  3QWG A;  2EZI A;  2CUE A;  1LE8 A;  5EYR A;  2E2I J;  3PM1 A;  1NER A;  3VK0 A;  2HXO A;  2O7O A;  4C3H J;  5F04 A;  1UXC A;  4MFD A;  4A3M J;  3IH2 A;  4M3F A;  1BA5 A;  3G1M A;  2DMP A;  4I76 A;  5M5W J;  3ZQL A;  2XPV A;  1NEQ A;  3CRO L;  1U9O A;  4BBR J;  2Y9Z A;  5M5Y J;  1B72 B;  4YG7 B;  2JJ7 A;  1JKQ C;  1U78 A;  4Z5H A;  2PPX A;  1Y9Q A;  4FIS A;  3ZQC A;  2K40 A;  5C3E J;  1POU A;  1ZVV A;  1BW6 A;  3TP0 A;  2O9L A;  3S1M J;  2B5A A;  2Y30 A;  5FLM J;  4JX6 A;  1GUU A;  3HBL A;  2XB0 X;  4W97 A;  2OR1 L;  3UFD A;  3GTL J;  5FLV A;  3SJM A;  1IUF A;  3GTO J;  4IHY A;  2DA5 A;  1ETO A;  3TP3 A;  4AUX A;  1ENH A;  2IVQ A;  3HOU J;  3S16 J;  4A3B J;  4LOC A;  2AW6 A;  3OQO A;  3IVP A;  3JRB A;  3HOV J;  2R63 A;  4XRS G;  2LTP A;  5FKL A;  2DTZ A;  3LSG A;  1PNR A;  1VF9 A;  1BJZ A;  1PER L;  2TCT A;  2VI6 A;  1FIA A;  1NTC A;  5C4X J;  1JGG A;  4FBI A;  2ICP A;  1UTX A;  1I50 J;  4DYR A;  2XSD C;  4YAR A;  2CRG A;  3BG5 A;  2XB5 A;  1I6H J;  2AUW A;  3LNQ A;  2CRO A;  2EWT A;  2JVL A;  4IEJ A;  1JT0 A;  1CQT A;  1JJ8 C;  1JT6 A;  2IBD A;  5JLX A;  1SQ8 A;  4C3I J;  3SFI A;  3CLC A;  1DU0 A;  4XIC A;  1ETQ A;  2L7F P;  1B8I A;  1R9T J;  1EFA A;  3QF3 A;  1QPZ A;  4Y52 J;  4M3G A;  1BL0 A;  2IEK A;  2XGC A;  3A01 A;  4IVZ A;  1SFO J;  2R93 J;  2E19 A;  3A03 A;  5K7Z A;  2EH3 A;  5FKM A;  2ICT A;  2MQK A;  5IOY A;  2PUC A;  5EZG A;  2YUS A;  2D5V A;  3RQI A;  3O9X A;  1H89 C;  3ZQH A;  1UXD A;  1GV2 A;  5J3L A;  3GTQ J;  4PU4 C;  1DU6 A;  3BTJ A;  2R1J L;  4IHX A;  2WV1 A;  3BT9 A;  2HXI A;  2JN6 A;  3DCF A;  2YU9 J;  3QQ6 A;  2TRT A;  4X6A J;  2LYJ A;  2XGD A;  4FCY A;  5F1J A;  1QP7 A;  3CCY A;  3ZQI A;  3S1R J;  1ZZ7 A;  1JFT A;  2JMW A;  1MH4 A;  5FKO A;  2PMZ N;  3K2A A;  1LQC A;  2K9N A;  3DNV B;  2IVB A;  1QVT A;  1XS9 A;  1BDI A;  1TC3 C;  2XGE A;  1JUS A;  2WB1 N;  3IH4 A;  4UUT A;  4JX4 A;  5IYD J;  3OMT A;  1ZKG A;  2K9S A;  3FK7 A;  4BKX A;  1HF0 A;  4IWR A;  3HGG A;  2OF7 A;  2DA1 A;  4A3L J;  2FX0 A;  5IPA A;  2NS8 A;  1JKP C;  1LMB 3;  3G5G A;  4RDU A;  4J19 A;  2EZL A;  2DMQ A;  3JXB C;  5F0H A;  1S7E A;  3CMY A;  3JR9 A;  2JA5 J;  3U3W A;  2EBI A;  4MFE A;  2ID3 A;  3MVP A;  4D7M A;  5K98 B;  3G7D A;  2AO9 A;  1JJ6 C;  2A6C A;  1G2H A;  4XK4 A;  2FJ1 A;  1HCR A;  1JUM A;  2K9Q A;  5EGO A;  4I8T A;  2WAQ N;  2PUE A;  1TWA J;  4XID A;  1ZR4 A;  1I3Q J;  2HOT A;  4CYC B;  4QSH A;  3G1O A;  2Y0S N;  2L7M P;  4QIW N;  5E3N A;  3UKG A;  2LYR A;  2ZB9 A;  1X58 A;  1P7I A;  4FE7 A;  1TWC J;  4MLO A;  1Y1V J;  5M3M J;  5E3O A;  2I10 A;  3OSG A;  4X4E A;  3JXC L;  2R92 J;  3WHC A;  2M8G X;  2HOS A;  3GN5 B;  1B8I B;  2KEK A;  4HNV A;  1O4X A;  1WCM J;  3HGY A;  4B3A A;  3A01 B;  4BY1 J;  3BD1 A;  2Y9Y A;  2AXU A;  2QCO A;  4C2M J;  5EG0 A;  1HDP A;  1PUF B;  3S1N J;  2OFY A;  1A5J A;  2R5Y A;  2KT0 A;  4Z59 A;  1UMQ A;  2GRM A;  3BR2 A;  5K7F A;  1W0U A;  3RKQ A;  3CEC A;  5F0F A;  3MN2 A;  2GZU A;  2XPU A;  5F0C A;  1NK3 P;  1YRN B;  2GBY A;  1OCP A;  2DN0 A;  2VKE A;  1U8B A;  1FEX A;  2LYK A;  2KDZ A;  1ZZ9 A;  2HIN A;  4NDW A;  4PU7 A;  2LK2 A;  2JA7 J;  3TW7 A;  1SAN A;  1MBK A;  2O38 A;  4O8B A;  4X4B A;  1TWF J;  2NOG A;  1FIP A;  3NAU A;  4X4F A;  2LLK A;  2CU7 A;  3ZQF A;  5IYC J;  3TRB A;  1JWL A;  4Z5C A;  4B1R A;  1U9N A;  1RIO A;  1AKH A;  2IAI A;  3JRF A;  2ME0 A;  5EF6 A;  1IC8 A;  1AHD P;  2CQX A;  3GTG J;  4D5C A;  4A3C J;  1QQA A;  2ME6 A;  3S2H J;  3RZZ A;  4YG1 A;  3HOW J;  3S2D J;  3VPR A;  1PRV A;  2PUF A;  2O49 A;  5IP9 J;  4JCY A;  1MH3 A;  2R5Z B;  1ZTR A;  1QP4 A;  2FD5 A;  1ZQ3 P;  3HM5 A;  4UUS A;  2AXZ A;  1XWR A;  1FTT A;  4QTR A;  2WUS R;  2ECB A;  1X2N A;  4V2G A;  1RZS A;  3MLF A;  4Y42 A;  1JUP A;  2GRL A;  3KZ3 A;  2M0C A;  4D5F A;  4IHV A;  3ZKC A;  1VPW A;  2IU7 A;  1RET A;  1IGN A;  4M3B A;  2KEJ A;  2HI3 A;  3BR6 A;  3JRG A;  4X1E A;  4XRS A;  2AXV A;  3BG3 A;  3Q0W A;  5J1R A;  2R7Z J;  1CJG A;  3OQM A;  1Z0X A;  1JTX A;  1HLV A;  2L8N A;  2G0E A;  3HOX J;  1X2M A;  3K7A J;  5M5X J;  2EBY A;  2M34 A;  2X6O A;  4AC0 A;  2LVS A;  2CJJ A;  1PRU A;  2X48 A;  4ABZ A;  4A3G J;  2MG4 A;  2YS9 A;  3JRC A;  1MBH A;  2DA2 A;  2NVY J;  4I6R A;  3BG9 A;  2IUO A;  3JRH A;  1HDD C;  1GVD A;  5IP7 J;  1XG1 A;  1LE8 B;  2GLO A;  4GFB A;  3S14 J;  2EZH A;  2L9R A;  1R69 A;  5M3F J;  4YG4 A;  3JRD A;  1WPK A;  3NAR A;  1LFU P;  2VPR A;  4A3D J;  3ZHM A;  1APL C;  2NVX J;  2JA6 J;  1Z77 A;  5C4J J;  5GPA A;  1W0T A;  2QF7 A;  1ZAY A;  4FN3 A;  3TW6 A;  1B72 A;  1ETV A;  2O8K A;  2XI8 A;  4M3E A;  4JCX A;  1ZPQ A;  3BS3 A;  5EZH A;  1ZK8 A;  2KZ8 A;  2HYJ A;  1HOM A;  2DA7 A;  3SDG A;  1JKO C;  1WH6 A;  1ZZB A;  1ZS4 A;  4JX5 A;  3GTJ J;  3O8G A;  2ELK A;  4A3I J;  2JA8 J;  1JKR C;  4DYC A;  4FTH A;  1K83 J;  1A6I A;  3H0G J;  2E2H J;  1LCD A;  2HSG A;  4JQD A;  1JH9 A;  3QQA A;  3BQZ A;  3HDD A;  3OOU A;  4A3E J;  2JCG A;  2IVG A;  1OFC X;  1ZZ8 A;  3FYM A;  3RZO J;  1OSL A;  3FMY A;  2VUM J;  3C2B A;  3GTP J;  3QPS A;  2ECC A;  2DA6 A;  3KXA A;  3Q3S A;  4IA8 A;  2B63 J;  4DZP A;  4A3K J;  1LFB A;  4F8D A;  5IYB J;  4X4G A;  2DMN A;  1RR7 A;  4DZJ A;  3IV5 A;  3PO2 J;  5BNG A;  1NK2 P;  1P7J A;  1R63 A;  1UG2 A;  3S15 J;  1ZGW A;  5FKK A;  5GPC A;  1ETW A;  2M9H A;  1RPW A;  2WIU B;  2PUG A;  3BR3 A;  1QRY A;  4AYB N;  4A93 J;  4MCT A;  1E3O C;  1Q1V A;  1MBG A;  1YSE A;  5EEA A;  1GDT A;  1BDH A;  5E3M A;  4MO7 A;  5IOZ A;  4B4C A;  4EEF G;  4YBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...