1E3OC

Crystal structure of oct-1 pou dimer bound to more
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
160
structure length
132
Chain Sequence
EEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMSKLKPLLEKWLNDAEKRTSIETNIRVALEKSFMENQKPTSEDITLIAEQLNMEKEVIRVWFSNRRQKEKRIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Differential Dimer Activities of the Transcription Factor Oct-1 by DNA-Induced Interface Swapping
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords 5'-D(*AP*TP*GP*CP*AP*TP*GP*AP*GP*GP*A)-3'
total genus 44
structure length 132
sequence length 160
ec nomenclature
pdb deposition date 2000-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00046 Homeodomain Homeodomain
C PF00157 Pou Pou domain - N-terminal to homeobox domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1e3oC02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1e3oC01
1JGGA 2DMTA 3TW6A 2MGQA 2CUEA 2R5YB 1A5JA 2XB0X 2XGEA 2XPWA 1XS9A 5IP7J 2H8RA 3OQMA 1MBGA 1D5YA 4AYBN 4CYCB 3OIOA 2D5VA 2HOSA 4MLOA 4J1XA 3NAUA 2XPUA 2CROA 3GTJJ 3JRGA 5HODA 2ICTA 3O9XA 1RIOA 2CQXA 2LP0A 1IGNA 4XICA 1SFOJ 3HOWJ 5J1UA 2GRLA 4X4HA 3JXDL 1DWKA 4YBAA 2YUSA 5DS9A 3TEDA 3MN2A 2IV1A 2B63J 1HF0A 1VNDA 3OOUA 1IV6A 2XIUA 5E3NA 3BTJA 3IH4A 2CRGA 1UTXA 4G12A 4DYCA 1K83J 1E3OC 2GBYA 4GHJA 2HYJA 2ICPA 5F0HA 1QQBA 2LYLA 1XG1A 2WV1A 1POUA 1WCMJ 3EUSA 1U9OA 2M34A 4J19A 1P7IA 5IP6A 4A3IJ 3IH2A 1BW6A 3JRBA 2YU9J 1MH3A 2AHQA 2MW8A 1EF4A 4D7NA 3HOUJ 1AKHB 3HGYA 4A3DJ 2FQ4A 4V2FA 1H88C 3GTGJ 2PPXA 4HNVA 3ZKCA 3IV5A 2DMQA 3BS3A 2ELKA 4AUXA 4BKXA 3CROL 2L7ZA 3FIWA 1IG7A 3TRBA 3S16J 4I76A 2HI3A 3BTLA 2E1OA 4BXXJ 2DJNA 2TCTA 1NTCA 1VI0A 1QRYA 4D5FA 3IH3A 3CMYA 4MFEA 2KEIA 3HKZN 2JA6J 5EGOB 1NK2P 1ZTRA 3LSRA 3E7LA 1HDPA 4QSHA 5FKMA 4A3JJ 5C44J 1WH6A 2AWIA 4PU7A 4M3BA 2PMZN 2NVQJ 4MIMA 1ETKA 3DEWA 4ABZA 3HEFA 3RQIA 4NDLA 2NS8A 3CQZJ 2XB5A 1JTXA 2QF7A 3JREA 1PUFB 1LFUP 1ZR4A 1FTTA 2IBDA 3HBLA 3GTOJ 4I6TA 3ZHIA 2N8GA 1B72B 5IPAA 4W1UA 2L0KA 1W0UA 2WUSR 3S1RJ 5K7HA 3JRFA 1YRNA 2XGCA 2R92J 4GQMA 1CJGA 1ZK8A 4X1EA 3OP9A 3OMTA 4MFDA 4F8DA 2IU7A 1ZUGA 2EQRA 1ZVVA 2M0CA 4FISA 1YRNB 3L1PA 3WHBA 2OR1L 3SCGA 4A3MJ 1TWHJ 4RBOA 4DZJA 2JA5J 4JCYA 2EH3A 2LVSA 1QP7A 4BY7J 1Z77A 2COBA 3SJMA 5EGOA 1JKPC 2A6CA 1ZS4A 4X6AJ 1TWAJ 2KPJA 2PUBA 3R1FA 1AU7A 2LR8A 2DMUA 1PNRA 1MNMC 2KT0A 1QVTA 1B0NA 1X2MA 3RZDJ 4PU4C 4I8TA 1WPKA 3RKQA 3BR0A 1RR7A 1AHDP 1JFSA 2JA7J 2VKEA 3BR6A 4UUSB 3BG9A 3G1LA 1I3QJ 2MQKA 1TWFJ 2M8GX 1ETQA 2CJJA 4JP0A 3ZOBA 4M3GA 1NK3P 2DA5A 5J1RA 3TW7A 1ETWA 4W97A 3DCFA 3PM1A 4FE7A 3B6CA 3I4NJ 3HOVJ 1ZKGA 5F1JA 1RPWA 3FISA 3GTPJ 5F04A 1PRUA 1JJ8C 4XRSG 5FJ8J 2PUDA 1QP0A 1POGA 2NS7A 1LE8A 2JN6A 2E2HJ 5A7LA 1OFCX 4JCXA 3U3WA 3OSGA 1LCCA 1ZZ8A 1UHSA 1PRVA 1JWLA 2ME6A 1Y1WJ 2GLOA 2HDDA 2ZB9A 2GZUA 4DYRA 2K9NA 1ZR2A 3HOZJ 2LYRA 1MBJA 2O7OA 5GPCA 1YSEA 5M3MJ 3QPLA 3O8HA 2IVBA 1T33A 2VPRA 4A3GJ 1CQTA 3MLFA 1IRZA 1RZRD 4A69C 3I4MJ 1JUSA 3A01B 2O9LA 2CU7A 2AW6A 3ZQHA 3S8QA 1L1MA 1A6IA 3LSPA 3OQOA 2QCOA 2HINA 2CSFA 4FBIA 3S17J 4IVZA 1U8BA 1OCTC 1ADRA 3WHCA 1MSFC 1VPWA 1H89C 1I50J 1OSLA 2FJ1A 1IUFA 1HLVA 1GV5A 3Q0VA 2K9SA 2R0QC 5M5YJ 5IYBJ 2PE5A 2PUCA 2Y9ZA 5K7FA 1R9TJ 4AC0A 4X4BA 4X4DA 3HZIB 2HOTA 3F52A 3JRIA 4BBRJ 2ID6A 1TWCJ 2ECCA 5IP9J 5GPAA 1JT0A 3Q3SA 2O8KA 2XCJA 2RAEA 2E2IJ 1PUFA 2HXIA 4A3CJ 1BJZA 3CCYA 1MBKA 2O49A 1LFBA 3ZQGA 2FD5A 4YG7B 3A02A 2DA3A 1P7JA 4C2MJ 2NOGA 2L9RA 4DZPA 1LE8B 3CLCA 1B72A 5FKOA 2ID3A 1ZZBA 2DMNA 1WI3A 2LTPA 4IHYA 3A01A 1R63A 3D1NI 1QPZA 3S15J 2BNOA 5F27A 3JRHA 3S1QJ 2IVQA 1TWGJ 2R5ZA 5M5XJ 4X4GA 1APLC 3BTIA 3HGGA 5J3LA 2LYJA 3HOYJ 4O8BA 1GV2A 4XRSA 3IVPA 2R5YA 3MVPA 3QPSA 2L7MP 3ZQIA 3JRAA 3BT9A 2VUMJ 3PO3J 2X48A 5K98B 3CECA 5EYRA 1Z0XA 1XC5A 3BG5A 4A3FJ 1LQCA 1FIPA 1ZPQA 3S1NJ 2K40A 1JUPA 3LOCA 4C3IJ 5J1YA 3CDLA 1WH5A 1MBEA 5FLMJ 2WIUB 2IAIA 2ECBA 2JMWA 1FTZA 2XJ3A 5EG0B 1PERL 1LLIA 3GN5B 3Q0UA 2HOAA 2K9QA 2BJCA 3GBGA 4X4FA 1GVDA 4PU3C 2X6OA 5C4XJ 1IC8A 1QVUA 2BNNA 3LNQA 1UG2A 2W48A 2NVYJ 5IOZA 2LD5A 1Y1VJ 3SDGA 2AXVA 3SFIA 3RZOJ 2EWTA 3JR9A 3QQ6A 4EEFG 2M2EA 2WAQN 3TP3A 4B3AA 2AXUA 3RZZA 2AUWA 4JYKA 2AXZA 4I6UA 1X2NA 2KDZA 3ZQCA 5FLVA 2KZ8A 3FMYA 4JX4A 3W6VA 3M4OJ 1ETYA 4X4IA 4M3FA 1BDHA 3FKIJ 4V2GA 2H1KA 2OPTA 3QYXA 3F51A 5M3FJ 1RKWA 4Y42A 1JFTA 2EBIA 1MBFA 3B7HA 4D7MA 3PXPA 4IA8A 4A3BJ 1BL0A 2B5AA 3B6AA 5FKKA 3LISA 3HM5A 3GBFA 4X4EA 3BR5A 3ZQLA 2OFYA 5EG0A 1HDDC 2E19A 2JJ7A 1ZZCA 2XGDA 5FKLA 5EEAA 4M3EA 1U9NA 3HB9A 4D5CA 1SANA 1Y9QA 1UMQA 1HOMA 2DA4A 1FIAA 2IVGA 2ME0A 3KJXA 3JRDA 1NERA 1ZZ7A 1OJLA 5C3EJ 2I10A 1ZZ9A 4FCYA 2M9HA 2LYSA 2LYQA 3A03A 3JRCA 1LMB3 3S14J 2FX0A 2TRTA 2Y30A 4CYCA 2XRLA 4Z58A 2R7ZJ 4Z5CA 2LCVA 1ETVA 3K2AA 1RPEL 1B8IB 2AO9A 3LSJA 3S2DJ 4MO7A 1TC3C 4FN3A 1RZRA 4QTRA 3C2BA 1QQAA 2NVXJ 2PUEA 4C3JJ 3HOXJ 1JT6A 2IEKA 4L5EA 5BNGA 3F6WA 4B1RA 5E3MA 4NDWA 3K7AJ 3ZQFA 4A93J 1DW9A 4QIWN 2JK3A 1ZAYA 3Q0WA 4M3DA 3KZ3A 1WGXA 5K7ZA 1W0TA 2XSDC 1MSEC 4DYQA 2CUFA 2JCGA 2EZHA 2Y9YA 3LFPA 4YG1A 1ORKA 4FE4A 5M5WJ 4X4CA 1GDTA 1ETXA 1XWRA 2DA1A 1NEQA 5EZGA 2MG4A 3BR1A 4I6ZA 4C3HJ 3G1MA 1U78A 1RETA 3ZHMA 2CQQA 1JKRC 1R69A 2DA7A 2HQ5A 2PUAA 2DA2A 1T56A 3UFDA 3HDDA 3FYAA 1X58A 2E2JJ 3DNVB 1UXDA 3QQAA 4I6RA 5JLXA 1X2LA 5EDNA 1IDYA 2BNMA 2XPVA 1FEXA 4BY1J 1H8AC 3H0GJ 2R63A 2EZLA 4A3EJ 3BD1A 3G5GA 3SCFA 1WETA 1DU6A 2DTZA 4IEJA 1WIZA 2YS9A 4IHWA 3BR2A 1JTYA 1ITYA 1B8IA 2O38A 1ZZ6A 1MBHA 5FKNA 4IWRA 4YG4A 2LK2A 1IDZA 3BQYA 3BQZA 4UUTA 2OF7A 4S0HB 2VKVA 1GT0C 1UXCA 1JJ6C 2JWTA 5E3OA 3JXCL 2L7FP 2PIJA 1OCPA 1F36A 5C4JJ 1VF9A 4Y52J 2JA8J 3TP0A 2DN0A 2DA6A 1I6HJ 2P81A 5JLWA 3S1MJ 2GRMA 3GTQJ 1K61A 3H3VK 5E3LA 1QPIA 1VFCA 2GM4A 3KXAA 2HXOA 3GTLJ 1X57A 3BG3A 1ZGWA 4IHVA 3GTKJ 3FK6A 3UKGA 2JVLA 1BDIA 1JKOC 4Z5DA 1LCDA 3VK0A 5IOYA 3F0CA 4LOCA 2NVTJ 2IUOA 1QP4A 3LSGA 5EZHA 1S7EA 2EZIA 4GFBA 4BBSJ 4M6VA 1F43A 1Y7YA 5F0CA 4A3LJ 2G0EA 4MCTA 3H5TA 5DTDA 1Q1VA 5EF6A 2FJRA 1ZQ3P 2PUFA 4JX5A 4UUSA 1JUMA 4XK4A 4YARA 3FK7A 2L8NA 3GN5A 2KEKA 4FTHA 4J1WA 3G1OA 1JH9A 4RDUA 2LYKA 2Y2ZA 3SCHA 1O4XA 4XIDA 1RZSA 3BDNA 2MSYA 3PO2J 5IYCJ 3OQNA 3O8GA 2R93J 3QF3A 4OB4A 4Z59A 2R5ZB 2EZKA 1G2HA 2LFBA 2DMPA 3JXBC 5F0FA 1BW5A 1FJLA 1SQ8A 5IYDJ 2EF8A 4Z5HA 3VPRA 2R1JL 2MEZA 5GP9A 2Y31A 2X9DA 2EBYA 1PRAA 1BA5A 1GUUA 1DU0A 3FYMA 4A3KJ 3MKLA 1ETOA 4Y7NJ 3G7DA 3QWGA 4JQDA 1WH7A 1AKHA 4XRMA 2LKXA 2VI6A 1JKQC 1HCRA 2LLKA 2WB1N 5F08A 3M3YJ 2LYPA 4DW6A 3OSFA 2LY9A 3BTCA 3NARA 3S2HJ 2KEJA 1EFAA 9ANTA 4PU8A 2XI8A 1MH4A 1IJWC 2PUGA 2HSGA 4JX6A 3BR3A 1WH8A 2L49A 4MCXA 1RKTA 4IHXA 3GTMJ 1ENHA 2Y0SN 4B4CA 2O4AA 1RESA
chains in the Genus database with same CATH superfamily
1LDJA 4EM1A 2VT3A 4IRHA 2XPWA 4G94A 4LB5A 1XS9A 3SZTA 2H8RA 3WTWC 1MBGA 2IVMA 2HOSA 2XPUA 5IT9K 4GDFA 4I99C 2CFOA 1LB2A 2E5ZA 2HGCA 4LFUA 4XLFA 3J7AO 2L4MA 1SFOJ 5LGNA 3BPXA 3I64A 3PUFA 5J1UA 3OYNA 3CCSI 3U2RA 1O3SA 1PDNC 4M9ZA 1DWKA 4YBAA 3SYTA 3DKXA 4IX7A 3MQ0A 1HF0A 1VNDA 1IV6A 3CO7C 1MD0A 4XN3A 2P6TA 2M4KA 4XBFA 3IH4A 2CRGA 3VYTB 1E3OC 2HYJA 3DU5A 1EH8A 5D6EA 2L9NA 2LYLA 1XG1A 1H9TA 1HSTA 2CW0F 2M34A 1ZRCA 1K4TA 2F5FA 3BZKA 3IH2A 5IT3A 1DP7P 2DQLA 2XSJC 1T98A 2AHQA 2MW8A 5ICEA 1UFMA 3R09A 4V2FA 1H88C 3GTGJ 3ZKCA 4HNVA 2LLWA 3R0AA 4L9VA 2QSFX 1MNEA 5D5XB 2IGNA 3SEZA 5KVRA 1IG7A 4XKCA 3S16J 1LVAA 4I76A 1LFPA 2JRTA 1VQPI 1SEUA 2TCTA 2LY1A 2QQAA 3CCEI 1KZHA 5H20A 1NH3A 2BW3B 2KEIA 1U2WA 4AVZA 3HKZN 3K70C 1NK2P 4KN7X 1ERDA 4OIPF 5FKMA 2ISZA 2B0LA 3CLOA 2FEZA 5C44J 4MIMA 4BHBA 4UV9A 3DEWA 4CCNA 1X1DA 1TW2A 2MYSA 3GCMA 4RS8A 1LFUP 4YEJA 1WFXA 3S32A 3T1BA 2IBDA 2L5QA 3HBLA 3GTOJ 1IO2A 3WU0A 3V7CA 3ZHIA 5L3CA 1R5GA 1P4WA 4CH7A 3HSEA 2L0KA 1IXCA 4CCLA 1B59A 3HHHA 3S1RJ 1RIOH 3KFWX 2PXVA 1T95A 1TQIA 2YX7A 3OMTA 3OP9A 3FMQA 4MFDA 3RSNA 4F8DA 4KA4A 5LHIA 2M0MA 4RAYA 4A0YA 3C3WA 4FISA 3MKYB 5K1YA 1YRNB 3F6OA 4M6YA 2LF7A 1HA8A 3L1PA 1LUJB 2O03A 1YO5C 3QU3A 4V19K 2JA5J 1I39A 2EINH 3QAHA 2Z5UA 1MMGA 3KLNA 4KITB 3SJMA 1W1WE 1JKPC 4N9IA 3VFZA 2Q1ZB 3F23A 1U8RA 2MC3A 4QLCU 1BI1A 1B0NA 4I8TA 3RKQA 3BR0A 3JTHA 1JFSA 3ELKA 3I71A 1BI0A 2VKEA 2QBYB 2ESNA 1I3QJ 1HQ1A 4JP0A 3ZOBA 3GEZA 3PSIA 2CO5A 5EEHA 5J1RA 3RYRA 4ON0A 3WTYC 4BE2A 3DCFA 2X51A 5DYMA 3B6CA 2V79A 5GADJ 3KYCB 3A9YA 1FBSA 2JZYA 2Z2SB 4P5OA 2XXAA 5KAIC 3FISA 2QEXI 3GTPJ 1FX7A 5F04A 3PQKA 4F91B 3CD6I 1SFEA 1FZPB 3VSLA 2OZ6A 3N97A 2HVQA 3OYAA 1TLHB 2HDDA 3BJAA 2DFIA 2BVLA 3DWLE 2K9NA 3LA3A 2VONA 4L5IA 3SX0A 1FYMA 2O7OA 4Y4RA 4RM2A 2HOEA 1Z1DA 4EKIA 4B43A 1T33A 4B47A 4N9HA 2NVUB 3G71I 4NQWB 4D0PA 3LSIA 1IRZA 2VT2A 4A5MA 3H9JA 3I4MJ 3A01B 2CU7A 2XAFA 3DPTA 3ZQHA 3S8PA 4UVBA 2A5WA 4DJAA 4FETA 1VPWA 1X1BA 2PXLA 1I50J 1KU2A 2DJIA 1GV5A 3GWZA 3OYLA 1MIJA 3K4CA 4EATA 2RGVA 2R0QC 2L1PA 3VYSB 1ON2A 1D8KA 3ROUA 2LNBA 1WJDA 3IP4B 2ZJQF 1E0EA 4M71A 1EV7A 3K4BA 4IXAA 5IP9J 3MKZA 2VLAA 5GPAA 2RAEA 3CO6C 3CLQA 2JA2A 1OKRA 4YELA 3E6CC 3CC2I 4A3CJ 1USSA 1TZLA 1LFBA 1TNSA 5J8CA 1P7JA 2R7DA 1MKMA 4IPAA 2V4JC 3M8EA 1B72A 4M9SA 5FKOA 1SD6A 1WI3A 2KMUA 2LTPA 4JBAA 4OWRB 3PL8A 1QPZA 3VWSA 4LIUA 3C2GA 1P92A 2VKHA 3MZHA 3S1QJ 4O5VA 2IVQA 3TO9A 3MD2A 4IHTA 1X1PA 1I1GA 2Q8KA 5JI6A 2EIJH 2QQ8A 5M5XJ 4X4GA 4H4KC 1W4MA 1APLC 1O7LA 4RGUA 2OQGA 2Q2EB 2R7TA 2IS1A 4CZCA 1DP3A 1GV2A 2DPDA 3E0JB 3JAMZ 4XRSA 3AG2H 2R5YA 3MVPA 2GAUA 3QPSA 3H9GA 1HKQA 1YOVB 2O3FA 2O61A 2MC4A 1UJ8A 2KIQA 5LD2C 3KP5A 1KU7A 4N0BA 4HNUA 1R6RA 1YQAA 2H6CA 2K86A 1K4SA 3RI4A 4UVAA 3BG5A 2H1LA 3LOCA 4G7ZF 1O3TA 2ECBA 1S29A 2XJ3A 5EG0B 1PERL 3TQNA 1I6XA 1XSVA 4ZH4F 2XAJA 4BEHB 2NRAC 2BJCA 4XLEA 1MMSA 2M5WA 4OIOF 3DPUA 2NS0A 2PFBA 2XF5A 2ZSHB 5H6QA 1QVUA 3VYUB 2DFEA 3HJEA 3A9XA 1QHHD 3M1CA 4IHSA 2AXVA 3RZOJ 5FD6A 3EDPA 2V3CC 2ZMEB 2AUWA 4L18B 4I6UA 2L02A 1XCBA 5KK1A 2UXXA 1A35A 5FLVA 1IXRC 4EJVA 4JX4A 3EETA 1ETYA 5GTIC 2Z99A 4M3FA 3S93A 2O0YA 3ABMH 1YYVA 3GZNB 2H1KA 2BVMA 2M1BA 2ZJRF 2PMUA 1RKWA 5M3FJ 5CLSA 3DTKA 2ESHA 3OYGA 1BL0A 1BI3A 2LH9A 3MKWB 2G9WA 3GBFA 4X4EA 4ITVA 4OU0A 1D1BA 4YIIA 5EG0A 1BR2A 1OR7A 3CCRI 2KRFA 5BQTA 1ZZCA 5FKLA 4M3EA 1SVOA 4HX8A 3K9TA 2PXPA 1HOMA 1Y0NA 3RYPA 1QU3A 4EK9A 3MMYB 1W5CC 2ME0A 2IVGA 3QP6A 3OYCA 1ZZ7A 3BZ6A 4HLYA 4FCYA 3QOPA 3I3LA 2Z16A 1WJ5A 4OAZA 3HG9A 2XRLA 4A2UA 4BJ5C 4Z58A 1QQIA 2L3DA 3PIPF 3K69A 4CSWA 3L2RA 4G6TB 4MO7A 4FN3A 2WB1A 3JCUC 5JVTA 2V1NA 2PUEA 3HUGA 5D4SA 1QZZA 5CVIA 2QKMB 2ETHA 3F6WA 5GAHJ 3DFGA 2G7UA 4HZFA 3K7AJ 4NBQA 4A93J 4NDWA 3EYIA 1TNTA 4YFXF 5CQGA 1J59A 1YE9A 5HLHA 5DUKA 2W24A 5K7ZA 2I8DA 2KZVA 3K6GA 2C6YA 2GWRA 3FF5A 4YG1A 4ENJA 3FXOA 4R8HA 3UR3C 3NDBB 1FSEA 3T8TA 1RC9A 2DA1A 1ZAOA 3ONQA 1B9MA 2L54A 4ZYEA 2CUZA 5K5QA 1N77A 1HW1A 2XHKA 4C3HJ 1K79A 5KCMA 2ZXIA 3ZHMA 2CQQA 3OL4A 2HQ5A 3HHGA 2VODA 3UWPA 1T56A 3E5QA 2BY2A 1HKTA 5J4VA 3WTTC 2E71A 2P5KA 1SC7A 2M7AA 4P55A 5JLXA 1VQLI 5LRSA 3HIFA 3RCOA 2ELJA 3U1KA 2FA5A 2HQAA 2XGXA 4BY1J 4ENMA 5TISC 3H0GJ 3TKYA 4A3EJ 2FQ3A 3DKWA 2DYRH 4IEJA 1WIZA 4IHWA 4Q2JA 1S3JA 3KYDB 5FKNA 3DBLB 3PIOF 4HOBA 4NC8A 3BQYA 1UXCA 3OS0A 4ZJZA 1MJBA 2L7FP 1OCPA 3BDDA 2X6YA 4Y52J 3CDHA 1L3LA 1S7AA 5B5EC 2CV1A 4ER0A 2GXGA 2DA6A 1I6HJ 4HX7A 3FWEA 5JLWA 3S1MJ 3QPTA 3R60A 4RAFA 1SVMA 5DCFA 2XAHA 3TO7A 4BQQA 2QENA 2DQRA 1XN7A 2JPCA 2DI3A 1K78B 3LMMA 1VFCA 1YJWI 1P6RA 2GM4A 2OTJI 2F4IA 3KXAA 1X57A 4ZZLA 3GTKJ 4HAMA 2JVLA 3UKGA 1BDIA 2RKHA 1JKOC 2E35A 2KDOA 1KGSA 3F0CA 4XOTA 2IUOA 2V7FA 3DXJF 1Z21A 3NEUA 2PXBA 1XX5A 4GFBA 2F4MB 2Z3YA 4CCKA 1WQ2A 1F43A 1Y7YA 3FBIB 3I56I 1JXSA 2G0EA 4MCTA 2LKPA 1VQNI 1HQCA 4P1WA 2XKOA 1D1CA 2QLZA 2QBYA 1R1TA 3IAM2 2W25A 4FASD 3L2CA 3FK7A 3W2WA 1Z7LA 3GN5A 4FTHA 3SZPA 2L9SA 3PSFA 2ZNZA 2CWEA 3G1OA 3QP5A 2VJIA 4WF2A 4XMYA 5CJ9A 3V8LA 1R4MB 3F8CA 3SCHA 3ISPA 2Y75A 3S2WA 1V55H 1W7PB 3WG9A 2AS5F 3HUGB 2H09A 1DPUA 1N75A 4MQVA 1AOYA 5ILUA 2R93J 4A0XA 3FXKA 5GAGi 1W7PA 2DMPA 3ZGKA 3VPRA 1S7OA 2DLLA 1X1AA 4FX0A 2WC2A 3P9CA 2X9DA 4PZJA 2PMZA 1YTYA 1PRAA 1GUUA 2VQGA 2JQ7A 4PJMA 2H8WA 4A3KJ 1R49A 3CCLI 3FKJA 3R4KA 4JQDA 1AKHA 2LKXA 3VEPA 5DTMA 3DTIA 3J80K 2E1NA 1YX3A 2WB1N 1JHHA 5F08A 3WODF 3OMYA 1VQ7I 2LYPA 1UG0A 1BR4A 2P5LC 4BH9A 2CW8A 2A07F 5TGTA 9ANTA 3CMEI 4EJTA 2XI8A 2O5RA 2EIMH 2L49A 4MCXA 3GTMJ 2KQRA 3K1MA 1ENHA 3Q9VA 1RESA 2J7UA 3LAJA 4LK0F 4WXDA 2CUEA 1A5JA 2XB0X 4OIRF 5IP7J 5DCMA 1ZRDA 3H3ZA 1R1VA 4N4OB 1D5YA 3OIOA 4E70A 4J1XA 4MLOA 1OCZH 2HKXA 2HQNA 1BR1A 3LSTA 3NXHA 3QOXA 2K9LA 3JRGA 2BGCA 2NOJB 1BN5A 3ZQQA 2LP0A 3JAMK 3O9XA 4XICA 3BCAA 4DGWB 2GRLA 4CA0A 2ZXHA 2L2OA 4XORA 5DS9A 1YITI 3V42A 4CO8A 3MN2A 4ZTFA 2XIUA 4CCOA 2WADA 1VQMI 5E3NA 3P9IA 3KCCA 2XV4S 3GFLA 1XMXA 4ZC3A 1TQMA 2M3AA 1SAXA 1Z67A 3Q5FA 4JK1X 4AM3A 2BE5F 1K83J 4KN4X 3C18A 3WTZA 3PFYA 1QQBA 1VTNC 2WV1A 2ZXWH 1N78A 1WCMJ 1POUA 3EUSA 4J19A 2EWNA 5IP6A 3LWFA 2ZMEC 2OZUA 4A3IJ 2CYYA 1K78A 1BW6A 3M9AA 4D7NA 2FQ4A 2COMA 3ZCOA 2PPXA 2P6SA 1ZRFA 1Y6IA 2DMQA 3KP6A 4XNFA 1NHAA 3FIWA 4E4HA 2HI3A 2BY0A 3BTLA 2E1OA 2IRFG 2DJNA 4E7KA 3TOAA 3BPVA 2QSGX 4AVPA 3IH3A 4MFEA 4OBMA 3MEXA 4RGSA 2JA6J 1HDPA 2QYOA 4RGXA 2OQRA 4JQFA 3CC7I 2WAEA 4M3BA 4XR6A 2PEXA 3T5XA 4ABZA 3OWTA 4KNYA 3CP2A 4NDLA 3CQZJ 4HA8A 5L3BA 2XB5A 2RVCA 4EQQA 3QYBA 3OYBA 1T39A 1WZ2A 2HCSA 4G6QA 1XCVA 1N25A 5D5UB 1YW9A 2BV6A 2E5NA 1PUFB 1KQ8A 1ZR4A 1FTTA 3L7WA 2EK5A 4EMSA 5LHGA 4BACA 4PJ0C 4YG2F 1FSHA 2D45A 3EUAA 2N8GA 3GFIA 5FFZA 5IPAA 1W0UA 5AIPA 2O6GE 1NG7A 1YRNA 2L01A 2R92J 4GQMA 1CJGA 3OYMA 4DOZA 2XASA 2IU7A 2E1MC 2K4BA 1ZUGA 4F3QA 5DUIA 2M0CA 3HXLA 3COAC 4A3MJ 1TWHJ 1I3AA 3R6SA 4C2UA 4DZJA 4QPOA 2JUCA 1E3PA 2EH3A 3I9V2 2LVSA 5DD8A 4C30A 3T8RA 3GZ6A 1VQOI 4BDZA 3E6DA 1DULA 5EGOA 2PUBA 3R1FA 3TGNA 1AU7A 1E3HA 2JVGA 1MNMC 1FNNA 1X2MA 1RR7A 1FMWA 1AHDP 1FWZA 1M1EB 2X1CA 2MQKA 3BG9A 3G1LA 3AG4H 1IUYA 3KX2A 1NW3A 4XLHA 2EA2A 2VQHA 1MJ9A 2BW3A 4HF2A 2EIKH 2MD0A 1I1SA 3I59A 4ETSA 5FGMA 2KZGA 4XL9A 3A2KA 1ZKGA 1RPWA 2YX4A 3FM5A 1MMAA 3HPHA 2XC7A 4IL6C 1OR7C 1QP0A 1POGA 4XKVA 1H0MA 2NS7A 1LE8A 2AQFA 2HYGD 3U3WA 1HKSA 1BOBA 1MMNA 2ME6A 2HPIA 2V26A 4I7HA 4F92B 1Y39A 2GZUA 4DYRA 4XM3A 2PQ8A 1YJNI 3QODA 2H94A 1ZYRF 1B1BA 2LYRA 3D0SA 4EJUA 1QZYA 2CG4A 3O8HA 4I2OA 1FOYA 3GFJA 5H6RA 2IGOA 1CQTA 3KZIC 5HLTA 2STWA 5CVUA 1QO0D 3P9KA 4PK4A 4A69C 4IQ4A 4LITA 2O9LA 4BJ6C 5LLQA 1U5TB 4EVIA 1A6IA 3R61A 3LSPA 4LGWA 2BHZA 1SFUA 5CVJA 2HQRA 2DOEA 2QCOA 3KPHA 4FBIA 3OQOA 2P5VA 1LKXA 3J7ZI 4KJZA 2FSWA 1H89C 4DNCA 3CMAI 4XOPA 1PJRA 2FJ1A 1IUFA 4AIHA 2Z1DA 1KYZA 1W5SA 5DCMB 3KP3A 1QNTA 2DK5A 4G9YA 3C7JA 5E8IA 1W36C 5M5YJ 1AWCA 2IXSA 5IYBJ 1SFKA 4CICA 4RB1A 2Y9ZA 5K5RA 3QYEA 4E7ZA 4AC0A 1G3SA 1ONVA 5DDGA 3RPQA 3JRIA 4C2TA 1OYWA 4BBRJ 1R4NB 2HTJA 1TWCJ 5CVRA 1JT0A 4O6JA 1HXDA 1PUFA 2ODRD 4I02A 5E1XA 2PBIA 2O49A 3ZQGA 3OV8A 2DU9A 4YG7B 3A02A 2DA3A 2IGKA 1G3WA 2NOGA 1QGPA 2DMNA 3ZQ7A 4IHYA 4KT5C 1XGSA 2EILH 4BEHA 1IAWA 1R63A 2OU2A 3R0JA 2IA0A 3JRHA 3GX4X 4CUGA 5JHUA 4I09A 3IRQA 2EV6A 3HSFA 2PXDA 4DE8A 1QHGA 1JI8A 2UV1A 3HKZA 4D9JA 1BC8C 4X0GA 1F9NA 3HGGA 5J3LA 2R7FA 4DBQA 4ER6A 2F2EA 3C2HA 4M73A 3B73A 2CMPA 3KEOA 4WCGA 3O2PE 2DFHA 4I0AA 3ZQIA 3BT9A 2VUMJ 1U2ZA 4HDUA 3I4PA 2W82A 1IN8A 3CECA 4LB6B 3TEPA 2IW5A 1Z0XA 3DLAA 3ML6A 1LQCA 1SFXA 2VL8A 4ER3A 2K40A 1JUPA 3I5UA 3OR1C 4Z2YA 4EGYA 2HWVA 5JHFA 4HSTA 2EFNA 4BJTA 5FLMJ 2WIUB 2IAIA 4OOIA 3L2QA 1FTZA 3M8JA 4XSZF 3GN5B 4ZYGA 4S05A 1GVJA 2FOWA 2K9QA 3BJOA 3MEJA 4M72A 4B44A 4BE1A 1GVDA 3CJNA 2X6OA 3LA7A 3M7GA 3OYIA 2A6HF 3OS1A 2W48A 3FMSA 4BXFA 3CCVI 1VZ0A 5BPIA 2V6EA 3GLXA 2LD5A 1Y1VJ 3SDGA 4EEFG 2M2EA 1YIOA 3TP3A 2AXUA 1J09A 3GXOA 3K4MA 2YPRA 3G2BA 1E2XA 2KDZA 1JGSA 2DDAA 3OWQA 1BDHA 2KLOA 3DLLF 2B9SA 1UHWA 4V2GA 1X4OA 1D3YA 4NQWA 4DE9A 2OPTA 3QYXA 4Y13A 4D7MA 4IA8A 4HLXA 3E97A 3HM5A 1R5ID 3BR5A 3QWLA 4WK8F 4A5NA 1HDDC 2JJ7A 3A0HC 4J01A 3D5RC 4L9TA 2BYVE 3HB9A 1Y9QA 2DA4A 4I01A 4CZZA 2YSRA 1A6QA 1NERA 4P9UA 3J81K 2FU4A 2I10A 1OISA 5C3EJ 5BOXA 1ZZ9A 2NNNA 2LYSA 3WGIA 3I58A 2LYQA 4G8XA 3JRCA 3S14J 2TRTA 2Y30A 4BHPA 4BDYA 3G3ZA 2LCVA 1VQ9I 1G6NA 3GZCA 5GAGJ 3ZMDA 3ZXSA 2B7EA 1SMTA 3FHNA 3WGGA 2D1HA 3AKZA 2NVXJ 4C3JJ 1JT6A 1OCRH 2XAGA 4XONA 5E3MA 1RZ4A 4HNTA 2OUMA 4BAYA 2JQEA 3KZ3A 3MZYA 2PI0A 3H5NA 1WGXA 4LD5A 5LEKA 2HDCA 3ZN0A 4BE0A 1W0TA 2MFZA 1T38A 5HVQC 3L9FA 1MSEC 2CUFA 5A2QK 2JCGA 2EZHA 4AU7A 2Y9YA 1U5TA 4FE4A 3LA2A 4KICA 4X4CA 3BZCA 1ETXA 1V54H 2LYCA 2PJRB 1R7JA 4FQGA 3ME5A 2EV0A 2MG4A 2V1DA 3BR1A 3KEQA 3TO6A 4BYYA 3VODA 1U78A 2LC2A 1R69A 3BLYA 1JKRC 1F4KA 1JHFA 3ECHA 2A5YB 2K5CA 4AD9A 2OJED 3S3OA 3AAFA 4L9NA 3DNVB 1UXDA 3DQVC 1YFHA 2DTRA 5EDNA 3VSKA 4GRIA 2PLYA 2BNMA 2PMHA 1RRJA 1ULYA 4O3MA 2I5UA 3F3XA 1WJEA 2EZLA 3SCFA 2TDXA 2DTZA 2XXQA 3BR2A 2LG4A 2LF8A 2O38A 1Y56A 2K02A 4LG3A 3F9KA 2HEOA 1S6LA 2HU9A 2P4WA 2MD5A 2VC0A 1GT0C 4KDPA 2JWTA 4IKFA 2L4AA 1VF9A 2JSCA 1OPCA 4LG0A 1SD4A 1G59A 4AYBA 4M74A 2IA2A 4EM0B 3HRSA 4P96A 2WV0A 4RB3C 3H3VK 5E3LA 4LG0B 1QPIA 2KISA 1MDMB 1D1AA 3GTLJ 4G7HF 2VJ5A 1YIJI 2EPFA 1YJ9I 2XUBA 2ZJ2A 1S72I 1LCDA 3CF2A 5IOYA 4LOCA 1WSUA 1QP4A 4ZYHA 2K27A 1FYLA 1S7EA 2VBYA 1GHCA 4NHJA 4M6VA 5FD5A 1PP8F 1EH6A 3ZN1A 1ZH5A 2BHYA 2E1CA 1VQ5I 4DBRA 2ZFUA 5FFXA 2FJRA 5EF6A 3AG1H 4WXHA 1ZQ3P 2IS4A 4JX5A 2HVRA 3H1CA 4A6EA 1JUMA 2VJJA 4HW0A 2L8NA 4MTEA 2X6XA 2DT7B 4N4NB 4UB8C 4MGRA 3BCBA 1EJ9A 1JH9A 2LYKA 4S04A 2HDWA 3PNVA 3E6MA 5FO5A 3ERED 1P4AA 1RZSA 3BDNA 2LOOA 1UB9A 2QM3A 4L0YB 3M9LA 2ZC2A 4Z59A 2FRHA 2IS2A 3QFIA 2MH2A 1ZGJA 2R5ZB 1G2HA 2LFBA 5JUWA 3JXBC 1O3QA 2HFHA 5D5VB 2R7VA 1FJLA 1I27A 3HOTA 2MEZA 5JR3A 3I55I 2ZNYA 5J6XA 1BA5A 1XD7A 3K4JA 2J5OA 1BJAA 3AL0B 3G7DA 4LJZF 3L2VA 1WH7A 3CCQI 2VI6A 1JKQC 2CSOA 4OMZA 2PXKA 3QYFA 3CCMI 3OSFA 3S2HJ 2ZXJA 1DGRM 3OYDA 5ICFA 4AIJA 1XTAA 2KJCA 4R1HA 2KEJA 3S3NA 1IJWC 2PUGA 2YR2A 2HSGA 3BR3A 3FZVA 4XSXF 3W2VA 1WH8A 2O4AA 2VOOA 3T0YA 2PUDA 3I54A 2Y0SN 4PU3C 3Q9SA 1JGGA 2DMTA 2D1VA 5DEQA 2JUGA 2R5YB 1A36A 2OA4A 2XGEA 3ESWB 1R36A 2EB7A 3GTJJ 3PE5A 5HODA 2ICTA 2HVSA 1Z05A 1IGNA 4X4HA 2DOFA 3JXDL 3VYRB 2VOPA 2GXBA 4QPQA 4L0ZB 1OMIA 2YUSA 3JSOA 2CGPA 5F1RA 3GZ5A 2VBWA 4G6DA 4F93B 2W1OA 3BTJA 5JFRA 2A05A 1UTXA 3K70D 1BOAA 3HZJA 4G12A 4II2A 2GBYA 2RNGA 1FOXA 1B4AA 5F0HA 3ZMSA 5ILVA 1U9OA 4IF4A 2JRMA 3GMEA 2R7RA 1FMVA 1CF7A 2DT6A 2FNPA 2OTLI 3GZDC 3HOUJ 1AKHB 3HGYA 4A3DJ 2YBDA 5DTRA 3BS3A 2ELKA 2R4GA 3B02A 2DDBA 3EUHA 4AUXA 2L7ZA 4KMFA 3TRBA 2IGMA 4BXXJ 1NTCA 4KFCA 5EJCA 4D5FA 3WGHA 4KISA 1T6SA 2VXZA 5EGOB 4A6DA 1ZTRA 1KA8A 3E7LA 3LSRA 1ZREA 1WH6A 2VE8A 4HBLA 2DPUA 3CP8A 2V1UA 1E17A 2NVQJ 1A31A 4PU7A 2GOMA 1ETKA 2M8EA 3HEFA 3OKZA 3LSHA 3G73A 3RKWA 3RQIA 4E7LA 2NS8A 4PUSA 5FB2A 5HNFA 3RPUD 1JTXA 1WWXA 2V9VA 1I5ZA 2KIFA 2ZCWA 3NZLA 3RIRA 3ZMVA 3NROA 2QQBA 1B72B 2MABA 4Y3OA 4C9YA 5K7HA 1ODDA 3JRFA 2XGCA 4ER5A 1KQ9A 3AL0C 1TT5B 2CQ7A 4XQFA 1RUOA 2GZWA 1OCCH 1P4XA 1ZHFA 5HS7A 3ECOA 1ZVVA 4RAZA 2OD5A 3U21A 2MLKA 4JOMA 2P7CB 1USTA 4RLQA 2OR1L 3SCGA 2K3FA 4RBOA 4HV5A 3EQLF 3UNGC 3OS2A 3WU2C 4B09A 4BY7J 1Z77A 3ZRGA 2COBA 4ZYAA 2E1MB 2FXAA 2P8TA 3QRFF 1ZS4A 4X6AJ 1TWAJ 4F7ZA 1XDUA 1QVTA 2DOAA 3AG3H 3RZDJ 2CV2A 1FOWA 2MA3A 1J5YA 3BY6A 1GXPA 4KIGA 2JA7J 3BR6A 1IF1A 1T0FA 1UHMA 4I0BA 1OCOH 4KMUX 5A2QZ 2M8GX 1ETQA 4UUSB 4J00A 2X1DA 5J40A 2DA5A 3VWBA 5LEJA 5CKTA 1ETWA 1VQ6I 4W97A 4FE7A 3I4NJ 1YHQI 3F8NA 1Z6TA 2WAQA 4YIRX 3HRTA 5F1JA 1ACIA 1PVEA 3HTSB 1OLTA 1R22A 1V5FA 1R1UA 3KIOA 2PN6A 4XRSG 5FJ8J 1D8JA 1FC3A 3IKVA 2E2HJ 5A7LA 1OFCX 2VXDA 3OSGA 2JTVA 1JE8A 1ZZ8A 1PRVA 1JWLA 2GIZA 4RB0A 1Y1WJ 2ZB9A 1LEBA 2F5EA 4EZIA 4HF1A 1ZR2A 3HOZJ 3RJPA 2X4HA 3K1PA 2KKOA 3ZP5A 5GPCA 2LMDA 5M3MJ 2VJ4A 2IVBA 4A3GJ 3ASOH 3D5SC 5E79C 5D8KB 1LDDA 1RZRD 1JUSA 4PJNA 4IJAA 2AW6A 3S8QA 3EYYA 1L1MA 2HINA 2OCEA 1LVKA 4RM3A 4AIDA 3S17J 1U8BA 3H5RA 1OCTC 1ADRA 3CTAA 1MSFC 2EA4A 3GYHX 3FXJA 4FT8A 3RDIA 1OSLA 1WI9A 3C1DA 2RN7A 2CQNA 2K9SA 3PFIA 3WTVC 1PYVA 2PUCA 1ZELA 3O3KA 4WX9A 3CMMA 2V6CA 5K7FA 4X4BA 2H6BA 4X4DA 2HOTA 3IWZA 1X19A 3F52A 3QU6A 2QZ8A 3SDBA 3Q3SA 1V5EA 3OY9A 1SD7A 1ZLJA 2OC6A 2HXIA 1BJZA 1MBKA 3IUOA 3GZDA 1ZG3A 2FD5A 1P2FA 4DZPA 1ZZBA 2ID3A 3FXRA 1T8IA 3BC8A 5LBQA 3D1NI 2PXUA 1YLFA 4GYIA 3S15J 2BNOA 5F27A 2BEOA 2CH0A 2P7VB 1W5TA 1WHUA 2J5PA 3HYIA 4GGGA 2FMLA 4MQ9F 2R5ZA 2A6EF 1MNDA 2Y0MA 4Q5SF 2KIMA 3J7YJ 1WRJA 3BTIA 4HX4A 5F64A 3ULQB 4O8BA 1AA7A 3TBIA 1WJBA 2PG4A 1YS6A 2NNYA 5E20A 1IZ1A 2L7MP 4FHTA 1EA3A 4PGGA 3JRAA 1J9IA 3REOA 5DRTA 1KQ0A 1K6OA 5EYRA 1XC5A 1ZPQA 1FIPA 2GA1A 1P9QC 3DP7A 3S1NJ 5J1YA 3HPGA 3BOQA 3JSPA 1WH5A 1MBEA 3H35A 1G8XA 5TJJA 5E1ZB 1G3TA 3DM5A 4WVLA 1LLIA 5GAHi 3BJ6A 3Q0UA 4HV6A 4HQEA 3P5JA 1QPMA 5FROA 1SAUA 3SQNA 3V8JA 5C4XJ 4G7OF 2BNNA 3LNQA 1ZGAA 2ISYA 2QQ9A 3V7RA 5IOZA 2EWTA 5E17F 2FMYA 4QWQA 3QQ6A 4ZDPA 1NG6A 3O6BB 4B3AA 3DBRB 4JYKA 1IRGA 2AXZA 3ZQCA 4B48A 1MGTA 2KZ8A 3BG6A 3W6VA 3M4OJ 4X4IA 4P9FA 3CF5F 2F4OB 3FKIJ 3GO5A 3F8BA 4CYDA 3F51A 3GUDA 3KP4A 4Y42A 3B7HA 1MBFA 3CJRB 4NC7A 1A04A 4A3BJ 1QZXA 5FKKA 5HLIA 4RB2C 3J80Z 3TDZC 3OYKA 5DRYA 2XF6A 1U5TC 3ZQLA 2D2WA 1LJ9A 2E19A 5CVVA 2XGDA 4CCJA 1FP2A 1DPRA 2OBPA 2UXNA 1J0RA 2STTA 4XKWA 4U7BA 3KJXA 2L9VA 2VN2A 3JRDA 1MMDA 1OJLA 3N4MA 5ILSA 2K85A 1XSDA 2NYXA 5ICGA 4FX4A 3A03A 1LMB3 4CYCA 3HRMA 2FBKA 4Z5CA 2XF7A 2VE9A 1PUEE 1ZARA 3K2AA 2HPMA 1B8IB 3LSJA 3HRUA 4UVCA 3S2DJ 2KPMA 3W6JB 1RI7A 2JT1A 3C2BA 4QTRA 1QQAA 5HOOA 2IEKA 3PNYA 2NAZA 3V8KA 3HC7A 4B1RA 1DW9A 4F55A 4QIWN 4Y15A 3ZR8X 1DQUA 4KT6A 2K3PA 4HQMA 1XPXA 4IOAF 1W36D 4RAGA 1HSJA 1SMYF 1IN6A 1ORKA 2DK8A 4LLLA 1R00A 4NC6A 4RGRA 5M5WJ 4AIKA 1GDTA 2W85A 2K4JA 3VOEA 3F8MA 1NEQA 3QOWA 1WJFA 2EFWA 2A61A 2PXQA 1WKMA 1GLNA 4I6ZA 3G1MA 2BXZA 4XLCA 2GXAA 2DA7A 1OQYA 5J4YA 5JVGF 4UNOA 3HTUA 2DA2A 4ESBA 5DM7F 4BQAA 2PUAA 1DDNA 2V9KA 3SFZA 3UFDA 3HDDA 3FYAA 1X58A 2E2JJ 4YIFA 5HDKA 3QQAA 4NUBA 2G7HA 1TBXA 4IOCF 4I6RA 3KL4A 3M07A 1X2LA 1EKEA 1IDYA 2FUG2 1H8AC 2RDPA 2R63A 5ED4A 3G5GA 3PQJA 2UUZA 4GO1A 1FY7A 2DO7A 4II3A 2LKSA 2YS9A 4GXOA 1IXSB 2IJLA 3IHUA 4GYGA 1LPQA 2AXTC 3FMRA 3VDXA 1BBYA 2VB6A 3HL2A 2ZJPF 4IWRA 1IDZA 1X4PA 3BQZA 4UUTA 1Y0UA 2A68F 2ADUA 2VKVA 2PIJA 1F36A 3A0BC 3IC7A 2JA8J 2UZKA 2DN0A 3PUBA 1ZLKA 1PP7U 4ZTJA 2GRMA 3BG7A 5ICCA 3CJQB 3HOSA 1Z7UA 1J75A 4WWCA 3BG3A 1STZA 1OYYA 4BHCA 4BXUA 4Z5DA 3RKXA 5FRNA 3VK0A 4DQ2A 2NVTJ 1XSXA 3SHFA 2A3SA 5DV5A 3WTXC 2XKPA 4BBSJ 5F0CA 2HCNA 1YW7A 4YFKF 1LNWA 5J47A 2Z33A 2DT5A 4E7IA 3H5TA 2ZSIB 3CDIA 1X3ZB 1Q1VA 3CUQC 4EM2A 2E60A 2PUFA 3LSMA 4UUSA 4XK4A 4YARA 3SR4A 2Y0SA 1HW5A 5KNLA 2GQQA 5E1WA 3NWSA 3SZGA 5B66C 1G4DA 1QZEA 4RDUA 3F6VA 2Y69H 4M9XA 4HF0A 3J7AY 4XIDA 2VQLA 1R71A 2MSYA 1U6GA 2F48A 4Y17A 5IYCJ 4OB4A 3QF3A 4ANJA 3N05A 4WXCA 1SD5A 5F0FA 1O3RA 1SQ8A 3L2WA 5IYDJ 2EF8A 4Z5HA 5GP9A 1U0JA 3D5LA 2NXNB 1DU0A 2QA4I 1RUNA 3MKLA 1ETOA 3QWGA 3MWMA 4PFPA 1WJCA 3QPHA 3OYEA 3G4SI 1HCRA 3IL2A 1X3WB 3M3YJ 4HSRA 4DW6A 3RPUA 3NARA 2CW7A 1EFAA 5IY5H 1T0FC 1VQ4I 4PU8A 2W7NA 2UWMA 1RNLA 1TQPA 1IRXA 1MH4A 4LMYA 1BC7C 2RC4A 2KIUA 2P81A 2KRCA 4B4CA 3LAPA 3V4GA 5L3DA 4XLNF 3F21A 3KP7A 2IPQX 3K4KA 2MGQA 2RV8A 3TW6A 5H2FC 1L0OC 1IRFA 5HLGA 2LLVA 2KP6A 2BZTA 3GUUA 1DUXC 2R7QA 2O8XA 3OQMA 1FOKA 4AYBN 4CYCB 2D5VA 2WTEA 3NAUA 3CUQB 2CROA 4ESFA 5D8LB 1RIOA 4IZZA 2CQXA 2FBHA 2H27A 2WY8Q 2VC1A 4KUMA 3HOWJ 2L7KA 3CZ6A 2EJRA 2MLGA 4E7SA 4A0ZA 4CXFA 2FE3A 3TEDA 3GLLA 2IV1A 2HFZA 2B63J 2LSOA 3OOUA 5CYVA 4BNCA 2V1XA 4UY8I 2CQKA 2PXEA 3H3UA 4BQOA 2LDUA 3NWTA 1DGWY 4U7DA 4DYCA 3K10A 2FFHA 4GHJA 2ICPA 2WBMA 2ZO4A 3CCJI 2VEOA 1P7IA 3GW2A 3H36A 3JRBA 1BM9A 5EEGA 3V7SA 2YU9J 3J81Z 1MH3A 3TL4X 1BIAA 1B9NA 3LFKA 2M30A 1EF4A 4ZYDA 2DCEA 1KYWA 3IV5A 3QOEA 3OIQA 4UHTA 2E36A 2VASA 1MJAA 4BKXA 2RQPA 4EQZA 1Z3XA 3CROL 3GVAA 5D5WB 2X1EA 2GOXB 3WTUC 1T2KA 1VI0A 3LFUA 1QRYA 4YFNF 2LY2A 3CMYA 2VKDA 1Z9CA 2KL4A 2XXPA 2EFQA 5BS6A 1W7PD 4QSHA 3F22A 3CJTB 2HR3A 3KE2A 4A3JJ 2AWIA 1O7FA 2PMZN 2VBXA 3KP2A 4Y33A 4LK1F 3E5XA 5LRRA 4HRIA 2RREA 4ER7A 2AQEA 2QF7A 2JVHA 3L00A 1Y8RB 3JREA 5HDNA 2FF4A 2Z9OA 3A4CA 1IV8A 1FLIA 4I6TA 4L9JA 1LDKB 4W1UA 2WUSR 1LQ1A 2EV5A 4E7HA 5DSXA 5K5OA 3X2QH 2IT0A 1FPQA 1ZK8A 4X1EA 3G6EI 4I98B 2XRNA 1TT0A 2J7WA 3E1SA 5GAEJ 3IAS2 2EQRA 2JSPA 3LQRA 3WHBA 2IA1A 3ABUA 2IS6A 2PXTA 4PFOA 3M8FA 1J2XA 4JCYA 1QP7A 3H0DA 5LFAA 4OINF 2QGUA 3DF8A 2A6CA 2KPJA 3RQ4A 5FLXK 3LQXA 3K1NA 2LR8A 2DMUA 1PNRA 2KT0A 4PU4C 4HRAA 2W4SA 2ACJA 1WPKA 3WTSC 1FBUA 5DTQA 5K98B 1TWFJ 1UELB 2A6TA 2CJJA 2K7LA 3ZPLA 2OAZA 5ERIA 4M3GA 1NK3P 3MFKA 2MH9A 4HYEA 1XDSA 2Q0OA 2DXIA 3TW7A 1UCRA 3H9QA 1XGOA 2AXLA 1BI2A 2HKOA 3PM1A 4IRGA 2LBFA 3HOVJ 2RNJA 2QKLB 3DBHB 1VQKI 4Z6YA 2QVOA 3ABLH 4BGDA 1H9GA 1PRUA 1JJ8C 4XKBA 4M6XA 2JN6A 5D6FA 5CPRB 4JCXA 1LCCA 1UHSA 4RLFA 2R7OA 3WU1B 3GF2A 2GLOA 1TP4A 1XMAA 1K6YA 2VPLA 4BS9A 3OYFA 2ELHA 3CC4I 2PJPA 1MBJA 3TMOA 5E8GA 5GTHC 1IW7F 2ZBKA 3VB2A 1YSEA 2FOKA 3IWFA 3QPLA 1VQ8I 2VPRA 1ON1A 4K2EA 1U3EM 2YU3A 3MLFA 4EV0A 1B6AA 5FRMA 5B1AH 2MXDA 1ZG1A 1Q1HA 3IRRA 4BQNA 1ZN2A 2KHMA 2P0WA 2CSFA 3CCUI 3LL7A 2CFXA 2W00A 3DKYA 3WHCA 2ZKZA 2DAOA 5LGUA 4CGZA 2LBFB 1C0WA 3E6BA 3ZMZA 1Z91A 1BIBA 3L2UA 5DM6F 2A69F 1HLVA 3MCZA 3Q0VA 2WY7Q 3L09A 2PE5A 1MW7A 1V3FA 4ENKA 1R9TJ 4IVNA 3HZIB 2M87A 3FXQA 1FYKA 2ID6A 2ECCA 1V4RA 2O8KA 5F6FA 4MEYF 3RKYA 4MTDA 4PSXA 1QBJA 3DEUA 2E2IJ 2XCJA 1KU3A 4XLPF 6PAXA 3CCYA 4BL0B 4CHUA 3ABTA 2PX9A 4RMNA 3A1YA 2HTSA 4C2MJ 4U0VA 1LE8B 2L9RA 3CLCA 4B8XA 3E5UA 1WJAA 2KRHA 4HG2A 3F72A 2ZMEA 4EJOA 3A01A 3CUOA 1CGPA 4AWXB 4HPQA 2BXYA 2K9MA 1KONA 1TWGJ 4OMYA 4BU2A 2R7XA 3EPZA 4UV8A 1D0ZA 1GXQA 3JW4A 2OCCH 2HYFA 1UAAA 1MZBA 2CS3A 3IKTA 3OOPA 4Q48A 2LYJA 3FHZA 1XB4A 4F52A 3OYJA 2HS5A 3HOYJ 3IVPA 4D1QA 1O57A 2MBFA 1S9HA 3DTEA 1KU9A 2LREA 4U0WA 3PO3J 3BROA 2X48A 2RQQA 3KETA 1YW8A 4A3FJ 1IN7A 5AIQA 1RR8C 4C3IJ 1F1ZA 3CDLA 4EGZA 1Z6RA 2JMWA 2JPBA 2OV7A 4RA2A 4UUVA 1REPC 1YX5A 2WWYA 2HOAA 2E7WA 3GBGA 4U88A 4X4FA 1XGMA 1LEAA 4EKGA 1IC8A 3FXLA 1MFQC 1HC8A 5HDGA 1UG2A 3H5AA 2NVYJ 5L3FA 1F5TA 1YI2I 5BPDA 1TW3A 3WG7H 3K0LA 2CV0A 3SFIA 4E7JA 3JR9A 2WAQN 3DV8A 3RZZA 2XIGA 1X2NA 2IP2A 1TTYA 3NQOA 1Z3YA 3FMYA 5L3EA 1R58A 4CCMA 2W84A 5HNHA 4OAYA 4NB5A 1XGNA 4IO9F 4LIVA 4H0EA 2WAFA 3OIPA 2EBIA 1JFTA 2XAUA 3FXMA 2M4HA 2V9PA 3PXPA 1FBQA 2VQCA 3B6AA 3EUHC 3FXUA 2B5AA 3LISA 4ZDOA 1QB2A 1CF7B 1J7KA 4DIQA 4HDVA 2OFYA 3W2AA 3TDUC 4EJWA 4OIQF 3MZ8A 3TFLA 2X6WA 2XROA 4KYWA 5EEAA 2F5DA 1U9NA 4D5CA 1SANA 1UMQA 1FIAA 4A12A 4KIFA 1HBXG 4NNJA 3AFHA 4E6KG 4Q4ZF 2M9HA 3KZYA 4ZZDA 1XMKA 2FX0A 4LLNA 3BWGA 2R7ZJ 1ETVA 5KAFC 1RPEL 2AO9A 5IT9Z 1D5VA 2QUFA 1TC3C 1RZRA 1YG2A 3HOXJ 3ERMA 3I59B 4L5EA 2XAQA 5BNGA 5D4RA 3ZQFA 4U0YA 4PGHA 2JK3A 1ZAYA 3Q0WA 3DEEA 4M3DA 3HSRA 1ZG5A 5E18F 5AONA 3K4NA 3CESA 2XSDC 4DYQA 1V5GA 3E3VA 3OR2C 2LNMA 2E7XA 3W3CA 3LFPA 4PSWA 5DT2A 2BY1A 1QA6A 5B3SH 1D0YA 1XWRA 1IN4A 4PJJA 3A9ZA 1EH7A 3G0TA 2FNAA 4ENNA 5EZGA 3ZMUA 2DW4A 4XN0A 5LHHA 1SVLA 2GA2A 5TRDA 2M45A 2BY3A 1RETA 4XLAA 4UXNA 3LSKA 3DU6A 3SXYA 2EFPA 3JTGA 2R3SA 5LGTA 3ZPXA 3ZMTA 3OYHA 2BOLA 2M7BA 4GCVA 4MHGA 3I53A 3M1EA 2ZFWA 2VBZA 2DFFA 2LRDA 5CQEA 4PJLA 3W6KB 4BUPA 5HS9A 1UZCA 2XPVA 1FEXA 5FLXZ 1OYIA 3U9GA 3BD1A 1WETA 1DU6A 3EUKL 3KZZA 3OL3A 1X1CA 3KLOA 4UB6C 1JTYA 1ITYA 3TELA 3NRVA 1B8IA 1ZZ6A 1MBHA 4R79A 2X85A 4YG4A 2LK2A 3WE2A 3F8FA 2OF7A 3I0TA 4S0HB 2XDVA 1JJ6C 5E3OA 1TL8A 3JXCL 5L3GA 5C4JJ 4PDKA 4B3XA 3TP0A 5KHDA 2F6CA 4IQJA 3GTQJ 1K61A 3P7NA 3FDYA 2Q2EA 5BMZA 1R5HA 1WVRA 3PJRA 2R7SA 2ICWG 4CDGA 2HXOA 1ZGWA 4IHVA 2KJBA 2R7UA 3FK6A 5J8FA 4HEA2 3K4LA 2EFOA 3LSGA 5EZHA 1IN5A 2EZIA 2DBBA 5HS8A 2X0LA 2E34A 4Q47A 3MAJA 4A3LJ 1R23A 3FBNB 4L5JA 4ESJA 2VIXA 3ASNH 5DTDA 4PCQA 5B1BH 3KYLA 4TV7A 1FP1D 3FM3A 4MNUA 3GFMA 2QWWA 2F5VA 2WA0A 2KEKA 4J1WA 3K2ZA 4ASNA 4U87A 3LQQA 4YRVA 3SEQA 2W57A 2DYSH 2Y2ZA 3PNTA 4IRIA 1S5LC 4XRFA 5DD4A 1O4XA 3BP8A 1T08B 2FBIA 2HZDA 4KIBA 1Y8QB 2R7WA 1X3UA 3S3MA 3PO2J 3OQNA 3CUQA 3O8GA 1K7AA 2EZKA 3TOBA 3DPLC 1BW5A 2BBYA 3ABKH 2R1JL 3U1DA 2M4GA 2Y31A 2EBYA 2DODA 2HZTA 4MEXF 3FYMA 4Y7NJ 3WE3A 1G3YA 2PXFA 2QSHX 4XRMA 3H92A 1YS7A 2LLKA 3FX3A 1MDMA 2XVCA 1D0XA 2KFDA 2LY9A 3BTCA 2HNHA 2PJRA 1FT9A 2F5CA 2Y48A 4ZDLA 1HW2A 4JX6A 4LLGF 2GIVA 3KEYA 1RKTA 4IHXA 2CUJA 3RTRA 1S8NA 4IVZA
chains in the Genus database with same CATH topology
1JGGA 2DMTA 3TW6A 2MGQA 2CUEA 2R5YB 1A5JA 2XB0X 2XGEA 2XPWA 1XS9A 5IP7J 2H8RA 3OQMA 1MBGA 1D5YA 4AYBN 4CYCB 3OIOA 2D5VA 2HOSA 4MLOA 4J1XA 3NAUA 2XPUA 2CROA 3GTJJ 3JRGA 5HODA 2ICTA 3O9XA 1RIOA 2CQXA 2LP0A 1IGNA 4XICA 1SFOJ 3HOWJ 5J1UA 2GRLA 4X4HA 3JXDL 1DWKA 4YBAA 2YUSA 5DS9A 3TEDA 3MN2A 2IV1A 2B63J 1HF0A 1VNDA 3OOUA 1IV6A 2XIUA 5E3NA 3BTJA 3IH4A 2CRGA 1UTXA 4G12A 4DYCA 1K83J 1E3OC 2GBYA 4GHJA 2HYJA 2ICPA 5F0HA 1QQBA 2LYLA 1XG1A 2WV1A 1POUA 1WCMJ 3EUSA 1U9OA 2M34A 4J19A 1P7IA 5IP6A 4A3IJ 3IH2A 1BW6A 3JRBA 2YU9J 1MH3A 2AHQA 2MW8A 1EF4A 4D7NA 3HOUJ 1AKHB 3HGYA 4A3DJ 2FQ4A 4V2FA 1H88C 3GTGJ 2PPXA 4HNVA 3ZKCA 3IV5A 2DMQA 3BS3A 2ELKA 4AUXA 4BKXA 3CROL 2L7ZA 3FIWA 1IG7A 3TRBA 3S16J 4I76A 2HI3A 3BTLA 2E1OA 4BXXJ 2DJNA 2TCTA 1NTCA 1VI0A 1QRYA 4D5FA 3IH3A 3CMYA 4MFEA 2KEIA 3HKZN 2JA6J 5EGOB 1NK2P 1ZTRA 3LSRA 3E7LA 1HDPA 4QSHA 5FKMA 4A3JJ 5C44J 1WH6A 2AWIA 4PU7A 4M3BA 2PMZN 2NVQJ 4MIMA 1ETKA 3DEWA 4ABZA 3HEFA 3RQIA 4NDLA 2NS8A 3CQZJ 2XB5A 1JTXA 2QF7A 3JREA 1PUFB 1LFUP 1ZR4A 1FTTA 2IBDA 3HBLA 3GTOJ 4I6TA 3ZHIA 2N8GA 1B72B 5IPAA 4W1UA 2L0KA 1W0UA 2WUSR 3S1RJ 5K7HA 3JRFA 1YRNA 2XGCA 2R92J 4GQMA 1CJGA 1ZK8A 4X1EA 3OP9A 3OMTA 4MFDA 4F8DA 2IU7A 1ZUGA 2EQRA 1ZVVA 2M0CA 4FISA 1YRNB 3L1PA 3WHBA 2OR1L 3SCGA 4A3MJ 1TWHJ 4RBOA 4DZJA 2JA5J 4JCYA 2EH3A 2LVSA 1QP7A 4BY7J 1Z77A 2COBA 3SJMA 5EGOA 1JKPC 2A6CA 1ZS4A 4X6AJ 1TWAJ 2KPJA 2PUBA 3R1FA 1AU7A 2LR8A 2DMUA 1PNRA 1MNMC 2KT0A 1QVTA 1B0NA 1X2MA 3RZDJ 4PU4C 4I8TA 1WPKA 3RKQA 3BR0A 1RR7A 1AHDP 1JFSA 2JA7J 2VKEA 3BR6A 4UUSB 3BG9A 3G1LA 1I3QJ 2MQKA 1TWFJ 2M8GX 1ETQA 2CJJA 4JP0A 3ZOBA 4M3GA 1NK3P 2DA5A 5J1RA 3TW7A 1ETWA 4W97A 3DCFA 3PM1A 4FE7A 3B6CA 3I4NJ 3HOVJ 1ZKGA 5F1JA 1RPWA 3FISA 3GTPJ 5F04A 1PRUA 1JJ8C 4XRSG 5FJ8J 2PUDA 1QP0A 1POGA 2NS7A 1LE8A 2JN6A 2E2HJ 5A7LA 1OFCX 4JCXA 3U3WA 3OSGA 1LCCA 1ZZ8A 1UHSA 1PRVA 1JWLA 2ME6A 1Y1WJ 2GLOA 2HDDA 2ZB9A 2GZUA 4DYRA 2K9NA 1ZR2A 3HOZJ 2LYRA 1MBJA 2O7OA 5GPCA 1YSEA 5M3MJ 3QPLA 3O8HA 2IVBA 1T33A 2VPRA 4A3GJ 1CQTA 3MLFA 1IRZA 1RZRD 4A69C 3I4MJ 1JUSA 3A01B 2O9LA 2CU7A 2AW6A 3ZQHA 3S8QA 1L1MA 1A6IA 3LSPA 3OQOA 2QCOA 2HINA 2CSFA 4FBIA 3S17J 4IVZA 1U8BA 1OCTC 1ADRA 3WHCA 1MSFC 1VPWA 1H89C 1I50J 1OSLA 2FJ1A 1IUFA 1HLVA 1GV5A 3Q0VA 2K9SA 2R0QC 5M5YJ 5IYBJ 2PE5A 2PUCA 2Y9ZA 5K7FA 1R9TJ 4AC0A 4X4BA 4X4DA 3HZIB 2HOTA 3F52A 3JRIA 4BBRJ 2ID6A 1TWCJ 2ECCA 5IP9J 5GPAA 1JT0A 3Q3SA 2O8KA 2XCJA 2RAEA 2E2IJ 1PUFA 2HXIA 4A3CJ 1BJZA 3CCYA 1MBKA 2O49A 1LFBA 3ZQGA 2FD5A 4YG7B 3A02A 2DA3A 1P7JA 4C2MJ 2NOGA 2L9RA 4DZPA 1LE8B 3CLCA 1B72A 5FKOA 2ID3A 1ZZBA 2DMNA 1WI3A 2LTPA 4IHYA 3A01A 1R63A 3D1NI 1QPZA 3S15J 2BNOA 5F27A 3JRHA 3S1QJ 2IVQA 1TWGJ 2R5ZA 5M5XJ 4X4GA 1APLC 3BTIA 3HGGA 5J3LA 2LYJA 3HOYJ 4O8BA 1GV2A 4XRSA 3IVPA 2R5YA 3MVPA 3QPSA 2L7MP 3ZQIA 3JRAA 3BT9A 2VUMJ 3PO3J 2X48A 5K98B 3CECA 5EYRA 1Z0XA 1XC5A 3BG5A 4A3FJ 1LQCA 1FIPA 1ZPQA 3S1NJ 2K40A 1JUPA 3LOCA 4C3IJ 5J1YA 3CDLA 1WH5A 1MBEA 5FLMJ 2WIUB 2IAIA 2ECBA 2JMWA 1FTZA 2XJ3A 5EG0B 1PERL 1LLIA 3GN5B 3Q0UA 2HOAA 2K9QA 2BJCA 3GBGA 4X4FA 1GVDA 4PU3C 2X6OA 5C4XJ 1IC8A 1QVUA 2BNNA 3LNQA 1UG2A 2W48A 2NVYJ 5IOZA 2LD5A 1Y1VJ 3SDGA 2AXVA 3SFIA 3RZOJ 2EWTA 3JR9A 3QQ6A 4EEFG 2M2EA 2WAQN 3TP3A 4B3AA 2AXUA 3RZZA 2AUWA 4JYKA 2AXZA 4I6UA 1X2NA 2KDZA 3ZQCA 5FLVA 2KZ8A 3FMYA 4JX4A 3W6VA 3M4OJ 1ETYA 4X4IA 4M3FA 1BDHA 3FKIJ 4V2GA 2H1KA 2OPTA 3QYXA 3F51A 5M3FJ 1RKWA 4Y42A 1JFTA 2EBIA 1MBFA 3B7HA 4D7MA 3PXPA 4IA8A 4A3BJ 1BL0A 2B5AA 3B6AA 5FKKA 3LISA 3HM5A 3GBFA 4X4EA 3BR5A 3ZQLA 2OFYA 5EG0A 1HDDC 2E19A 2JJ7A 1ZZCA 2XGDA 5FKLA 5EEAA 4M3EA 1U9NA 3HB9A 4D5CA 1SANA 1Y9QA 1UMQA 1HOMA 2DA4A 1FIAA 2IVGA 2ME0A 3KJXA 3JRDA 1NERA 1ZZ7A 1OJLA 5C3EJ 2I10A 1ZZ9A 4FCYA 2M9HA 2LYSA 2LYQA 3A03A 3JRCA 1LMB3 3S14J 2FX0A 2TRTA 2Y30A 4CYCA 2XRLA 4Z58A 2R7ZJ 4Z5CA 2LCVA 1ETVA 3K2AA 1RPEL 1B8IB 2AO9A 3LSJA 3S2DJ 4MO7A 1TC3C 4FN3A 1RZRA 4QTRA 3C2BA 1QQAA 2NVXJ 2PUEA 4C3JJ 3HOXJ 1JT6A 2IEKA 4L5EA 5BNGA 3F6WA 4B1RA 5E3MA 4NDWA 3K7AJ 3ZQFA 4A93J 1DW9A 4QIWN 2JK3A 1ZAYA 3Q0WA 4M3DA 3KZ3A 1WGXA 5K7ZA 1W0TA 2XSDC 1MSEC 4DYQA 2CUFA 2JCGA 2EZHA 2Y9YA 3LFPA 4YG1A 1ORKA 4FE4A 5M5WJ 4X4CA 1GDTA 1ETXA 1XWRA 2DA1A 1NEQA 5EZGA 2MG4A 3BR1A 4I6ZA 4C3HJ 3G1MA 1U78A 1RETA 3ZHMA 2CQQA 1JKRC 1R69A 2DA7A 2HQ5A 2PUAA 2DA2A 1T56A 3UFDA 3HDDA 3FYAA 1X58A 2E2JJ 3DNVB 1UXDA 3QQAA 4I6RA 5JLXA 1X2LA 5EDNA 1IDYA 2BNMA 2XPVA 1FEXA 4BY1J 1H8AC 3H0GJ 2R63A 2EZLA 4A3EJ 3BD1A 3G5GA 3SCFA 1WETA 1DU6A 2DTZA 4IEJA 1WIZA 2YS9A 4IHWA 3BR2A 1JTYA 1ITYA 1B8IA 2O38A 1ZZ6A 1MBHA 5FKNA 4IWRA 4YG4A 2LK2A 1IDZA 3BQYA 3BQZA 4UUTA 2OF7A 4S0HB 2VKVA 1GT0C 1UXCA 1JJ6C 2JWTA 5E3OA 3JXCL 2L7FP 2PIJA 1OCPA 1F36A 5C4JJ 1VF9A 4Y52J 2JA8J 3TP0A 2DN0A 2DA6A 1I6HJ 2P81A 5JLWA 3S1MJ 2GRMA 3GTQJ 1K61A 3H3VK 5E3LA 1QPIA 1VFCA 2GM4A 3KXAA 2HXOA 3GTLJ 1X57A 3BG3A 1ZGWA 4IHVA 3GTKJ 3FK6A 3UKGA 2JVLA 1BDIA 1JKOC 4Z5DA 1LCDA 3VK0A 5IOYA 3F0CA 4LOCA 2NVTJ 2IUOA 1QP4A 3LSGA 5EZHA 1S7EA 2EZIA 4GFBA 4BBSJ 4M6VA 1F43A 1Y7YA 5F0CA 4A3LJ 2G0EA 4MCTA 3H5TA 5DTDA 1Q1VA 5EF6A 2FJRA 1ZQ3P 2PUFA 4JX5A 4UUSA 1JUMA 4XK4A 4YARA 3FK7A 2L8NA 3GN5A 2KEKA 4FTHA 4J1WA 3G1OA 1JH9A 4RDUA 2LYKA 2Y2ZA 3SCHA 1O4XA 4XIDA 1RZSA 3BDNA 2MSYA 3PO2J 5IYCJ 3OQNA 3O8GA 2R93J 3QF3A 4OB4A 4Z59A 2R5ZB 2EZKA 1G2HA 2LFBA 2DMPA 3JXBC 5F0FA 1BW5A 1FJLA 1SQ8A 5IYDJ 2EF8A 4Z5HA 3VPRA 2R1JL 2MEZA 5GP9A 2Y31A 2X9DA 2EBYA 1PRAA 1BA5A 1GUUA 1DU0A 3FYMA 4A3KJ 3MKLA 1ETOA 4Y7NJ 3G7DA 3QWGA 4JQDA 1WH7A 1AKHA 4XRMA 2LKXA 2VI6A 1JKQC 1HCRA 2LLKA 2WB1N 5F08A 3M3YJ 2LYPA 4DW6A 3OSFA 2LY9A 3BTCA 3NARA 3S2HJ 2KEJA 1EFAA 9ANTA 4PU8A 2XI8A 1MH4A 1IJWC 2PUGA 2HSGA 4JX6A 3BR3A 1WH8A 2L49A 4MCXA 1RKTA 4IHXA 3GTMJ 1ENHA 2Y0SN 4B4CA 2O4AA 1RESA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JGG A;  2DMT A;  3TW6 A;  2MGQ A;  2CUE A;  2R5Y B;  1A5J A;  2XB0 X;  2XGE A;  2XPW A;  1XS9 A;  5IP7 J;  2H8R A;  3OQM A;  1MBG A;  1D5Y A;  4AYB N;  4CYC B;  3OIO A;  2D5V A;  2HOS A;  4MLO A;  4J1X A;  3NAU A;  2XPU A;  2CRO A;  3GTJ J;  3JRG A;  5HOD A;  2ICT A;  3O9X A;  1RIO A;  2CQX A;  2LP0 A;  1IGN A;  4XIC A;  1SFO J;  3HOW J;  5J1U A;  2GRL A;  4X4H A;  3JXD L;  1DWK A;  4YBA A;  2YUS A;  5DS9 A;  3TED A;  3MN2 A;  2IV1 A;  2B63 J;  1HF0 A;  1VND A;  3OOU A;  1IV6 A;  2XIU A;  5E3N A;  3BTJ A;  3IH4 A;  2CRG A;  1UTX A;  4G12 A;  4DYC A;  1K83 J;  1E3O C;  2GBY A;  4GHJ A;  2HYJ A;  2ICP A;  5F0H A;  1QQB A;  2LYL A;  1XG1 A;  2WV1 A;  1POU A;  1WCM J;  3EUS A;  1U9O A;  2M34 A;  4J19 A;  1P7I A;  5IP6 A;  4A3I J;  3IH2 A;  1BW6 A;  3JRB A;  2YU9 J;  1MH3 A;  2AHQ A;  2MW8 A;  1EF4 A;  4D7N A;  3HOU J;  1AKH B;  3HGY A;  4A3D J;  2FQ4 A;  4V2F A;  1H88 C;  3GTG J;  2PPX A;  4HNV A;  3ZKC A;  3IV5 A;  2DMQ A;  3BS3 A;  2ELK A;  4AUX A;  4BKX A;  3CRO L;  2L7Z A;  3FIW A;  1IG7 A;  3TRB A;  3S16 J;  4I76 A;  2HI3 A;  3BTL A;  2E1O A;  4BXX J;  2DJN A;  2TCT A;  1NTC A;  1VI0 A;  1QRY A;  4D5F A;  3IH3 A;  3CMY A;  4MFE A;  2KEI A;  3HKZ N;  2JA6 J;  5EGO B;  1NK2 P;  1ZTR A;  3LSR A;  3E7L A;  1HDP A;  4QSH A;  5FKM A;  4A3J J;  5C44 J;  1WH6 A;  2AWI A;  4PU7 A;  4M3B A;  2PMZ N;  2NVQ J;  4MIM A;  1ETK A;  3DEW A;  4ABZ A;  3HEF A;  3RQI A;  4NDL A;  2NS8 A;  3CQZ J;  2XB5 A;  1JTX A;  2QF7 A;  3JRE A;  1PUF B;  1LFU P;  1ZR4 A;  1FTT A;  2IBD A;  3HBL A;  3GTO J;  4I6T A;  3ZHI A;  2N8G A;  1B72 B;  5IPA A;  4W1U A;  2L0K A;  1W0U A;  2WUS R;  3S1R J;  5K7H A;  3JRF A;  1YRN A;  2XGC A;  2R92 J;  4GQM A;  1CJG A;  1ZK8 A;  4X1E A;  3OP9 A;  3OMT A;  4MFD A;  4F8D A;  2IU7 A;  1ZUG A;  2EQR A;  1ZVV A;  2M0C A;  4FIS A;  1YRN B;  3L1P A;  3WHB A;  2OR1 L;  3SCG A;  4A3M J;  1TWH J;  4RBO A;  4DZJ A;  2JA5 J;  4JCY A;  2EH3 A;  2LVS A;  1QP7 A;  4BY7 J;  1Z77 A;  2COB A;  3SJM A;  5EGO A;  1JKP C;  2A6C A;  1ZS4 A;  4X6A J;  1TWA J;  2KPJ A;  2PUB A;  3R1F A;  1AU7 A;  2LR8 A;  2DMU A;  1PNR A;  1MNM C;  2KT0 A;  1QVT A;  1B0N A;  1X2M A;  3RZD J;  4PU4 C;  4I8T A;  1WPK A;  3RKQ A;  3BR0 A;  1RR7 A;  1AHD P;  1JFS A;  2JA7 J;  2VKE A;  3BR6 A;  4UUS B;  3BG9 A;  3G1L A;  1I3Q J;  2MQK A;  1TWF J;  2M8G X;  1ETQ A;  2CJJ A;  4JP0 A;  3ZOB A;  4M3G A;  1NK3 P;  2DA5 A;  5J1R A;  3TW7 A;  1ETW A;  4W97 A;  3DCF A;  3PM1 A;  4FE7 A;  3B6C A;  3I4N J;  3HOV J;  1ZKG A;  5F1J A;  1RPW A;  3FIS A;  3GTP J;  5F04 A;  1PRU A;  1JJ8 C;  4XRS G;  5FJ8 J;  2PUD A;  1QP0 A;  1POG A;  2NS7 A;  1LE8 A;  2JN6 A;  2E2H J;  5A7L A;  1OFC X;  4JCX A;  3U3W A;  3OSG A;  1LCC A;  1ZZ8 A;  1UHS A;  1PRV A;  1JWL A;  2ME6 A;  1Y1W J;  2GLO A;  2HDD A;  2ZB9 A;  2GZU A;  4DYR A;  2K9N A;  1ZR2 A;  3HOZ J;  2LYR A;  1MBJ A;  2O7O A;  5GPC A;  1YSE A;  5M3M J;  3QPL A;  3O8H A;  2IVB A;  1T33 A;  2VPR A;  4A3G J;  1CQT A;  3MLF A;  1IRZ A;  1RZR D;  4A69 C;  3I4M J;  1JUS A;  3A01 B;  2O9L A;  2CU7 A;  2AW6 A;  3ZQH A;  3S8Q A;  1L1M A;  1A6I A;  3LSP A;  3OQO A;  2QCO A;  2HIN A;  2CSF A;  4FBI A;  3S17 J;  4IVZ A;  1U8B A;  1OCT C;  1ADR A;  3WHC A;  1MSF C;  1VPW A;  1H89 C;  1I50 J;  1OSL A;  2FJ1 A;  1IUF A;  1HLV A;  1GV5 A;  3Q0V A;  2K9S A;  2R0Q C;  5M5Y J;  5IYB J;  2PE5 A;  2PUC A;  2Y9Z A;  5K7F A;  1R9T J;  4AC0 A;  4X4B A;  4X4D A;  3HZI B;  2HOT A;  3F52 A;  3JRI A;  4BBR J;  2ID6 A;  1TWC J;  2ECC A;  5IP9 J;  5GPA A;  1JT0 A;  3Q3S A;  2O8K A;  2XCJ A;  2RAE A;  2E2I J;  1PUF A;  2HXI A;  4A3C J;  1BJZ A;  3CCY A;  1MBK A;  2O49 A;  1LFB A;  3ZQG A;  2FD5 A;  4YG7 B;  3A02 A;  2DA3 A;  1P7J A;  4C2M J;  2NOG A;  2L9R A;  4DZP A;  1LE8 B;  3CLC A;  1B72 A;  5FKO A;  2ID3 A;  1ZZB A;  2DMN A;  1WI3 A;  2LTP A;  4IHY A;  3A01 A;  1R63 A;  3D1N I;  1QPZ A;  3S15 J;  2BNO A;  5F27 A;  3JRH A;  3S1Q J;  2IVQ A;  1TWG J;  2R5Z A;  5M5X J;  4X4G A;  1APL C;  3BTI A;  3HGG A;  5J3L A;  2LYJ A;  3HOY J;  4O8B A;  1GV2 A;  4XRS A;  3IVP A;  2R5Y A;  3MVP A;  3QPS A;  2L7M P;  3ZQI A;  3JRA A;  3BT9 A;  2VUM J;  3PO3 J;  2X48 A;  5K98 B;  3CEC A;  5EYR A;  1Z0X A;  1XC5 A;  3BG5 A;  4A3F J;  1LQC A;  1FIP A;  1ZPQ A;  3S1N J;  2K40 A;  1JUP A;  3LOC A;  4C3I J;  5J1Y A;  3CDL A;  1WH5 A;  1MBE A;  5FLM J;  2WIU B;  2IAI A;  2ECB A;  2JMW A;  1FTZ A;  2XJ3 A;  5EG0 B;  1PER L;  1LLI A;  3GN5 B;  3Q0U A;  2HOA A;  2K9Q A;  2BJC A;  3GBG A;  4X4F A;  1GVD A;  4PU3 C;  2X6O A;  5C4X J;  1IC8 A;  1QVU A;  2BNN A;  3LNQ A;  1UG2 A;  2W48 A;  2NVY J;  5IOZ A;  2LD5 A;  1Y1V J;  3SDG A;  2AXV A;  3SFI A;  3RZO J;  2EWT A;  3JR9 A;  3QQ6 A;  4EEF G;  2M2E A;  2WAQ N;  3TP3 A;  4B3A A;  2AXU A;  3RZZ A;  2AUW A;  4JYK A;  2AXZ A;  4I6U A;  1X2N A;  2KDZ A;  3ZQC A;  5FLV A;  2KZ8 A;  3FMY A;  4JX4 A;  3W6V A;  3M4O J;  1ETY A;  4X4I A;  4M3F A;  1BDH A;  3FKI J;  4V2G A;  2H1K A;  2OPT A;  3QYX A;  3F51 A;  5M3F J;  1RKW A;  4Y42 A;  1JFT A;  2EBI A;  1MBF A;  3B7H A;  4D7M A;  3PXP A;  4IA8 A;  4A3B J;  1BL0 A;  2B5A A;  3B6A A;  5FKK A;  3LIS A;  3HM5 A;  3GBF A;  4X4E A;  3BR5 A;  3ZQL A;  2OFY A;  5EG0 A;  1HDD C;  2E19 A;  2JJ7 A;  1ZZC A;  2XGD A;  5FKL A;  5EEA A;  4M3E A;  1U9N A;  3HB9 A;  4D5C A;  1SAN A;  1Y9Q A;  1UMQ A;  1HOM A;  2DA4 A;  1FIA A;  2IVG A;  2ME0 A;  3KJX A;  3JRD A;  1NER A;  1ZZ7 A;  1OJL A;  5C3E J;  2I10 A;  1ZZ9 A;  4FCY A;  2M9H A;  2LYS A;  2LYQ A;  3A03 A;  3JRC A;  1LMB 3;  3S14 J;  2FX0 A;  2TRT A;  2Y30 A;  4CYC A;  2XRL A;  4Z58 A;  2R7Z J;  4Z5C A;  2LCV A;  1ETV A;  3K2A A;  1RPE L;  1B8I B;  2AO9 A;  3LSJ A;  3S2D J;  4MO7 A;  1TC3 C;  4FN3 A;  1RZR A;  4QTR A;  3C2B A;  1QQA A;  2NVX J;  2PUE A;  4C3J J;  3HOX J;  1JT6 A;  2IEK A;  4L5E A;  5BNG A;  3F6W A;  4B1R A;  5E3M A;  4NDW A;  3K7A J;  3ZQF A;  4A93 J;  1DW9 A;  4QIW N;  2JK3 A;  1ZAY A;  3Q0W A;  4M3D A;  3KZ3 A;  1WGX A;  5K7Z A;  1W0T A;  2XSD C;  1MSE C;  4DYQ A;  2CUF A;  2JCG A;  2EZH A;  2Y9Y A;  3LFP A;  4YG1 A;  1ORK A;  4FE4 A;  5M5W J;  4X4C A;  1GDT A;  1ETX A;  1XWR A;  2DA1 A;  1NEQ A;  5EZG A;  2MG4 A;  3BR1 A;  4I6Z A;  4C3H J;  3G1M A;  1U78 A;  1RET A;  3ZHM A;  2CQQ A;  1JKR C;  1R69 A;  2DA7 A;  2HQ5 A;  2PUA A;  2DA2 A;  1T56 A;  3UFD A;  3HDD A;  3FYA A;  1X58 A;  2E2J J;  3DNV B;  1UXD A;  3QQA A;  4I6R A;  5JLX A;  1X2L A;  5EDN A;  1IDY A;  2BNM A;  2XPV A;  1FEX A;  4BY1 J;  1H8A C;  3H0G J;  2R63 A;  2EZL A;  4A3E J;  3BD1 A;  3G5G A;  3SCF A;  1WET A;  1DU6 A;  2DTZ A;  4IEJ A;  1WIZ A;  2YS9 A;  4IHW A;  3BR2 A;  1JTY A;  1ITY A;  1B8I A;  2O38 A;  1ZZ6 A;  1MBH A;  5FKN A;  4IWR A;  4YG4 A;  2LK2 A;  1IDZ A;  3BQY A;  3BQZ A;  4UUT A;  2OF7 A;  4S0H B;  2VKV A;  1GT0 C;  1UXC A;  1JJ6 C;  2JWT A;  5E3O A;  3JXC L;  2L7F P;  2PIJ A;  1OCP A;  1F36 A;  5C4J J;  1VF9 A;  4Y52 J;  2JA8 J;  3TP0 A;  2DN0 A;  2DA6 A;  1I6H J;  2P81 A;  5JLW A;  3S1M J;  2GRM A;  3GTQ J;  1K61 A;  3H3V K;  5E3L A;  1QPI A;  1VFC A;  2GM4 A;  3KXA A;  2HXO A;  3GTL J;  1X57 A;  3BG3 A;  1ZGW A;  4IHV A;  3GTK J;  3FK6 A;  3UKG A;  2JVL A;  1BDI A;  1JKO C;  4Z5D A;  1LCD A;  3VK0 A;  5IOY A;  3F0C A;  4LOC A;  2NVT J;  2IUO A;  1QP4 A;  3LSG A;  5EZH A;  1S7E A;  2EZI A;  4GFB A;  4BBS J;  4M6V A;  1F43 A;  1Y7Y A;  5F0C A;  4A3L J;  2G0E A;  4MCT A;  3H5T A;  5DTD A;  1Q1V A;  5EF6 A;  2FJR A;  1ZQ3 P;  2PUF A;  4JX5 A;  4UUS A;  1JUM A;  4XK4 A;  4YAR A;  3FK7 A;  2L8N A;  3GN5 A;  2KEK A;  4FTH A;  4J1W A;  3G1O A;  1JH9 A;  4RDU A;  2LYK A;  2Y2Z A;  3SCH A;  1O4X A;  4XID A;  1RZS A;  3BDN A;  2MSY A;  3PO2 J;  5IYC J;  3OQN A;  3O8G A;  2R93 J;  3QF3 A;  4OB4 A;  4Z59 A;  2R5Z B;  2EZK A;  1G2H A;  2LFB A;  2DMP A;  3JXB C;  5F0F A;  1BW5 A;  1FJL A;  1SQ8 A;  5IYD J;  2EF8 A;  4Z5H A;  3VPR A;  2R1J L;  2MEZ A;  5GP9 A;  2Y31 A;  2X9D A;  2EBY A;  1PRA A;  1BA5 A;  1GUU A;  1DU0 A;  3FYM A;  4A3K J;  3MKL A;  1ETO A;  4Y7N J;  3G7D A;  3QWG A;  4JQD A;  1WH7 A;  1AKH A;  4XRM A;  2LKX A;  2VI6 A;  1JKQ C;  1HCR A;  2LLK A;  2WB1 N;  5F08 A;  3M3Y J;  2LYP A;  4DW6 A;  3OSF A;  2LY9 A;  3BTC A;  3NAR A;  3S2H J;  2KEJ A;  1EFA A;  9ANT A;  4PU8 A;  2XI8 A;  1MH4 A;  1IJW C;  2PUG A;  2HSG A;  4JX6 A;  3BR3 A;  1WH8 A;  2L49 A;  4MCX A;  1RKT A;  4IHX A;  3GTM J;  1ENH A;  2Y0S N;  4B4C A;  2O4A A;  1RES A; 
#chains in the Genus database with same CATH topology
 1LDJ A;  4EM1 A;  2VT3 A;  4IRH A;  2XPW A;  4G94 A;  4LB5 A;  1XS9 A;  3SZT A;  2H8R A;  3WTW C;  1MBG A;  2IVM A;  2HOS A;  2XPU A;  5IT9 K;  4GDF A;  4I99 C;  2CFO A;  1LB2 A;  2E5Z A;  2HGC A;  4LFU A;  4XLF A;  3J7A O;  2L4M A;  1SFO J;  5LGN A;  3BPX A;  3I64 A;  3PUF A;  5J1U A;  3OYN A;  3CCS I;  3U2R A;  1O3S A;  1PDN C;  4M9Z A;  1DWK A;  4YBA A;  3SYT A;  3DKX A;  4IX7 A;  3MQ0 A;  1HF0 A;  1VND A;  1IV6 A;  3CO7 C;  1MD0 A;  4XN3 A;  2P6T A;  2M4K A;  4XBF A;  3IH4 A;  2CRG A;  3VYT B;  1E3O C;  2HYJ A;  3DU5 A;  1EH8 A;  5D6E A;  2L9N A;  2LYL A;  1XG1 A;  1H9T A;  1HST A;  2CW0 F;  2M34 A;  1ZRC A;  1K4T A;  2F5F A;  3BZK A;  3IH2 A;  5IT3 A;  1DP7 P;  2DQL A;  2XSJ C;  1T98 A;  2AHQ A;  2MW8 A;  5ICE A;  1UFM A;  3R09 A;  4V2F A;  1H88 C;  3GTG J;  3ZKC A;  4HNV A;  2LLW A;  3R0A A;  4L9V A;  2QSF X;  1MNE A;  5D5X B;  2IGN A;  3SEZ A;  5KVR A;  1IG7 A;  4XKC A;  3S16 J;  1LVA A;  4I76 A;  1LFP A;  2JRT A;  1VQP I;  1SEU A;  2TCT A;  2LY1 A;  2QQA A;  3CCE I;  1KZH A;  5H20 A;  1NH3 A;  2BW3 B;  2KEI A;  1U2W A;  4AVZ A;  3HKZ N;  3K70 C;  1NK2 P;  4KN7 X;  1ERD A;  4OIP F;  5FKM A;  2ISZ A;  2B0L A;  3CLO A;  2FEZ A;  5C44 J;  4MIM A;  4BHB A;  4UV9 A;  3DEW A;  4CCN A;  1X1D A;  1TW2 A;  2MYS A;  3GCM A;  4RS8 A;  1LFU P;  4YEJ A;  1WFX A;  3S32 A;  3T1B A;  2IBD A;  2L5Q A;  3HBL A;  3GTO J;  1IO2 A;  3WU0 A;  3V7C A;  3ZHI A;  5L3C A;  1R5G A;  1P4W A;  4CH7 A;  3HSE A;  2L0K A;  1IXC A;  4CCL A;  1B59 A;  3HHH A;  3S1R J;  1RIO H;  3KFW X;  2PXV A;  1T95 A;  1TQI A;  2YX7 A;  3OMT A;  3OP9 A;  3FMQ A;  4MFD A;  3RSN A;  4F8D A;  4KA4 A;  5LHI A;  2M0M A;  4RAY A;  4A0Y A;  3C3W A;  4FIS A;  3MKY B;  5K1Y A;  1YRN B;  3F6O A;  4M6Y A;  2LF7 A;  1HA8 A;  3L1P A;  1LUJ B;  2O03 A;  1YO5 C;  3QU3 A;  4V19 K;  2JA5 J;  1I39 A;  2EIN H;  3QAH A;  2Z5U A;  1MMG A;  3KLN A;  4KIT B;  3SJM A;  1W1W E;  1JKP C;  4N9I A;  3VFZ A;  2Q1Z B;  3F23 A;  1U8R A;  2MC3 A;  4QLC U;  1BI1 A;  1B0N A;  4I8T A;  3RKQ A;  3BR0 A;  3JTH A;  1JFS A;  3ELK A;  3I71 A;  1BI0 A;  2VKE A;  2QBY B;  2ESN A;  1I3Q J;  1HQ1 A;  4JP0 A;  3ZOB A;  3GEZ A;  3PSI A;  2CO5 A;  5EEH A;  5J1R A;  3RYR A;  4ON0 A;  3WTY C;  4BE2 A;  3DCF A;  2X51 A;  5DYM A;  3B6C A;  2V79 A;  5GAD J;  3KYC B;  3A9Y A;  1FBS A;  2JZY A;  2Z2S B;  4P5O A;  2XXA A;  5KAI C;  3FIS A;  2QEX I;  3GTP J;  1FX7 A;  5F04 A;  3PQK A;  4F91 B;  3CD6 I;  1SFE A;  1FZP B;  3VSL A;  2OZ6 A;  3N97 A;  2HVQ A;  3OYA A;  1TLH B;  2HDD A;  3BJA A;  2DFI A;  2BVL A;  3DWL E;  2K9N A;  3LA3 A;  2VON A;  4L5I A;  3SX0 A;  1FYM A;  2O7O A;  4Y4R A;  4RM2 A;  2HOE A;  1Z1D A;  4EKI A;  4B43 A;  1T33 A;  4B47 A;  4N9H A;  2NVU B;  3G71 I;  4NQW B;  4D0P A;  3LSI A;  1IRZ A;  2VT2 A;  4A5M A;  3H9J A;  3I4M J;  3A01 B;  2CU7 A;  2XAF A;  3DPT A;  3ZQH A;  3S8P A;  4UVB A;  2A5W A;  4DJA A;  4FET A;  1VPW A;  1X1B A;  2PXL A;  1I50 J;  1KU2 A;  2DJI A;  1GV5 A;  3GWZ A;  3OYL A;  1MIJ A;  3K4C A;  4EAT A;  2RGV A;  2R0Q C;  2L1P A;  3VYS B;  1ON2 A;  1D8K A;  3ROU A;  2LNB A;  1WJD A;  3IP4 B;  2ZJQ F;  1E0E A;  4M71 A;  1EV7 A;  3K4B A;  4IXA A;  5IP9 J;  3MKZ A;  2VLA A;  5GPA A;  2RAE A;  3CO6 C;  3CLQ A;  2JA2 A;  1OKR A;  4YEL A;  3E6C C;  3CC2 I;  4A3C J;  1USS A;  1TZL A;  1LFB A;  1TNS A;  5J8C A;  1P7J A;  2R7D A;  1MKM A;  4IPA A;  2V4J C;  3M8E A;  1B72 A;  4M9S A;  5FKO A;  1SD6 A;  1WI3 A;  2KMU A;  2LTP A;  4JBA A;  4OWR B;  3PL8 A;  1QPZ A;  3VWS A;  4LIU A;  3C2G A;  1P92 A;  2VKH A;  3MZH A;  3S1Q J;  4O5V A;  2IVQ A;  3TO9 A;  3MD2 A;  4IHT A;  1X1P A;  1I1G A;  2Q8K A;  5JI6 A;  2EIJ H;  2QQ8 A;  5M5X J;  4X4G A;  4H4K C;  1W4M A;  1APL C;  1O7L A;  4RGU A;  2OQG A;  2Q2E B;  2R7T A;  2IS1 A;  4CZC A;  1DP3 A;  1GV2 A;  2DPD A;  3E0J B;  3JAM Z;  4XRS A;  3AG2 H;  2R5Y A;  3MVP A;  2GAU A;  3QPS A;  3H9G A;  1HKQ A;  1YOV B;  2O3F A;  2O61 A;  2MC4 A;  1UJ8 A;  2KIQ A;  5LD2 C;  3KP5 A;  1KU7 A;  4N0B A;  4HNU A;  1R6R A;  1YQA A;  2H6C A;  2K86 A;  1K4S A;  3RI4 A;  4UVA A;  3BG5 A;  2H1L A;  3LOC A;  4G7Z F;  1O3T A;  2ECB A;  1S29 A;  2XJ3 A;  5EG0 B;  1PER L;  3TQN A;  1I6X A;  1XSV A;  4ZH4 F;  2XAJ A;  4BEH B;  2NRA C;  2BJC A;  4XLE A;  1MMS A;  2M5W A;  4OIO F;  3DPU A;  2NS0 A;  2PFB A;  2XF5 A;  2ZSH B;  5H6Q A;  1QVU A;  3VYU B;  2DFE A;  3HJE A;  3A9X A;  1QHH D;  3M1C A;  4IHS A;  2AXV A;  3RZO J;  5FD6 A;  3EDP A;  2V3C C;  2ZME B;  2AUW A;  4L18 B;  4I6U A;  2L02 A;  1XCB A;  5KK1 A;  2UXX A;  1A35 A;  5FLV A;  1IXR C;  4EJV A;  4JX4 A;  3EET A;  1ETY A;  5GTI C;  2Z99 A;  4M3F A;  3S93 A;  2O0Y A;  3ABM H;  1YYV A;  3GZN B;  2H1K A;  2BVM A;  2M1B A;  2ZJR F;  2PMU A;  1RKW A;  5M3F J;  5CLS A;  3DTK A;  2ESH A;  3OYG A;  1BL0 A;  1BI3 A;  2LH9 A;  3MKW B;  2G9W A;  3GBF A;  4X4E A;  4ITV A;  4OU0 A;  1D1B A;  4YII A;  5EG0 A;  1BR2 A;  1OR7 A;  3CCR I;  2KRF A;  5BQT A;  1ZZC A;  5FKL A;  4M3E A;  1SVO A;  4HX8 A;  3K9T A;  2PXP A;  1HOM A;  1Y0N A;  3RYP A;  1QU3 A;  4EK9 A;  3MMY B;  1W5C C;  2ME0 A;  2IVG A;  3QP6 A;  3OYC A;  1ZZ7 A;  3BZ6 A;  4HLY A;  4FCY A;  3QOP A;  3I3L A;  2Z16 A;  1WJ5 A;  4OAZ A;  3HG9 A;  2XRL A;  4A2U A;  4BJ5 C;  4Z58 A;  1QQI A;  2L3D A;  3PIP F;  3K69 A;  4CSW A;  3L2R A;  4G6T B;  4MO7 A;  4FN3 A;  2WB1 A;  3JCU C;  5JVT A;  2V1N A;  2PUE A;  3HUG A;  5D4S A;  1QZZ A;  5CVI A;  2QKM B;  2ETH A;  3F6W A;  5GAH J;  3DFG A;  2G7U A;  4HZF A;  3K7A J;  4NBQ A;  4A93 J;  4NDW A;  3EYI A;  1TNT A;  4YFX F;  5CQG A;  1J59 A;  1YE9 A;  5HLH A;  5DUK A;  2W24 A;  5K7Z A;  2I8D A;  2KZV A;  3K6G A;  2C6Y A;  2GWR A;  3FF5 A;  4YG1 A;  4ENJ A;  3FXO A;  4R8H A;  3UR3 C;  3NDB B;  1FSE A;  3T8T A;  1RC9 A;  2DA1 A;  1ZAO A;  3ONQ A;  1B9M A;  2L54 A;  4ZYE A;  2CUZ A;  5K5Q A;  1N77 A;  1HW1 A;  2XHK A;  4C3H J;  1K79 A;  5KCM A;  2ZXI A;  3ZHM A;  2CQQ A;  3OL4 A;  2HQ5 A;  3HHG A;  2VOD A;  3UWP A;  1T56 A;  3E5Q A;  2BY2 A;  1HKT A;  5J4V A;  3WTT C;  2E71 A;  2P5K A;  1SC7 A;  2M7A A;  4P55 A;  5JLX A;  1VQL I;  5LRS A;  3HIF A;  3RCO A;  2ELJ A;  3U1K A;  2FA5 A;  2HQA A;  2XGX A;  4BY1 J;  4ENM A;  5TIS C;  3H0G J;  3TKY A;  4A3E J;  2FQ3 A;  3DKW A;  2DYR H;  4IEJ A;  1WIZ A;  4IHW A;  4Q2J A;  1S3J A;  3KYD B;  5FKN A;  3DBL B;  3PIO F;  4HOB A;  4NC8 A;  3BQY A;  1UXC A;  3OS0 A;  4ZJZ A;  1MJB A;  2L7F P;  1OCP A;  3BDD A;  2X6Y A;  4Y52 J;  3CDH A;  1L3L A;  1S7A A;  5B5E C;  2CV1 A;  4ER0 A;  2GXG A;  2DA6 A;  1I6H J;  4HX7 A;  3FWE A;  5JLW A;  3S1M J;  3QPT A;  3R60 A;  4RAF A;  1SVM A;  5DCF A;  2XAH A;  3TO7 A;  4BQQ A;  2QEN A;  2DQR A;  1XN7 A;  2JPC A;  2DI3 A;  1K78 B;  3LMM A;  1VFC A;  1YJW I;  1P6R A;  2GM4 A;  2OTJ I;  2F4I A;  3KXA A;  1X57 A;  4ZZL A;  3GTK J;  4HAM A;  2JVL A;  3UKG A;  1BDI A;  2RKH A;  1JKO C;  2E35 A;  2KDO A;  1KGS A;  3F0C A;  4XOT A;  2IUO A;  2V7F A;  3DXJ F;  1Z21 A;  3NEU A;  2PXB A;  1XX5 A;  4GFB A;  2F4M B;  2Z3Y A;  4CCK A;  1WQ2 A;  1F43 A;  1Y7Y A;  3FBI B;  3I56 I;  1JXS A;  2G0E A;  4MCT A;  2LKP A;  1VQN I;  1HQC A;  4P1W A;  2XKO A;  1D1C A;  2QLZ A;  2QBY A;  1R1T A;  3IAM 2;  2W25 A;  4FAS D;  3L2C A;  3FK7 A;  3W2W A;  1Z7L A;  3GN5 A;  4FTH A;  3SZP A;  2L9S A;  3PSF A;  2ZNZ A;  2CWE A;  3G1O A;  3QP5 A;  2VJI A;  4WF2 A;  4XMY A;  5CJ9 A;  3V8L A;  1R4M B;  3F8C A;  3SCH A;  3ISP A;  2Y75 A;  3S2W A;  1V55 H;  1W7P B;  3WG9 A;  2AS5 F;  3HUG B;  2H09 A;  1DPU A;  1N75 A;  4MQV A;  1AOY A;  5ILU A;  2R93 J;  4A0X A;  3FXK A;  5GAG i;  1W7P A;  2DMP A;  3ZGK A;  3VPR A;  1S7O A;  2DLL A;  1X1A A;  4FX0 A;  2WC2 A;  3P9C A;  2X9D A;  4PZJ A;  2PMZ A;  1YTY A;  1PRA A;  1GUU A;  2VQG A;  2JQ7 A;  4PJM A;  2H8W A;  4A3K J;  1R49 A;  3CCL I;  3FKJ A;  3R4K A;  4JQD A;  1AKH A;  2LKX A;  3VEP A;  5DTM A;  3DTI A;  3J80 K;  2E1N A;  1YX3 A;  2WB1 N;  1JHH A;  5F08 A;  3WOD F;  3OMY A;  1VQ7 I;  2LYP A;  1UG0 A;  1BR4 A;  2P5L C;  4BH9 A;  2CW8 A;  2A07 F;  5TGT A;  9ANT A;  3CME I;  4EJT A;  2XI8 A;  2O5R A;  2EIM H;  2L49 A;  4MCX A;  3GTM J;  2KQR A;  3K1M A;  1ENH A;  3Q9V A;  1RES A;  2J7U A;  3LAJ A;  4LK0 F;  4WXD A;  2CUE A;  1A5J A;  2XB0 X;  4OIR F;  5IP7 J;  5DCM A;  1ZRD A;  3H3Z A;  1R1V A;  4N4O B;  1D5Y A;  3OIO A;  4E70 A;  4J1X A;  4MLO A;  1OCZ H;  2HKX A;  2HQN A;  1BR1 A;  3LST A;  3NXH A;  3QOX A;  2K9L A;  3JRG A;  2BGC A;  2NOJ B;  1BN5 A;  3ZQQ A;  2LP0 A;  3JAM K;  3O9X A;  4XIC A;  3BCA A;  4DGW B;  2GRL A;  4CA0 A;  2ZXH A;  2L2O A;  4XOR A;  5DS9 A;  1YIT I;  3V42 A;  4CO8 A;  3MN2 A;  4ZTF A;  2XIU A;  4CCO A;  2WAD A;  1VQM I;  5E3N A;  3P9I A;  3KCC A;  2XV4 S;  3GFL A;  1XMX A;  4ZC3 A;  1TQM A;  2M3A A;  1SAX A;  1Z67 A;  3Q5F A;  4JK1 X;  4AM3 A;  2BE5 F;  1K83 J;  4KN4 X;  3C18 A;  3WTZ A;  3PFY A;  1QQB A;  1VTN C;  2WV1 A;  2ZXW H;  1N78 A;  1WCM J;  1POU A;  3EUS A;  4J19 A;  2EWN A;  5IP6 A;  3LWF A;  2ZME C;  2OZU A;  4A3I J;  2CYY A;  1K78 A;  1BW6 A;  3M9A A;  4D7N A;  2FQ4 A;  2COM A;  3ZCO A;  2PPX A;  2P6S A;  1ZRF A;  1Y6I A;  2DMQ A;  3KP6 A;  4XNF A;  1NHA A;  3FIW A;  4E4H A;  2HI3 A;  2BY0 A;  3BTL A;  2E1O A;  2IRF G;  2DJN A;  4E7K A;  3TOA A;  3BPV A;  2QSG X;  4AVP A;  3IH3 A;  4MFE A;  4OBM A;  3MEX A;  4RGS A;  2JA6 J;  1HDP A;  2QYO A;  4RGX A;  2OQR A;  4JQF A;  3CC7 I;  2WAE A;  4M3B A;  4XR6 A;  2PEX A;  3T5X A;  4ABZ A;  3OWT A;  4KNY A;  3CP2 A;  4NDL A;  3CQZ J;  4HA8 A;  5L3B A;  2XB5 A;  2RVC A;  4EQQ A;  3QYB A;  3OYB A;  1T39 A;  1WZ2 A;  2HCS A;  4G6Q A;  1XCV A;  1N25 A;  5D5U B;  1YW9 A;  2BV6 A;  2E5N A;  1PUF B;  1KQ8 A;  1ZR4 A;  1FTT A;  3L7W A;  2EK5 A;  4EMS A;  5LHG A;  4BAC A;  4PJ0 C;  4YG2 F;  1FSH A;  2D45 A;  3EUA A;  2N8G A;  3GFI A;  5FFZ A;  5IPA A;  1W0U A;  5AIP A;  2O6G E;  1NG7 A;  1YRN A;  2L01 A;  2R92 J;  4GQM A;  1CJG A;  3OYM A;  4DOZ A;  2XAS A;  2IU7 A;  2E1M C;  2K4B A;  1ZUG A;  4F3Q A;  5DUI A;  2M0C A;  3HXL A;  3COA C;  4A3M J;  1TWH J;  1I3A A;  3R6S A;  4C2U A;  4DZJ A;  4QPO A;  2JUC A;  1E3P A;  2EH3 A;  3I9V 2;  2LVS A;  5DD8 A;  4C30 A;  3T8R A;  3GZ6 A;  1VQO I;  4BDZ A;  3E6D A;  1DUL A;  5EGO A;  2PUB A;  3R1F A;  3TGN A;  1AU7 A;  1E3H A;  2JVG A;  1MNM C;  1FNN A;  1X2M A;  1RR7 A;  1FMW A;  1AHD P;  1FWZ A;  1M1E B;  2X1C A;  2MQK A;  3BG9 A;  3G1L A;  3AG4 H;  1IUY A;  3KX2 A;  1NW3 A;  4XLH A;  2EA2 A;  2VQH A;  1MJ9 A;  2BW3 A;  4HF2 A;  2EIK H;  2MD0 A;  1I1S A;  3I59 A;  4ETS A;  5FGM A;  2KZG A;  4XL9 A;  3A2K A;  1ZKG A;  1RPW A;  2YX4 A;  3FM5 A;  1MMA A;  3HPH A;  2XC7 A;  4IL6 C;  1OR7 C;  1QP0 A;  1POG A;  4XKV A;  1H0M A;  2NS7 A;  1LE8 A;  2AQF A;  2HYG D;  3U3W A;  1HKS A;  1BOB A;  1MMN A;  2ME6 A;  2HPI A;  2V26 A;  4I7H A;  4F92 B;  1Y39 A;  2GZU A;  4DYR A;  4XM3 A;  2PQ8 A;  1YJN I;  3QOD A;  2H94 A;  1ZYR F;  1B1B A;  2LYR A;  3D0S A;  4EJU A;  1QZY A;  2CG4 A;  3O8H A;  4I2O A;  1FOY A;  3GFJ A;  5H6R A;  2IGO A;  1CQT A;  3KZI C;  5HLT A;  2STW A;  5CVU A;  1QO0 D;  3P9K A;  4PK4 A;  4A69 C;  4IQ4 A;  4LIT A;  2O9L A;  4BJ6 C;  5LLQ A;  1U5T B;  4EVI A;  1A6I A;  3R61 A;  3LSP A;  4LGW A;  2BHZ A;  1SFU A;  5CVJ A;  2HQR A;  2DOE A;  2QCO A;  3KPH A;  4FBI A;  3OQO A;  2P5V A;  1LKX A;  3J7Z I;  4KJZ A;  2FSW A;  1H89 C;  4DNC A;  3CMA I;  4XOP A;  1PJR A;  2FJ1 A;  1IUF A;  4AIH A;  2Z1D A;  1KYZ A;  1W5S A;  5DCM B;  3KP3 A;  1QNT A;  2DK5 A;  4G9Y A;  3C7J A;  5E8I A;  1W36 C;  5M5Y J;  1AWC A;  2IXS A;  5IYB J;  1SFK A;  4CIC A;  4RB1 A;  2Y9Z A;  5K5R A;  3QYE A;  4E7Z A;  4AC0 A;  1G3S A;  1ONV A;  5DDG A;  3RPQ A;  3JRI A;  4C2T A;  1OYW A;  4BBR J;  1R4N B;  2HTJ A;  1TWC J;  5CVR A;  1JT0 A;  4O6J A;  1HXD A;  1PUF A;  2ODR D;  4I02 A;  5E1X A;  2PBI A;  2O49 A;  3ZQG A;  3OV8 A;  2DU9 A;  4YG7 B;  3A02 A;  2DA3 A;  2IGK A;  1G3W A;  2NOG A;  1QGP A;  2DMN A;  3ZQ7 A;  4IHY A;  4KT5 C;  1XGS A;  2EIL H;  4BEH A;  1IAW A;  1R63 A;  2OU2 A;  3R0J A;  2IA0 A;  3JRH A;  3GX4 X;  4CUG A;  5JHU A;  4I09 A;  3IRQ A;  2EV6 A;  3HSF A;  2PXD A;  4DE8 A;  1QHG A;  1JI8 A;  2UV1 A;  3HKZ A;  4D9J A;  1BC8 C;  4X0G A;  1F9N A;  3HGG A;  5J3L A;  2R7F A;  4DBQ A;  4ER6 A;  2F2E A;  3C2H A;  4M73 A;  3B73 A;  2CMP A;  3KEO A;  4WCG A;  3O2P E;  2DFH A;  4I0A A;  3ZQI A;  3BT9 A;  2VUM J;  1U2Z A;  4HDU A;  3I4P A;  2W82 A;  1IN8 A;  3CEC A;  4LB6 B;  3TEP A;  2IW5 A;  1Z0X A;  3DLA A;  3ML6 A;  1LQC A;  1SFX A;  2VL8 A;  4ER3 A;  2K40 A;  1JUP A;  3I5U A;  3OR1 C;  4Z2Y A;  4EGY A;  2HWV A;  5JHF A;  4HST A;  2EFN A;  4BJT A;  5FLM J;  2WIU B;  2IAI A;  4OOI A;  3L2Q A;  1FTZ A;  3M8J A;  4XSZ F;  3GN5 B;  4ZYG A;  4S05 A;  1GVJ A;  2FOW A;  2K9Q A;  3BJO A;  3MEJ A;  4M72 A;  4B44 A;  4BE1 A;  1GVD A;  3CJN A;  2X6O A;  3LA7 A;  3M7G A;  3OYI A;  2A6H F;  3OS1 A;  2W48 A;  3FMS A;  4BXF A;  3CCV I;  1VZ0 A;  5BPI A;  2V6E A;  3GLX A;  2LD5 A;  1Y1V J;  3SDG A;  4EEF G;  2M2E A;  1YIO A;  3TP3 A;  2AXU A;  1J09 A;  3GXO A;  3K4M A;  2YPR A;  3G2B A;  1E2X A;  2KDZ A;  1JGS A;  2DDA A;  3OWQ A;  1BDH A;  2KLO A;  3DLL F;  2B9S A;  1UHW A;  4V2G A;  1X4O A;  1D3Y A;  4NQW A;  4DE9 A;  2OPT A;  3QYX A;  4Y13 A;  4D7M A;  4IA8 A;  4HLX A;  3E97 A;  3HM5 A;  1R5I D;  3BR5 A;  3QWL A;  4WK8 F;  4A5N A;  1HDD C;  2JJ7 A;  3A0H C;  4J01 A;  3D5R C;  4L9T A;  2BYV E;  3HB9 A;  1Y9Q A;  2DA4 A;  4I01 A;  4CZZ A;  2YSR A;  1A6Q A;  1NER A;  4P9U A;  3J81 K;  2FU4 A;  2I10 A;  1OIS A;  5C3E J;  5BOX A;  1ZZ9 A;  2NNN A;  2LYS A;  3WGI A;  3I58 A;  2LYQ A;  4G8X A;  3JRC A;  3S14 J;  2TRT A;  2Y30 A;  4BHP A;  4BDY A;  3G3Z A;  2LCV A;  1VQ9 I;  1G6N A;  3GZC A;  5GAG J;  3ZMD A;  3ZXS A;  2B7E A;  1SMT A;  3FHN A;  3WGG A;  2D1H A;  3AKZ A;  2NVX J;  4C3J J;  1JT6 A;  1OCR H;  2XAG A;  4XON A;  5E3M A;  1RZ4 A;  4HNT A;  2OUM A;  4BAY A;  2JQE A;  3KZ3 A;  3MZY A;  2PI0 A;  3H5N A;  1WGX A;  4LD5 A;  5LEK A;  2HDC A;  3ZN0 A;  4BE0 A;  1W0T A;  2MFZ A;  1T38 A;  5HVQ C;  3L9F A;  1MSE C;  2CUF A;  5A2Q K;  2JCG A;  2EZH A;  4AU7 A;  2Y9Y A;  1U5T A;  4FE4 A;  3LA2 A;  4KIC A;  4X4C A;  3BZC A;  1ETX A;  1V54 H;  2LYC A;  2PJR B;  1R7J A;  4FQG A;  3ME5 A;  2EV0 A;  2MG4 A;  2V1D A;  3BR1 A;  3KEQ A;  3TO6 A;  4BYY A;  3VOD A;  1U78 A;  2LC2 A;  1R69 A;  3BLY A;  1JKR C;  1F4K A;  1JHF A;  3ECH A;  2A5Y B;  2K5C A;  4AD9 A;  2OJE D;  3S3O A;  3AAF A;  4L9N A;  3DNV B;  1UXD A;  3DQV C;  1YFH A;  2DTR A;  5EDN A;  3VSK A;  4GRI A;  2PLY A;  2BNM A;  2PMH A;  1RRJ A;  1ULY A;  4O3M A;  2I5U A;  3F3X A;  1WJE A;  2EZL A;  3SCF A;  2TDX A;  2DTZ A;  2XXQ A;  3BR2 A;  2LG4 A;  2LF8 A;  2O38 A;  1Y56 A;  2K02 A;  4LG3 A;  3F9K A;  2HEO A;  1S6L A;  2HU9 A;  2P4W A;  2MD5 A;  2VC0 A;  1GT0 C;  4KDP A;  2JWT A;  4IKF A;  2L4A A;  1VF9 A;  2JSC A;  1OPC A;  4LG0 A;  1SD4 A;  1G59 A;  4AYB A;  4M74 A;  2IA2 A;  4EM0 B;  3HRS A;  4P96 A;  2WV0 A;  4RB3 C;  3H3V K;  5E3L A;  4LG0 B;  1QPI A;  2KIS A;  1MDM B;  1D1A A;  3GTL J;  4G7H F;  2VJ5 A;  1YIJ I;  2EPF A;  1YJ9 I;  2XUB A;  2ZJ2 A;  1S72 I;  1LCD A;  3CF2 A;  5IOY A;  4LOC A;  1WSU A;  1QP4 A;  4ZYH A;  2K27 A;  1FYL A;  1S7E A;  2VBY A;  1GHC A;  4NHJ A;  4M6V A;  5FD5 A;  1PP8 F;  1EH6 A;  3ZN1 A;  1ZH5 A;  2BHY A;  2E1C A;  1VQ5 I;  4DBR A;  2ZFU A;  5FFX A;  2FJR A;  5EF6 A;  3AG1 H;  4WXH A;  1ZQ3 P;  2IS4 A;  4JX5 A;  2HVR A;  3H1C A;  4A6E A;  1JUM A;  2VJJ A;  4HW0 A;  2L8N A;  4MTE A;  2X6X A;  2DT7 B;  4N4N B;  4UB8 C;  4MGR A;  3BCB A;  1EJ9 A;  1JH9 A;  2LYK A;  4S04 A;  2HDW A;  3PNV A;  3E6M A;  5FO5 A;  3ERE D;  1P4A A;  1RZS A;  3BDN A;  2LOO A;  1UB9 A;  2QM3 A;  4L0Y B;  3M9L A;  2ZC2 A;  4Z59 A;  2FRH A;  2IS2 A;  3QFI A;  2MH2 A;  1ZGJ A;  2R5Z B;  1G2H A;  2LFB A;  5JUW A;  3JXB C;  1O3Q A;  2HFH A;  5D5V B;  2R7V A;  1FJL A;  1I27 A;  3HOT A;  2MEZ A;  5JR3 A;  3I55 I;  2ZNY A;  5J6X A;  1BA5 A;  1XD7 A;  3K4J A;  2J5O A;  1BJA A;  3AL0 B;  3G7D A;  4LJZ F;  3L2V A;  1WH7 A;  3CCQ I;  2VI6 A;  1JKQ C;  2CSO A;  4OMZ A;  2PXK A;  3QYF A;  3CCM I;  3OSF A;  3S2H J;  2ZXJ A;  1DGR M;  3OYD A;  5ICF A;  4AIJ A;  1XTA A;  2KJC A;  4R1H A;  2KEJ A;  3S3N A;  1IJW C;  2PUG A;  2YR2 A;  2HSG A;  3BR3 A;  3FZV A;  4XSX F;  3W2V A;  1WH8 A;  2O4A A;  2VOO A;  3T0Y A;  2PUD A;  3I54 A;  2Y0S N;  4PU3 C;  3Q9S A;  1JGG A;  2DMT A;  2D1V A;  5DEQ A;  2JUG A;  2R5Y B;  1A36 A;  2OA4 A;  2XGE A;  3ESW B;  1R36 A;  2EB7 A;  3GTJ J;  3PE5 A;  5HOD A;  2ICT A;  2HVS A;  1Z05 A;  1IGN A;  4X4H A;  2DOF A;  3JXD L;  3VYR B;  2VOP A;  2GXB A;  4QPQ A;  4L0Z B;  1OMI A;  2YUS A;  3JSO A;  2CGP A;  5F1R A;  3GZ5 A;  2VBW A;  4G6D A;  4F93 B;  2W1O A;  3BTJ A;  5JFR A;  2A05 A;  1UTX A;  3K70 D;  1BOA A;  3HZJ A;  4G12 A;  4II2 A;  2GBY A;  2RNG A;  1FOX A;  1B4A A;  5F0H A;  3ZMS A;  5ILV A;  1U9O A;  4IF4 A;  2JRM A;  3GME A;  2R7R A;  1FMV A;  1CF7 A;  2DT6 A;  2FNP A;  2OTL I;  3GZD C;  3HOU J;  1AKH B;  3HGY A;  4A3D J;  2YBD A;  5DTR A;  3BS3 A;  2ELK A;  2R4G A;  3B02 A;  2DDB A;  3EUH A;  4AUX A;  2L7Z A;  4KMF A;  3TRB A;  2IGM A;  4BXX J;  1NTC A;  4KFC A;  5EJC A;  4D5F A;  3WGH A;  4KIS A;  1T6S A;  2VXZ A;  5EGO B;  4A6D A;  1ZTR A;  1KA8 A;  3E7L A;  3LSR A;  1ZRE A;  1WH6 A;  2VE8 A;  4HBL A;  2DPU A;  3CP8 A;  2V1U A;  1E17 A;  2NVQ J;  1A31 A;  4PU7 A;  2GOM A;  1ETK A;  2M8E A;  3HEF A;  3OKZ A;  3LSH A;  3G73 A;  3RKW A;  3RQI A;  4E7L A;  2NS8 A;  4PUS A;  5FB2 A;  5HNF A;  3RPU D;  1JTX A;  1WWX A;  2V9V A;  1I5Z A;  2KIF A;  2ZCW A;  3NZL A;  3RIR A;  3ZMV A;  3NRO A;  2QQB A;  1B72 B;  2MAB A;  4Y3O A;  4C9Y A;  5K7H A;  1ODD A;  3JRF A;  2XGC A;  4ER5 A;  1KQ9 A;  3AL0 C;  1TT5 B;  2CQ7 A;  4XQF A;  1RUO A;  2GZW A;  1OCC H;  1P4X A;  1ZHF A;  5HS7 A;  3ECO A;  1ZVV A;  4RAZ A;  2OD5 A;  3U21 A;  2MLK A;  4JOM A;  2P7C B;  1UST A;  4RLQ A;  2OR1 L;  3SCG A;  2K3F A;  4RBO A;  4HV5 A;  3EQL F;  3UNG C;  3OS2 A;  3WU2 C;  4B09 A;  4BY7 J;  1Z77 A;  3ZRG A;  2COB A;  4ZYA A;  2E1M B;  2FXA A;  2P8T A;  3QRF F;  1ZS4 A;  4X6A J;  1TWA J;  4F7Z A;  1XDU A;  1QVT A;  2DOA A;  3AG3 H;  3RZD J;  2CV2 A;  1FOW A;  2MA3 A;  1J5Y A;  3BY6 A;  1GXP A;  4KIG A;  2JA7 J;  3BR6 A;  1IF1 A;  1T0F A;  1UHM A;  4I0B A;  1OCO H;  4KMU X;  5A2Q Z;  2M8G X;  1ETQ A;  4UUS B;  4J00 A;  2X1D A;  5J40 A;  2DA5 A;  3VWB A;  5LEJ A;  5CKT A;  1ETW A;  1VQ6 I;  4W97 A;  4FE7 A;  3I4N J;  1YHQ I;  3F8N A;  1Z6T A;  2WAQ A;  4YIR X;  3HRT A;  5F1J A;  1ACI A;  1PVE A;  3HTS B;  1OLT A;  1R22 A;  1V5F A;  1R1U A;  3KIO A;  2PN6 A;  4XRS G;  5FJ8 J;  1D8J A;  1FC3 A;  3IKV A;  2E2H J;  5A7L A;  1OFC X;  2VXD A;  3OSG A;  2JTV A;  1JE8 A;  1ZZ8 A;  1PRV A;  1JWL A;  2GIZ A;  4RB0 A;  1Y1W J;  2ZB9 A;  1LEB A;  2F5E A;  4EZI A;  4HF1 A;  1ZR2 A;  3HOZ J;  3RJP A;  2X4H A;  3K1P A;  2KKO A;  3ZP5 A;  5GPC A;  2LMD A;  5M3M J;  2VJ4 A;  2IVB A;  4A3G J;  3ASO H;  3D5S C;  5E79 C;  5D8K B;  1LDD A;  1RZR D;  1JUS A;  4PJN A;  4IJA A;  2AW6 A;  3S8Q A;  3EYY A;  1L1M A;  2HIN A;  2OCE A;  1LVK A;  4RM3 A;  4AID A;  3S17 J;  1U8B A;  3H5R A;  1OCT C;  1ADR A;  3CTA A;  1MSF C;  2EA4 A;  3GYH X;  3FXJ A;  4FT8 A;  3RDI A;  1OSL A;  1WI9 A;  3C1D A;  2RN7 A;  2CQN A;  2K9S A;  3PFI A;  3WTV C;  1PYV A;  2PUC A;  1ZEL A;  3O3K A;  4WX9 A;  3CMM A;  2V6C A;  5K7F A;  4X4B A;  2H6B A;  4X4D A;  2HOT A;  3IWZ A;  1X19 A;  3F52 A;  3QU6 A;  2QZ8 A;  3SDB A;  3Q3S A;  1V5E A;  3OY9 A;  1SD7 A;  1ZLJ A;  2OC6 A;  2HXI A;  1BJZ A;  1MBK A;  3IUO A;  3GZD A;  1ZG3 A;  2FD5 A;  1P2F A;  4DZP A;  1ZZB A;  2ID3 A;  3FXR A;  1T8I A;  3BC8 A;  5LBQ A;  3D1N I;  2PXU A;  1YLF A;  4GYI A;  3S15 J;  2BNO A;  5F27 A;  2BEO A;  2CH0 A;  2P7V B;  1W5T A;  1WHU A;  2J5P A;  3HYI A;  4GGG A;  2FML A;  4MQ9 F;  2R5Z A;  2A6E F;  1MND A;  2Y0M A;  4Q5S F;  2KIM A;  3J7Y J;  1WRJ A;  3BTI A;  4HX4 A;  5F64 A;  3ULQ B;  4O8B A;  1AA7 A;  3TBI A;  1WJB A;  2PG4 A;  1YS6 A;  2NNY A;  5E20 A;  1IZ1 A;  2L7M P;  4FHT A;  1EA3 A;  4PGG A;  3JRA A;  1J9I A;  3REO A;  5DRT A;  1KQ0 A;  1K6O A;  5EYR A;  1XC5 A;  1ZPQ A;  1FIP A;  2GA1 A;  1P9Q C;  3DP7 A;  3S1N J;  5J1Y A;  3HPG A;  3BOQ A;  3JSP A;  1WH5 A;  1MBE A;  3H35 A;  1G8X A;  5TJJ A;  5E1Z B;  1G3T A;  3DM5 A;  4WVL A;  1LLI A;  5GAH i;  3BJ6 A;  3Q0U A;  4HV6 A;  4HQE A;  3P5J A;  1QPM A;  5FRO A;  1SAU A;  3SQN A;  3V8J A;  5C4X J;  4G7O F;  2BNN A;  3LNQ A;  1ZGA A;  2ISY A;  2QQ9 A;  3V7R A;  5IOZ A;  2EWT A;  5E17 F;  2FMY A;  4QWQ A;  3QQ6 A;  4ZDP A;  1NG6 A;  3O6B B;  4B3A A;  3DBR B;  4JYK A;  1IRG A;  2AXZ A;  3ZQC A;  4B48 A;  1MGT A;  2KZ8 A;  3BG6 A;  3W6V A;  3M4O J;  4X4I A;  4P9F A;  3CF5 F;  2F4O B;  3FKI J;  3GO5 A;  3F8B A;  4CYD A;  3F51 A;  3GUD A;  3KP4 A;  4Y42 A;  3B7H A;  1MBF A;  3CJR B;  4NC7 A;  1A04 A;  4A3B J;  1QZX A;  5FKK A;  5HLI A;  4RB2 C;  3J80 Z;  3TDZ C;  3OYK A;  5DRY A;  2XF6 A;  1U5T C;  3ZQL A;  2D2W A;  1LJ9 A;  2E19 A;  5CVV A;  2XGD A;  4CCJ A;  1FP2 A;  1DPR A;  2OBP A;  2UXN A;  1J0R A;  2STT A;  4XKW A;  4U7B A;  3KJX A;  2L9V A;  2VN2 A;  3JRD A;  1MMD A;  1OJL A;  3N4M A;  5ILS A;  2K85 A;  1XSD A;  2NYX A;  5ICG A;  4FX4 A;  3A03 A;  1LMB 3;  4CYC A;  3HRM A;  2FBK A;  4Z5C A;  2XF7 A;  2VE9 A;  1PUE E;  1ZAR A;  3K2A A;  2HPM A;  1B8I B;  3LSJ A;  3HRU A;  4UVC A;  3S2D J;  2KPM A;  3W6J B;  1RI7 A;  2JT1 A;  3C2B A;  4QTR A;  1QQA A;  5HOO A;  2IEK A;  3PNY A;  2NAZ A;  3V8K A;  3HC7 A;  4B1R A;  1DW9 A;  4F55 A;  4QIW N;  4Y15 A;  3ZR8 X;  1DQU A;  4KT6 A;  2K3P A;  4HQM A;  1XPX A;  4IOA F;  1W36 D;  4RAG A;  1HSJ A;  1SMY F;  1IN6 A;  1ORK A;  2DK8 A;  4LLL A;  1R00 A;  4NC6 A;  4RGR A;  5M5W J;  4AIK A;  1GDT A;  2W85 A;  2K4J A;  3VOE A;  3F8M A;  1NEQ A;  3QOW A;  1WJF A;  2EFW A;  2A61 A;  2PXQ A;  1WKM A;  1GLN A;  4I6Z A;  3G1M A;  2BXZ A;  4XLC A;  2GXA A;  2DA7 A;  1OQY A;  5J4Y A;  5JVG F;  4UNO A;  3HTU A;  2DA2 A;  4ESB A;  5DM7 F;  4BQA A;  2PUA A;  1DDN A;  2V9K A;  3SFZ A;  3UFD A;  3HDD A;  3FYA A;  1X58 A;  2E2J J;  4YIF A;  5HDK A;  3QQA A;  4NUB A;  2G7H A;  1TBX A;  4IOC F;  4I6R A;  3KL4 A;  3M07 A;  1X2L A;  1EKE A;  1IDY A;  2FUG 2;  1H8A C;  2RDP A;  2R63 A;  5ED4 A;  3G5G A;  3PQJ A;  2UUZ A;  4GO1 A;  1FY7 A;  2DO7 A;  4II3 A;  2LKS A;  2YS9 A;  4GXO A;  1IXS B;  2IJL A;  3IHU A;  4GYG A;  1LPQ A;  2AXT C;  3FMR A;  3VDX A;  1BBY A;  2VB6 A;  3HL2 A;  2ZJP F;  4IWR A;  1IDZ A;  1X4P A;  3BQZ A;  4UUT A;  1Y0U A;  2A68 F;  2ADU A;  2VKV A;  2PIJ A;  1F36 A;  3A0B C;  3IC7 A;  2JA8 J;  2UZK A;  2DN0 A;  3PUB A;  1ZLK A;  1PP7 U;  4ZTJ A;  2GRM A;  3BG7 A;  5ICC A;  3CJQ B;  3HOS A;  1Z7U A;  1J75 A;  4WWC A;  3BG3 A;  1STZ A;  1OYY A;  4BHC A;  4BXU A;  4Z5D A;  3RKX A;  5FRN A;  3VK0 A;  4DQ2 A;  2NVT J;  1XSX A;  3SHF A;  2A3S A;  5DV5 A;  3WTX C;  2XKP A;  4BBS J;  5F0C A;  2HCN A;  1YW7 A;  4YFK F;  1LNW A;  5J47 A;  2Z33 A;  2DT5 A;  4E7I A;  3H5T A;  2ZSI B;  3CDI A;  1X3Z B;  1Q1V A;  3CUQ C;  4EM2 A;  2E60 A;  2PUF A;  3LSM A;  4UUS A;  4XK4 A;  4YAR A;  3SR4 A;  2Y0S A;  1HW5 A;  5KNL A;  2GQQ A;  5E1W A;  3NWS A;  3SZG A;  5B66 C;  1G4D A;  1QZE A;  4RDU A;  3F6V A;  2Y69 H;  4M9X A;  4HF0 A;  3J7A Y;  4XID A;  2VQL A;  1R71 A;  2MSY A;  1U6G A;  2F48 A;  4Y17 A;  5IYC J;  4OB4 A;  3QF3 A;  4ANJ A;  3N05 A;  4WXC A;  1SD5 A;  5F0F A;  1O3R A;  1SQ8 A;  3L2W A;  5IYD J;  2EF8 A;  4Z5H A;  5GP9 A;  1U0J A;  3D5L A;  2NXN B;  1DU0 A;  2QA4 I;  1RUN A;  3MKL A;  1ETO A;  3QWG A;  3MWM A;  4PFP A;  1WJC A;  3QPH A;  3OYE A;  3G4S I;  1HCR A;  3IL2 A;  1X3W B;  3M3Y J;  4HSR A;  4DW6 A;  3RPU A;  3NAR A;  2CW7 A;  1EFA A;  5IY5 H;  1T0F C;  1VQ4 I;  4PU8 A;  2W7N A;  2UWM A;  1RNL A;  1TQP A;  1IRX A;  1MH4 A;  4LMY A;  1BC7 C;  2RC4 A;  2KIU A;  2P81 A;  2KRC A;  4B4C A;  3LAP A;  3V4G A;  5L3D A;  4XLN F;  3F21 A;  3KP7 A;  2IPQ X;  3K4K A;  2MGQ A;  2RV8 A;  3TW6 A;  5H2F C;  1L0O C;  1IRF A;  5HLG A;  2LLV A;  2KP6 A;  2BZT A;  3GUU A;  1DUX C;  2R7Q A;  2O8X A;  3OQM A;  1FOK A;  4AYB N;  4CYC B;  2D5V A;  2WTE A;  3NAU A;  3CUQ B;  2CRO A;  4ESF A;  5D8L B;  1RIO A;  4IZZ A;  2CQX A;  2FBH A;  2H27 A;  2WY8 Q;  2VC1 A;  4KUM A;  3HOW J;  2L7K A;  3CZ6 A;  2EJR A;  2MLG A;  4E7S A;  4A0Z A;  4CXF A;  2FE3 A;  3TED A;  3GLL A;  2IV1 A;  2HFZ A;  2B63 J;  2LSO A;  3OOU A;  5CYV A;  4BNC A;  2V1X A;  4UY8 I;  2CQK A;  2PXE A;  3H3U A;  4BQO A;  2LDU A;  3NWT A;  1DGW Y;  4U7D A;  4DYC A;  3K10 A;  2FFH A;  4GHJ A;  2ICP A;  2WBM A;  2ZO4 A;  3CCJ I;  2VEO A;  1P7I A;  3GW2 A;  3H36 A;  3JRB A;  1BM9 A;  5EEG A;  3V7S A;  2YU9 J;  3J81 Z;  1MH3 A;  3TL4 X;  1BIA A;  1B9N A;  3LFK A;  2M30 A;  1EF4 A;  4ZYD A;  2DCE A;  1KYW A;  3IV5 A;  3QOE A;  3OIQ A;  4UHT A;  2E36 A;  2VAS A;  1MJA A;  4BKX A;  2RQP A;  4EQZ A;  1Z3X A;  3CRO L;  3GVA A;  5D5W B;  2X1E A;  2GOX B;  3WTU C;  1T2K A;  1VI0 A;  3LFU A;  1QRY A;  4YFN F;  2LY2 A;  3CMY A;  2VKD A;  1Z9C A;  2KL4 A;  2XXP A;  2EFQ A;  5BS6 A;  1W7P D;  4QSH A;  3F22 A;  3CJT B;  2HR3 A;  3KE2 A;  4A3J J;  2AWI A;  1O7F A;  2PMZ N;  2VBX A;  3KP2 A;  4Y33 A;  4LK1 F;  3E5X A;  5LRR A;  4HRI A;  2RRE A;  4ER7 A;  2AQE A;  2QF7 A;  2JVH A;  3L00 A;  1Y8R B;  3JRE A;  5HDN A;  2FF4 A;  2Z9O A;  3A4C A;  1IV8 A;  1FLI A;  4I6T A;  4L9J A;  1LDK B;  4W1U A;  2WUS R;  1LQ1 A;  2EV5 A;  4E7H A;  5DSX A;  5K5O A;  3X2Q H;  2IT0 A;  1FPQ A;  1ZK8 A;  4X1E A;  3G6E I;  4I98 B;  2XRN A;  1TT0 A;  2J7W A;  3E1S A;  5GAE J;  3IAS 2;  2EQR A;  2JSP A;  3LQR A;  3WHB A;  2IA1 A;  3ABU A;  2IS6 A;  2PXT A;  4PFO A;  3M8F A;  1J2X A;  4JCY A;  1QP7 A;  3H0D A;  5LFA A;  4OIN F;  2QGU A;  3DF8 A;  2A6C A;  2KPJ A;  3RQ4 A;  5FLX K;  3LQX A;  3K1N A;  2LR8 A;  2DMU A;  1PNR A;  2KT0 A;  4PU4 C;  4HRA A;  2W4S A;  2ACJ A;  1WPK A;  3WTS C;  1FBU A;  5DTQ A;  5K98 B;  1TWF J;  1UEL B;  2A6T A;  2CJJ A;  2K7L A;  3ZPL A;  2OAZ A;  5ERI A;  4M3G A;  1NK3 P;  3MFK A;  2MH9 A;  4HYE A;  1XDS A;  2Q0O A;  2DXI A;  3TW7 A;  1UCR A;  3H9Q A;  1XGO A;  2AXL A;  1BI2 A;  2HKO A;  3PM1 A;  4IRG A;  2LBF A;  3HOV J;  2RNJ A;  2QKL B;  3DBH B;  1VQK I;  4Z6Y A;  2QVO A;  3ABL H;  4BGD A;  1H9G A;  1PRU A;  1JJ8 C;  4XKB A;  4M6X A;  2JN6 A;  5D6F A;  5CPR B;  4JCX A;  1LCC A;  1UHS A;  4RLF A;  2R7O A;  3WU1 B;  3GF2 A;  2GLO A;  1TP4 A;  1XMA A;  1K6Y A;  2VPL A;  4BS9 A;  3OYF A;  2ELH A;  3CC4 I;  2PJP A;  1MBJ A;  3TMO A;  5E8G A;  5GTH C;  1IW7 F;  2ZBK A;  3VB2 A;  1YSE A;  2FOK A;  3IWF A;  3QPL A;  1VQ8 I;  2VPR A;  1ON1 A;  4K2E A;  1U3E M;  2YU3 A;  3MLF A;  4EV0 A;  1B6A A;  5FRM A;  5B1A H;  2MXD A;  1ZG1 A;  1Q1H A;  3IRR A;  4BQN A;  1ZN2 A;  2KHM A;  2P0W A;  2CSF A;  3CCU I;  3LL7 A;  2CFX A;  2W00 A;  3DKY A;  3WHC A;  2ZKZ A;  2DAO A;  5LGU A;  4CGZ A;  2LBF B;  1C0W A;  3E6B A;  3ZMZ A;  1Z91 A;  1BIB A;  3L2U A;  5DM6 F;  2A69 F;  1HLV A;  3MCZ A;  3Q0V A;  2WY7 Q;  3L09 A;  2PE5 A;  1MW7 A;  1V3F A;  4ENK A;  1R9T J;  4IVN A;  3HZI B;  2M87 A;  3FXQ A;  1FYK A;  2ID6 A;  2ECC A;  1V4R A;  2O8K A;  5F6F A;  4MEY F;  3RKY A;  4MTD A;  4PSX A;  1QBJ A;  3DEU A;  2E2I J;  2XCJ A;  1KU3 A;  4XLP F;  6PAX A;  3CCY A;  4BL0 B;  4CHU A;  3ABT A;  2PX9 A;  4RMN A;  3A1Y A;  2HTS A;  4C2M J;  4U0V A;  1LE8 B;  2L9R A;  3CLC A;  4B8X A;  3E5U A;  1WJA A;  2KRH A;  4HG2 A;  3F72 A;  2ZME A;  4EJO A;  3A01 A;  3CUO A;  1CGP A;  4AWX B;  4HPQ A;  2BXY A;  2K9M A;  1KON A;  1TWG J;  4OMY A;  4BU2 A;  2R7X A;  3EPZ A;  4UV8 A;  1D0Z A;  1GXQ A;  3JW4 A;  2OCC H;  2HYF A;  1UAA A;  1MZB A;  2CS3 A;  3IKT A;  3OOP A;  4Q48 A;  2LYJ A;  3FHZ A;  1XB4 A;  4F52 A;  3OYJ A;  2HS5 A;  3HOY J;  3IVP A;  4D1Q A;  1O57 A;  2MBF A;  1S9H A;  3DTE A;  1KU9 A;  2LRE A;  4U0W A;  3PO3 J;  3BRO A;  2X48 A;  2RQQ A;  3KET A;  1YW8 A;  4A3F J;  1IN7 A;  5AIQ A;  1RR8 C;  4C3I J;  1F1Z A;  3CDL A;  4EGZ A;  1Z6R A;  2JMW A;  2JPB A;  2OV7 A;  4RA2 A;  4UUV A;  1REP C;  1YX5 A;  2WWY A;  2HOA A;  2E7W A;  3GBG A;  4U88 A;  4X4F A;  1XGM A;  1LEA A;  4EKG A;  1IC8 A;  3FXL A;  1MFQ C;  1HC8 A;  5HDG A;  1UG2 A;  3H5A A;  2NVY J;  5L3F A;  1F5T A;  1YI2 I;  5BPD A;  1TW3 A;  3WG7 H;  3K0L A;  2CV0 A;  3SFI A;  4E7J A;  3JR9 A;  2WAQ N;  3DV8 A;  3RZZ A;  2XIG A;  1X2N A;  2IP2 A;  1TTY A;  3NQO A;  1Z3Y A;  3FMY A;  5L3E A;  1R58 A;  4CCM A;  2W84 A;  5HNH A;  4OAY A;  4NB5 A;  1XGN A;  4IO9 F;  4LIV A;  4H0E A;  2WAF A;  3OIP A;  2EBI A;  1JFT A;  2XAU A;  3FXM A;  2M4H A;  2V9P A;  3PXP A;  1FBQ A;  2VQC A;  3B6A A;  3EUH C;  3FXU A;  2B5A A;  3LIS A;  4ZDO A;  1QB2 A;  1CF7 B;  1J7K A;  4DIQ A;  4HDV A;  2OFY A;  3W2A A;  3TDU C;  4EJW A;  4OIQ F;  3MZ8 A;  3TFL A;  2X6W A;  2XRO A;  4KYW A;  5EEA A;  2F5D A;  1U9N A;  4D5C A;  1SAN A;  1UMQ A;  1FIA A;  4A12 A;  4KIF A;  1HBX G;  4NNJ A;  3AFH A;  4E6K G;  4Q4Z F;  2M9H A;  3KZY A;  4ZZD A;  1XMK A;  2FX0 A;  4LLN A;  3BWG A;  2R7Z J;  1ETV A;  5KAF C;  1RPE L;  2AO9 A;  5IT9 Z;  1D5V A;  2QUF A;  1TC3 C;  1RZR A;  1YG2 A;  3HOX J;  3ERM A;  3I59 B;  4L5E A;  2XAQ A;  5BNG A;  5D4R A;  3ZQF A;  4U0Y A;  4PGH A;  2JK3 A;  1ZAY A;  3Q0W A;  3DEE A;  4M3D A;  3HSR A;  1ZG5 A;  5E18 F;  5AON A;  3K4N A;  3CES A;  2XSD C;  4DYQ A;  1V5G A;  3E3V A;  3OR2 C;  2LNM A;  2E7X A;  3W3C A;  3LFP A;  4PSW A;  5DT2 A;  2BY1 A;  1QA6 A;  5B3S H;  1D0Y A;  1XWR A;  1IN4 A;  4PJJ A;  3A9Z A;  1EH7 A;  3G0T A;  2FNA A;  4ENN A;  5EZG A;  3ZMU A;  2DW4 A;  4XN0 A;  5LHH A;  1SVL A;  2GA2 A;  5TRD A;  2M45 A;  2BY3 A;  1RET A;  4XLA A;  4UXN A;  3LSK A;  3DU6 A;  3SXY A;  2EFP A;  3JTG A;  2R3S A;  5LGT A;  3ZPX A;  3ZMT A;  3OYH A;  2BOL A;  2M7B A;  4GCV A;  4MHG A;  3I53 A;  3M1E A;  2ZFW A;  2VBZ A;  2DFF A;  2LRD A;  5CQE A;  4PJL A;  3W6K B;  4BUP A;  5HS9 A;  1UZC A;  2XPV A;  1FEX A;  5FLX Z;  1OYI A;  3U9G A;  3BD1 A;  1WET A;  1DU6 A;  3EUK L;  3KZZ A;  3OL3 A;  1X1C A;  3KLO A;  4UB6 C;  1JTY A;  1ITY A;  3TEL A;  3NRV A;  1B8I A;  1ZZ6 A;  1MBH A;  4R79 A;  2X85 A;  4YG4 A;  2LK2 A;  3WE2 A;  3F8F A;  2OF7 A;  3I0T A;  4S0H B;  2XDV A;  1JJ6 C;  5E3O A;  1TL8 A;  3JXC L;  5L3G A;  5C4J J;  4PDK A;  4B3X A;  3TP0 A;  5KHD A;  2F6C A;  4IQJ A;  3GTQ J;  1K61 A;  3P7N A;  3FDY A;  2Q2E A;  5BMZ A;  1R5H A;  1WVR A;  3PJR A;  2R7S A;  2ICW G;  4CDG A;  2HXO A;  1ZGW A;  4IHV A;  2KJB A;  2R7U A;  3FK6 A;  5J8F A;  4HEA 2;  3K4L A;  2EFO A;  3LSG A;  5EZH A;  1IN5 A;  2EZI A;  2DBB A;  5HS8 A;  2X0L A;  2E34 A;  4Q47 A;  3MAJ A;  4A3L J;  1R23 A;  3FBN B;  4L5J A;  4ESJ A;  2VIX A;  3ASN H;  5DTD A;  4PCQ A;  5B1B H;  3KYL A;  4TV7 A;  1FP1 D;  3FM3 A;  4MNU A;  3GFM A;  2QWW A;  2F5V A;  2WA0 A;  2KEK A;  4J1W A;  3K2Z A;  4ASN A;  4U87 A;  3LQQ A;  4YRV A;  3SEQ A;  2W57 A;  2DYS H;  2Y2Z A;  3PNT A;  4IRI A;  1S5L C;  4XRF A;  5DD4 A;  1O4X A;  3BP8 A;  1T08 B;  2FBI A;  2HZD A;  4KIB A;  1Y8Q B;  2R7W A;  1X3U A;  3S3M A;  3PO2 J;  3OQN A;  3CUQ A;  3O8G A;  1K7A A;  2EZK A;  3TOB A;  3DPL C;  1BW5 A;  2BBY A;  3ABK H;  2R1J L;  3U1D A;  2M4G A;  2Y31 A;  2EBY A;  2DOD A;  2HZT A;  4MEX F;  3FYM A;  4Y7N J;  3WE3 A;  1G3Y A;  2PXF A;  2QSH X;  4XRM A;  3H92 A;  1YS7 A;  2LLK A;  3FX3 A;  1MDM A;  2XVC A;  1D0X A;  2KFD A;  2LY9 A;  3BTC A;  2HNH A;  2PJR A;  1FT9 A;  2F5C A;  2Y48 A;  4ZDL A;  1HW2 A;  4JX6 A;  4LLG F;  2GIV A;  3KEY A;  1RKT A;  4IHX A;  2CUJ A;  3RTR A;  1S8N A;  4IVZ A; 
#chains in the Genus database with same CATH homology
 1JGG A;  2DMT A;  3TW6 A;  2MGQ A;  2CUE A;  2R5Y B;  1A5J A;  2XB0 X;  2XGE A;  2XPW A;  1XS9 A;  5IP7 J;  2H8R A;  3OQM A;  1MBG A;  1D5Y A;  4AYB N;  4CYC B;  3OIO A;  2D5V A;  2HOS A;  4MLO A;  4J1X A;  3NAU A;  2XPU A;  2CRO A;  3GTJ J;  3JRG A;  5HOD A;  2ICT A;  3O9X A;  1RIO A;  2CQX A;  2LP0 A;  1IGN A;  4XIC A;  1SFO J;  3HOW J;  5J1U A;  2GRL A;  4X4H A;  3JXD L;  1DWK A;  4YBA A;  2YUS A;  5DS9 A;  3TED A;  3MN2 A;  2IV1 A;  2B63 J;  1HF0 A;  1VND A;  3OOU A;  1IV6 A;  2XIU A;  5E3N A;  3BTJ A;  3IH4 A;  2CRG A;  1UTX A;  4G12 A;  4DYC A;  1K83 J;  1E3O C;  2GBY A;  4GHJ A;  2HYJ A;  2ICP A;  5F0H A;  1QQB A;  2LYL A;  1XG1 A;  2WV1 A;  1POU A;  1WCM J;  3EUS A;  1U9O A;  2M34 A;  4J19 A;  1P7I A;  5IP6 A;  4A3I J;  3IH2 A;  1BW6 A;  3JRB A;  2YU9 J;  1MH3 A;  2AHQ A;  2MW8 A;  1EF4 A;  4D7N A;  3HOU J;  1AKH B;  3HGY A;  4A3D J;  2FQ4 A;  4V2F A;  1H88 C;  3GTG J;  2PPX A;  4HNV A;  3ZKC A;  3IV5 A;  2DMQ A;  3BS3 A;  2ELK A;  4AUX A;  4BKX A;  3CRO L;  2L7Z A;  3FIW A;  1IG7 A;  3TRB A;  3S16 J;  4I76 A;  2HI3 A;  3BTL A;  2E1O A;  4BXX J;  2DJN A;  2TCT A;  1NTC A;  1VI0 A;  1QRY A;  4D5F A;  3IH3 A;  3CMY A;  4MFE A;  2KEI A;  3HKZ N;  2JA6 J;  5EGO B;  1NK2 P;  1ZTR A;  3LSR A;  3E7L A;  1HDP A;  4QSH A;  5FKM A;  4A3J J;  5C44 J;  1WH6 A;  2AWI A;  4PU7 A;  4M3B A;  2PMZ N;  2NVQ J;  4MIM A;  1ETK A;  3DEW A;  4ABZ A;  3HEF A;  3RQI A;  4NDL A;  2NS8 A;  3CQZ J;  2XB5 A;  1JTX A;  2QF7 A;  3JRE A;  1PUF B;  1LFU P;  1ZR4 A;  1FTT A;  2IBD A;  3HBL A;  3GTO J;  4I6T A;  3ZHI A;  2N8G A;  1B72 B;  5IPA A;  4W1U A;  2L0K A;  1W0U A;  2WUS R;  3S1R J;  5K7H A;  3JRF A;  1YRN A;  2XGC A;  2R92 J;  4GQM A;  1CJG A;  1ZK8 A;  4X1E A;  3OP9 A;  3OMT A;  4MFD A;  4F8D A;  2IU7 A;  1ZUG A;  2EQR A;  1ZVV A;  2M0C A;  4FIS A;  1YRN B;  3L1P A;  3WHB A;  2OR1 L;  3SCG A;  4A3M J;  1TWH J;  4RBO A;  4DZJ A;  2JA5 J;  4JCY A;  2EH3 A;  2LVS A;  1QP7 A;  4BY7 J;  1Z77 A;  2COB A;  3SJM A;  5EGO A;  1JKP C;  2A6C A;  1ZS4 A;  4X6A J;  1TWA J;  2KPJ A;  2PUB A;  3R1F A;  1AU7 A;  2LR8 A;  2DMU A;  1PNR A;  1MNM C;  2KT0 A;  1QVT A;  1B0N A;  1X2M A;  3RZD J;  4PU4 C;  4I8T A;  1WPK A;  3RKQ A;  3BR0 A;  1RR7 A;  1AHD P;  1JFS A;  2JA7 J;  2VKE A;  3BR6 A;  4UUS B;  3BG9 A;  3G1L A;  1I3Q J;  2MQK A;  1TWF J;  2M8G X;  1ETQ A;  2CJJ A;  4JP0 A;  3ZOB A;  4M3G A;  1NK3 P;  2DA5 A;  5J1R A;  3TW7 A;  1ETW A;  4W97 A;  3DCF A;  3PM1 A;  4FE7 A;  3B6C A;  3I4N J;  3HOV J;  1ZKG A;  5F1J A;  1RPW A;  3FIS A;  3GTP J;  5F04 A;  1PRU A;  1JJ8 C;  4XRS G;  5FJ8 J;  2PUD A;  1QP0 A;  1POG A;  2NS7 A;  1LE8 A;  2JN6 A;  2E2H J;  5A7L A;  1OFC X;  4JCX A;  3U3W A;  3OSG A;  1LCC A;  1ZZ8 A;  1UHS A;  1PRV A;  1JWL A;  2ME6 A;  1Y1W J;  2GLO A;  2HDD A;  2ZB9 A;  2GZU A;  4DYR A;  2K9N A;  1ZR2 A;  3HOZ J;  2LYR A;  1MBJ A;  2O7O A;  5GPC A;  1YSE A;  5M3M J;  3QPL A;  3O8H A;  2IVB A;  1T33 A;  2VPR A;  4A3G J;  1CQT A;  3MLF A;  1IRZ A;  1RZR D;  4A69 C;  3I4M J;  1JUS A;  3A01 B;  2O9L A;  2CU7 A;  2AW6 A;  3ZQH A;  3S8Q A;  1L1M A;  1A6I A;  3LSP A;  3OQO A;  2QCO A;  2HIN A;  2CSF A;  4FBI A;  3S17 J;  4IVZ A;  1U8B A;  1OCT C;  1ADR A;  3WHC A;  1MSF C;  1VPW A;  1H89 C;  1I50 J;  1OSL A;  2FJ1 A;  1IUF A;  1HLV A;  1GV5 A;  3Q0V A;  2K9S A;  2R0Q C;  5M5Y J;  5IYB J;  2PE5 A;  2PUC A;  2Y9Z A;  5K7F A;  1R9T J;  4AC0 A;  4X4B A;  4X4D A;  3HZI B;  2HOT A;  3F52 A;  3JRI A;  4BBR J;  2ID6 A;  1TWC J;  2ECC A;  5IP9 J;  5GPA A;  1JT0 A;  3Q3S A;  2O8K A;  2XCJ A;  2RAE A;  2E2I J;  1PUF A;  2HXI A;  4A3C J;  1BJZ A;  3CCY A;  1MBK A;  2O49 A;  1LFB A;  3ZQG A;  2FD5 A;  4YG7 B;  3A02 A;  2DA3 A;  1P7J A;  4C2M J;  2NOG A;  2L9R A;  4DZP A;  1LE8 B;  3CLC A;  1B72 A;  5FKO A;  2ID3 A;  1ZZB A;  2DMN A;  1WI3 A;  2LTP A;  4IHY A;  3A01 A;  1R63 A;  3D1N I;  1QPZ A;  3S15 J;  2BNO A;  5F27 A;  3JRH A;  3S1Q J;  2IVQ A;  1TWG J;  2R5Z A;  5M5X J;  4X4G A;  1APL C;  3BTI A;  3HGG A;  5J3L A;  2LYJ A;  3HOY J;  4O8B A;  1GV2 A;  4XRS A;  3IVP A;  2R5Y A;  3MVP A;  3QPS A;  2L7M P;  3ZQI A;  3JRA A;  3BT9 A;  2VUM J;  3PO3 J;  2X48 A;  5K98 B;  3CEC A;  5EYR A;  1Z0X A;  1XC5 A;  3BG5 A;  4A3F J;  1LQC A;  1FIP A;  1ZPQ A;  3S1N J;  2K40 A;  1JUP A;  3LOC A;  4C3I J;  5J1Y A;  3CDL A;  1WH5 A;  1MBE A;  5FLM J;  2WIU B;  2IAI A;  2ECB A;  2JMW A;  1FTZ A;  2XJ3 A;  5EG0 B;  1PER L;  1LLI A;  3GN5 B;  3Q0U A;  2HOA A;  2K9Q A;  2BJC A;  3GBG A;  4X4F A;  1GVD A;  4PU3 C;  2X6O A;  5C4X J;  1IC8 A;  1QVU A;  2BNN A;  3LNQ A;  1UG2 A;  2W48 A;  2NVY J;  5IOZ A;  2LD5 A;  1Y1V J;  3SDG A;  2AXV A;  3SFI A;  3RZO J;  2EWT A;  3JR9 A;  3QQ6 A;  4EEF G;  2M2E A;  2WAQ N;  3TP3 A;  4B3A A;  2AXU A;  3RZZ A;  2AUW A;  4JYK A;  2AXZ A;  4I6U A;  1X2N A;  2KDZ A;  3ZQC A;  5FLV A;  2KZ8 A;  3FMY A;  4JX4 A;  3W6V A;  3M4O J;  1ETY A;  4X4I A;  4M3F A;  1BDH A;  3FKI J;  4V2G A;  2H1K A;  2OPT A;  3QYX A;  3F51 A;  5M3F J;  1RKW A;  4Y42 A;  1JFT A;  2EBI A;  1MBF A;  3B7H A;  4D7M A;  3PXP A;  4IA8 A;  4A3B J;  1BL0 A;  2B5A A;  3B6A A;  5FKK A;  3LIS A;  3HM5 A;  3GBF A;  4X4E A;  3BR5 A;  3ZQL A;  2OFY A;  5EG0 A;  1HDD C;  2E19 A;  2JJ7 A;  1ZZC A;  2XGD A;  5FKL A;  5EEA A;  4M3E A;  1U9N A;  3HB9 A;  4D5C A;  1SAN A;  1Y9Q A;  1UMQ A;  1HOM A;  2DA4 A;  1FIA A;  2IVG A;  2ME0 A;  3KJX A;  3JRD A;  1NER A;  1ZZ7 A;  1OJL A;  5C3E J;  2I10 A;  1ZZ9 A;  4FCY A;  2M9H A;  2LYS A;  2LYQ A;  3A03 A;  3JRC A;  1LMB 3;  3S14 J;  2FX0 A;  2TRT A;  2Y30 A;  4CYC A;  2XRL A;  4Z58 A;  2R7Z J;  4Z5C A;  2LCV A;  1ETV A;  3K2A A;  1RPE L;  1B8I B;  2AO9 A;  3LSJ A;  3S2D J;  4MO7 A;  1TC3 C;  4FN3 A;  1RZR A;  4QTR A;  3C2B A;  1QQA A;  2NVX J;  2PUE A;  4C3J J;  3HOX J;  1JT6 A;  2IEK A;  4L5E A;  5BNG A;  3F6W A;  4B1R A;  5E3M A;  4NDW A;  3K7A J;  3ZQF A;  4A93 J;  1DW9 A;  4QIW N;  2JK3 A;  1ZAY A;  3Q0W A;  4M3D A;  3KZ3 A;  1WGX A;  5K7Z A;  1W0T A;  2XSD C;  1MSE C;  4DYQ A;  2CUF A;  2JCG A;  2EZH A;  2Y9Y A;  3LFP A;  4YG1 A;  1ORK A;  4FE4 A;  5M5W J;  4X4C A;  1GDT A;  1ETX A;  1XWR A;  2DA1 A;  1NEQ A;  5EZG A;  2MG4 A;  3BR1 A;  4I6Z A;  4C3H J;  3G1M A;  1U78 A;  1RET A;  3ZHM A;  2CQQ A;  1JKR C;  1R69 A;  2DA7 A;  2HQ5 A;  2PUA A;  2DA2 A;  1T56 A;  3UFD A;  3HDD A;  3FYA A;  1X58 A;  2E2J J;  3DNV B;  1UXD A;  3QQA A;  4I6R A;  5JLX A;  1X2L A;  5EDN A;  1IDY A;  2BNM A;  2XPV A;  1FEX A;  4BY1 J;  1H8A C;  3H0G J;  2R63 A;  2EZL A;  4A3E J;  3BD1 A;  3G5G A;  3SCF A;  1WET A;  1DU6 A;  2DTZ A;  4IEJ A;  1WIZ A;  2YS9 A;  4IHW A;  3BR2 A;  1JTY A;  1ITY A;  1B8I A;  2O38 A;  1ZZ6 A;  1MBH A;  5FKN A;  4IWR A;  4YG4 A;  2LK2 A;  1IDZ A;  3BQY A;  3BQZ A;  4UUT A;  2OF7 A;  4S0H B;  2VKV A;  1GT0 C;  1UXC A;  1JJ6 C;  2JWT A;  5E3O A;  3JXC L;  2L7F P;  2PIJ A;  1OCP A;  1F36 A;  5C4J J;  1VF9 A;  4Y52 J;  2JA8 J;  3TP0 A;  2DN0 A;  2DA6 A;  1I6H J;  2P81 A;  5JLW A;  3S1M J;  2GRM A;  3GTQ J;  1K61 A;  3H3V K;  5E3L A;  1QPI A;  1VFC A;  2GM4 A;  3KXA A;  2HXO A;  3GTL J;  1X57 A;  3BG3 A;  1ZGW A;  4IHV A;  3GTK J;  3FK6 A;  3UKG A;  2JVL A;  1BDI A;  1JKO C;  4Z5D A;  1LCD A;  3VK0 A;  5IOY A;  3F0C A;  4LOC A;  2NVT J;  2IUO A;  1QP4 A;  3LSG A;  5EZH A;  1S7E A;  2EZI A;  4GFB A;  4BBS J;  4M6V A;  1F43 A;  1Y7Y A;  5F0C A;  4A3L J;  2G0E A;  4MCT A;  3H5T A;  5DTD A;  1Q1V A;  5EF6 A;  2FJR A;  1ZQ3 P;  2PUF A;  4JX5 A;  4UUS A;  1JUM A;  4XK4 A;  4YAR A;  3FK7 A;  2L8N A;  3GN5 A;  2KEK A;  4FTH A;  4J1W A;  3G1O A;  1JH9 A;  4RDU A;  2LYK A;  2Y2Z A;  3SCH A;  1O4X A;  4XID A;  1RZS A;  3BDN A;  2MSY A;  3PO2 J;  5IYC J;  3OQN A;  3O8G A;  2R93 J;  3QF3 A;  4OB4 A;  4Z59 A;  2R5Z B;  2EZK A;  1G2H A;  2LFB A;  2DMP A;  3JXB C;  5F0F A;  1BW5 A;  1FJL A;  1SQ8 A;  5IYD J;  2EF8 A;  4Z5H A;  3VPR A;  2R1J L;  2MEZ A;  5GP9 A;  2Y31 A;  2X9D A;  2EBY A;  1PRA A;  1BA5 A;  1GUU A;  1DU0 A;  3FYM A;  4A3K J;  3MKL A;  1ETO A;  4Y7N J;  3G7D A;  3QWG A;  4JQD A;  1WH7 A;  1AKH A;  4XRM A;  2LKX A;  2VI6 A;  1JKQ C;  1HCR A;  2LLK A;  2WB1 N;  5F08 A;  3M3Y J;  2LYP A;  4DW6 A;  3OSF A;  2LY9 A;  3BTC A;  3NAR A;  3S2H J;  2KEJ A;  1EFA A;  9ANT A;  4PU8 A;  2XI8 A;  1MH4 A;  1IJW C;  2PUG A;  2HSG A;  4JX6 A;  3BR3 A;  1WH8 A;  2L49 A;  4MCX A;  1RKT A;  4IHX A;  3GTM J;  1ENH A;  2Y0S N;  4B4C A;  2O4A A;  1RES A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...