1E3WA

Rat brain 3-hydroxyacyl-coa dehydrogenase binary complex with nadh and 3-keto butyrate
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
255
structure length
251
Chain Sequence
SVKGLVAVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGGNCIFAPANVTSEKEVQAALTLAKEKFGRIDVAVNCAGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLLTTVRNFLASQVPFPSRLGDPAEYAHLVQMVIENPFLNGEVIRLDGAIRMQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of Structurally Diverse Substrates by Type II 3-Hydroxyacyl-Coa Dehydrogenase (Hadh II) Amyloid-Beta Binding Alcohol Dehydrogenase (Abad)
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Dehydrogenase
molecule keywords SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
total genus 91
structure length 251
sequence length 255
ec nomenclature ec 1.1.1.178: 3-hydroxy-2-methylbutyryl-CoA dehydrogenase.
pdb deposition date 2000-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1e3wA00
3FD8A 1VJ0A 3UHAA 2YHIB 1Y9AA 1R0LA 4CMBA 3QA9A 4YQYA 5A3VA 3FTNA 2GERA 2NVUA 4U6SA 2NVBA 5TS3A 3M2TA 4GLOA 1YOVB 3JV7A 1HE5A 4BNZA 2V6GA 2EGHA 4BO2A 1H6DA 4BV9A 5I7SA 1AHHA 1H0KA 4Z0TA 3DBLA 1W4ZA 2HK9A 4LSMA 2NU6A 1VJTA 5TRTA 1I10A 5HBRA 1K6JA 3IJRA 2QG4A 3P19A 4CUKA 2YYYA 2QHXA 5I9LA 5EESA 1HDOA 1SO8A 1NFFA 4IQGA 2LDXA 4DC0A 3ZNOA 3T7CA 2Q3EA 1D1TA 2RH4A 1DBVO 3LVFO 2O3SA 3ROPA 1NFRA 3GN2A 5K9ZA 2CFCA 1XCBA 2ZJ0A 4GLLA 3DAPA 1E7RA 3DL2A 2DTDA 4EUEA 1E5QA 3NJ4A 4RPLA 4LRTB 3RUCA 4E3ZA 4RVGA 4Z0HO 3L77A 1B3BA 1BW9B 1L7EA 1FF9A 1U8FO 4EDFA 2NSDA 1QLHA 3VPSA 3K9QO 2PZMA 4J4HA 3H8VA 4FSHA 1B3RA 1EVJA 5JDCC 1PJ3A 2AEMA 3FHLA 5BSFA 4BMNA 2X6TA 1FMCA 1HDZA 1ZSVA 4Q3BA 4A27A 1PJQA 2C0CA 1TVEA 2I67A 2W98A 2BLLA 4QXMA 4Y67A 5A05A 4E6PA 2R2GA 1XGKA 3DDNA 4UEKA 1KYQA 1VRWA 4IDBA 2JFHA 1OBFO 4TRRA 4HXYA 1E7MA 2FP4A 5ILGA 2FR0A 3TL2A 1I24A 1X0VA 3ZHZA 2AHRA 3JQFC 2CVQA 5HA5A 1CYDA 4J43A 4OAQA 1H93A 4BNTA 3SX2A 2JD0A 4AJHA 1NR7A 2HMWA 3KHUA 3WS7A 2OHXA 1KEUA 4NR0A 1P9LA 1PS9A 2TMDA 1V9LA 2EERA 1C1XB 3BMQB 2ZJ1A 1LA2A 4BGVA 2JAHA 1F14A 1L7DA 3JQBC 2B5VA 1HRDA 1MUUA 3H5NA 3PDUA 3KEOA 4FIZA 3VPHA 7ADHA 3WWYA 2NTVA 4G2NA 3Q9UA 3K73O 5F1PA 5DCUA 2PKRA 1PL6A 3KB6A 4TRMA 3KYDB 2IDZA 4ZA2A 5IN5A 1XELA 2HRZA 3P5SA 1GAEO 1LTHR 1MXFA 4JQCA 4BGUA 4CQMD 2CUKA 3M1AA 2AE1A 1YQDA 2B4QA 3IJPA 4BKUA 4CM4B 1XEAA 4TQGA 4J6FA 1ADCA 2P68A 1V3TA 2VOEA 1Z45A 4FC6A 5C7LO 3R0IA 2CVOA 4YJHB 2O3JA 1HTBA 4W7IA 2EF1A 3STHA 1ZFNA 5CEEA 4BO5A 1F8GA 2GUGA 1EVYA 2IEDA 1LLCA 3AY7A 3H9UA 3OICA 3ZU5A 3VH3A 2NWQA 4DWVA 1OC4A 3DZIA 2X9GA 1SEPA 4Y9DA 3W8DA 2X1HA 1X1TA 4OOFA 4CLXA 1LQTA 1C0LA 4F45A 3LC2O 1DPGA 4LCJA 1Y8QB 4AJNA 1SZJG 3C85A 4O63O 5ER6A 3RKRA 4AJ2A 1ZK0A 4IJVA 3G49A 1A72A 4R01A 2BF7A 3SEFA 1BG6A 4BO9A 1R66A 3DOJA 4QX6A 1GEGA 5ES3A 4B79A 2DUWA 2W2LA 3UOGA 2YJZA 4LMPA 1DC6A 3BHIA 1NAIA 3HG7A 1V8BA 3D0OA 1OC2A 3LF2A 2BELA 4KZPA 3QWBA 3KO8A 4Q3AA 2V7PA 3D3EA 2BFMA 1XYGA 1U4OA 2VCYA 1W73A 3AM4A 5KTKA 3A06A 5L7YA 4E4YA 3PHGA 3IIEA 4KUEA 2GN8A 3S2IA 3VH1A 4RCVA 4ZQHA 4PCVA 1DB3A 3IP1A 4CM7A 1LDNA 2AW5A 1T26A 3ZWCA 3PYMA 2PD4A 1PEDA 1QLJA 5A9SB 1P33A 2DBZA 4PVCA 4NFYA 1CRWG 4YT4A 4YT8A 4H3VA 4I5GA 1E7SA 2B0JA 4A5OA 1I01A 5EERA 3PWSA 5FYDA 4KDEA 3GPIA 4E13A 5JAIA 4D43A 3OETA 2BHLA 2QQ5A 5GZ3A 1BDBA 1AHIA 3SJ7A 4E2WA 3JQEA 1DRVA 4R4JA 4CLHA 2YDYA 1CIVA 3GVPA 1ML3A 1LU9A 1ONOA 4U5QA 4XEHA 4TVOA 1QKIA 1Y6JA 1WDMA 2VTDA 4DLBA 4Q39A 2Q1UA 2W2LD 2GDZA 5TQVA 2POQX 3OIGA 2BKAA 4WLFA 4P4NA 3NT4A 1HYHA 4DA9A 2PGDA 3WX0A 1T2FA 2D8AA 1E1NA 3PHJA 5KWEA 4FB5A 1BTOA 3VZQA 4I9HA 4M54A 1I33A 2W2KB 2X0RA 4Q3NA 4BNKA 3WMXA 4OYRA 1PJSA 4YJGB 1FDTA 3NYWA 3NGLA 3KLPX 3S55A 5JAZA 3HDYA 3IKVA 2BFPA 1WZEA 1BMDA 1DAOA 3UUWA 1GDHA 4CMCA 4GSKA 1VE9A 3QVOA 5LCXA 3G0OA 1GCOA 3WFIA 3WIDA 1ISJA 5B4UA 3H6KA 2GD1O 1I8TA 1I3LA 3LT2A 4I9UA 4XWYA 2OZPA 5KJCA 3V5NA 1XR3A 3C1OA 4RVHA 1RKXA 1UZLA 3NV9A 4IZHA 4MOWA 1PQPA 3NJ8A 3GDOA 1ZXLA 1YB5A 1G0NA 1JW9B 3D4OA 3RC9A 3S1LA 3U9LA 1PGJA 2OMEA 4ZQEA 3ULKA 3RUEA 3E8XA 5KVVA 1NPYA 3E1KA 2WEKA 3OJFA 5AOVA 2X5OA 4I1IA 2FOIA 1T4DA 4R51A 3S2EA 5JCJD 1SB9A 3CTMA 1R37A 4MP3A 3ADOA 4DBVO 4BOYA 1MGOA 3GUCA 2IYPA 3RFVA 1KEPA 4GL4A 3GVCA 2NQTA 3D4NA 2ZYAA 2H1SA 3WXBA 3V8BA 2BI8A 1ISHA 3ROMA 3KV3O 1ZKMA 3UCFA 2Z5LA 1YBAA 1ADGA 3WGTA 1CF2O 1T2DA 4YB8A 4YRDA 1UDBA 4HUJA 1ZO8A 1M67A 3LT0A 4QSMA 1ZMOA 4RL6A 4H16A 1W6UA 3OJEA 4QEDA 1E3JA 1RM3A 5IDYA 3AI1A 1B8VA 2A9FA 1B2LA 4D46A 3BAZA 3FNHA 1BVRA 4BMVA 1T1RA 2IE0A 2PD3A 3E9NA 4FN4A 1YQXA 3DFUA 3E82A 4WE3A 3UICA 1DSSG 4B3IA 2VHXA 1EBUA 4K6FA 4UVGA 5BT9A 4EW6A 1V6AA 1D3AA 2O4CA 3PZRA 1E6UA 5ICSA 2X58A 5FF9A 3R1IA 3TPCA 4IDDA 3HUDA 2IZZA 1B8PA 2ZK7A 1UDCA 2NQ8A 4CV1A 4W99A 4NDNE 4RLHA 4S3MA 2PH3A 3TWOA 5TF4A 2Y0EA 4U8GA 2YFQA 4XYEA 5DBFA 3TFQA 1DRWA 2IRWA 1HSOA 1I3NA 1DIRA 4UVIA 1PL8A 1FJHA 3ANLA 5KKCA 1NX6A 3I83A 3IUPA 4FCCA 5JCXA 2Y67A 3RBXA 2J3IA 3GRKA 1U5AA 3RIHA 1JWBB 2R00C 3QIVA 4Z3KA 2PK3A 2ZTMA 1ISMA 4WUVA 1NPTO 1MG0A 2EJVA 3AUSA 4BO8A 1B0AA 4YR9A 2AMFA 1HLPA 3AUAA 2ZTVA 3DBRB 2P4HX 3ZNPA 2Q1TA 1X14A 4H7PA 3DOOA 4MO2A 2NU8A 3ZW8A 4IDFA 4CMIB 1NAHA 2C07A 4I9NA 3WNQA 3ZWOA 3H2ZA 4BKRA 5JMWA 1GUZA 4UULA 2P91A 1IL0A 4BMSA 5TLSA 2Z95A 3C7DB 2PFGA 3MWEB 4DTIA 4AJPA 4AJ1A 4H15A 5LDGA 1EDOA 2I6TA 4GI2A 5JW6A 1R6DA 2AQHA 4TSKA 4NQZA 1CDOA 4RV9A 5IFLA 1HXHA 3KETA 1P74A 3S2GA 3B70A 2FSSA 5G4LA 2I3AA 2EG9A 4QTZA 3JD1A 1DFIA 2IZ1A 4RF2A 4ALIA 3MJTA 2YZ7A 4ND4A 4IDCA 3ROKA 3WLEA 4WCFB 1U5CA 2HK8A 2DBRA 1NP3A 3DBRA 1DIHA 4FS3A 1CQIA 2HQ1A 5ADHA 5L95A 4YEDA 1PJLA 1KS9A 3HN2A 1V35A 2GN9A 4U0KA 3WMWA 3AM5A 3RD5A 3AOEC 4FC7A 2X22A 4AICA 4YT2A 1Z74A 1UJMA 1M2WA 1ZXBA 2ZB4A 3MEQA 3WICA 4BNYA 1GD1O 1DC4A 5G2OA 1ZUD1 2O2YA 4ILKA 3UF0A 2PZLA 3DONA 3H7AA 1PU2A 3KBOA 3Q3CA 4IIVA 5EIOA 3HB5X 2BGKA 2CD9A 4E2ZA 4DQXA 1GFSA 2UUOA 2PKQO 4HNGA 1UZMA 1O95A 2IZ0A 1Z73A 4P4LA 2CDBA 1UUFA 3ICCA 3H4VA 4NU6A 3UVEA 3ZZNA 1YL6A 3VKUA 4ZGWA 1XQ6A 3HDJA 4N54A 4FFOA 1JQBA 1XDWA 3GZNA 3MOGA 2HJRA 3F9IA 4CR6A 1EZ4A 4E5NA 2JAPA 5B37A 3DBHA 3JYLA 1VL6A 1Q7BA 1GZ4A 2I5PO 4OXYA 1NVTA 4AL4A 4RDHA 4AJOA 3GMDA 1DEHA 4NHEA 1C3VA 3HADA 4XGNA 1NTOA 5BQFA 3I1JA 2Y1EA 1WNTA 2EGGA 2F00A 1ADFA 2DVMA 2G1UA 2HKIA 3KEQA 4R1TA 3MTGA 2VWPA 4I5EA 2D4AA 3PK0A 1PJ4A 3DFZA 3G1UA 4J2OA 4FJ2A 4BNWA 4DGSA 1V0JA 2Q99A 1B8UA 3U4HA 2J5RA 1Y5MA 1NQAO 3W8FA 1Q0QA 3H3FA 5U1PA 4TKLA 4I5DA 5JFOA 2EXXA 2AQKA 3H9QA 5CDYA 4R1UA 1DIAA 3A14A 1XIVA 4W4TA 5FI5A 4URFA 3VKVA 1ZEMA 3HNPA 2CNBA 4E12A 3WLFA 4AFNA 4EJ6A 3CUKA 1LDMA 4CQMB 2EIHA 1U1IA 3G1TA 3DMYA 3FNGA 1U4SA 1A71A 1ID1A 3TSCA 3RWBA 1EUDA 2B4TO 3NDRA 1EFKA 1QXSA 1YQGA 1JKIA 4BS9A 4PLHA 1J4AA 4IGEA 4LISA 4BNGA 2ZYDA 3BHMA 3BTUA 2Q46A 4R1NA 4JN6B 2QRLA 5DT9A 3RJ5A 2E4AA 4PRKA 4EEXA 2Q2VA 2O2SA 4GH5A 4G5HA 1XU7A 4FQ8A 5AXDA 4ITUA 3AUUA 1KETA 3VTFA 4BNFA 4J4BA 4E31A 4ALKA 3PQEA 2EP5A 3IKTA 1WVGA 3H5RA 4J90A 4N5MA 4OL9A 2WTBA 3PP8A 3BMOB 3RQSA 1CQJA 3HDHA 4WGGA 5DZSA 3Q1LA 1P1IA 2C7VA 3ZWBA 3PJFA 4CMAA 1Z6ZA 1HDRA 2GN4A 4QT0A 4B4UA 3JQBA 3L6OO 5JC8A 5A4DA 1X13A 4FDAA 1FDWA 1VL8A 3GF4A 5CEFA 3DB2A 3OA2A 1PZGA 4DQUA 3WR5A 5DP2A 1DIGA 4RO0A 9LDTA 3KSDO 3ASVA 5HWSA 2OP0A 3DHYA 3PIIA 2I9PA 2UV8A 2VYNA 3FRJA 3GG9A 4OGWA 1WDKA 2RH8A 4ALLA 3PYLA 1XQ1A 1ZH8A 1B26A 3KXDA 4ALMA 1U3VA 2XXJA 5BSGA 1M75A 3JYQA 2B4RO 3MZ0A 3PGJA 3TZCA 5AQ1A 1C1DB 4FW8A 2WD8A 2EP7A 3E9MA 1ZW1A 3PHHA 4XQ9A 3VDRA 1NWHA 1C0PA 4R68A 1DLJA 4PLZA 2IYOA 5FI3A 3QWAA 1OFGA 2NTJA 4UEOA 1YDEA 5J23A 5L7TA 2YHUA 3GAFA 1LX6A 1YONA 1ENOA 4EGFA 3CEAA 2YV3A 3VVCA 1OAAA 4CM8B 2QX7A 4DPMA 1LNQA 1UP4A 1ZCJA 1JTVA 2XPCA 4WECA 3LLVA 4JCOA 3GGOA 3WYBA 4FJ0A 4RVUA 1IPEA 5BNTA 2WE7A 5A5EA 4KP7A 2A35A 3PWKA 4G81A 1TT5A 1IE3A 1F06A 3OA0A 4YPOA 2XOXA 1R4NB 3BZUA 4B3JA 2AEJA 5TGDA 3BXXA 3SJUA 4XQEA 1A4IA 1AXGA 2CF6A 5EN4A 3W8EA 2HDHA 3ANMA 1P31A 4LVUA 2O7QA 4GX0A 4K26A 1Z82A 4UVHA 5EL0A 2AEFA 1TI7A 2VRCD 1FDUA 4BQPA 1SPXA 1ONNA 4L75A 4DIOA 3OQ1A 2WD7A 4GMGA 4B3HA 3U3XA 4E33A 4D41A 2W90A 3A1NA 4W6ZA 5A03A 1SMKA 5MDHA 3EGOA 4UUPA 3ZNQA 4J7XA 5F3RA 4UUMA 1UDAA 3DAFA 4M8SA 1U3TA 1PL7A 2FPGA 2GLXA 1MA0A 1Q2XA 3BYZA 1LSJA 4R16A 3NT5A 3ZWWA 2EWMA 2FZWA 4GQAA 4D0RA 2Y0DA 1RWBA 3WGHA 4IMPA 1H6CA 1HE4A 5ITVA 1P1JA 3GK3A 1B15A 4A0SA 2G76A 3NRCA 2VYVD 4RF4A 4YAEA 4ZVVA 4R69A 3OM9A 3QHAA 1BVUA 3C1AA 2VNAA 4M1QA 2QYSA 2NTNA 2VHZA 3JQ7A 5IDXA 3IAHA 1I0ZA 1I3MA 1YRLA 4PN3A 3AU9A 5JCJA 3D7LA 1FXSA 5DOVA 3B1FA 2VN8A 1ENYA 5L53A 1GUFA 1PS8A 5C3MA 4OM8A 1DJNA 3OMLA 1O5IA 3UH1A 1I32A 1C1DA 2WYVA 1GQYA 3NEPX 1U9JA 4NJMA 3C8MA 1PR3A 4UAGA 5IZCC 1QSGA 2HLPA 4S1VA 1P45A 4BNXA 2C2XA 3WGIA 4W7HA 4Y8VA 5H82A 3OFSA 4E30A 4OXKA 3JTMA 4MKRA 3IL2A 3ZWPA 1EDZA 1ZK3A 1CERA 1N1GA 1MX3A 5IAAA 3A9WA 2CZCA 2Y0CA 3OJ0A 2D59A 3NTRA 5EJ2A 3WWZA 4DMLA 3T4XA 3WGOA 1DIBA 2Q2WA 4EUHA 3RAJA 1DC3A 4BNLA 2FZEA 4CMKA 4W9NC 1E3WB 1OI7A 2HU2A 4WOJA 5CDSA 4I5FA 3PIDA 3OJLA 4TZTA 3HFGA 4ZICA 4KWHA 2FMUA 3GC6A 3QY9A 4RQTA 3ETGA 5KVSA 3C7AA 1SNYA 2WMDA 2X0NA 4J1SA 4BB5A 2E49A 1N7HA 3Q0EA 1DDOA 4KDFA 3V1TC 3RBVA 5JLAA 3NGXA 5JE8A 3QVTA 5DCWA 2VWHA 4QUKA 1RYEA 4K9DA 5TT1A 2HMUA 1GYRA 3FBGA 3GY0A 1P1KA 1LSSA 4NBUA 1HYEA 2VZ8A 4J2HA 1TXGA 1DFHA 4A73A 2D5CA 4UUNA 1QMGA 1T25A 3H5AA 1WDLA 3GEMA 4AJKA 4FBGA 4JBGA 1P3DA 3LQFA 3H9GA 1IYZA 1X1EA 4ZRNA 2PTGA 5L9AA 3MJCA 4D3DA 1WAMA 1HDGO 2WSBA 5A04A 1KY4A 2GZ1A 1EBFA 4HFNA 1CWUA 1EVIA 4HADA 4WEQA 2P9EA 3HE3A 2IXBA 2PNFA 1ISIA 4MVJI 5THQA 4A10A 2H9IA 2EEZA 2YW9A 1P1HA 4Q9NA 3EC7A 4PVDA 1DRUA 4DMMA 2O4UX 3CSDA 1O6ZA 3GOHA 1K6IA 2C59A 4NJOA 1KC1A 2PV7A 2DLDA 5THKA 1M6WA 4R3NA 4KUGA 4YAKA 1JU9A 1T1SA 4ZRMA 4EITA 4AJEA 2HMSA 5AXBA 2C5AA 3NAQA 5A9RA 5BSHA 5CDUA 2CVZA 3O9ZA 3N74A 4E21A 5CDTA 2QW8A 4NMHA 1HSZA 2Y1GA 3FR7A 3GNSA 5C7OO 4JJIA 2PLAA 1X7HA 4IJUA 2ZYGA 1JVBA 5I7FA 2EHDA 2GNAA 4E5PA 4CMEC 3MJVA 4NBWA 3BTSA 3A28A 4ND1A 2V6FA 3SXPA 3WGYA 1NBOA 2GYYA 4JLWA 4IMRA 1EUZA 3PXXA 3Q2IA 3ZWNA 1EQUA 1A7AA 3RUHA 2QRJA 2O50A 3AI2A 1MC4A 3K8ZA 4IDAA 4WCDA 5F1OA 2CY0A 4CLOB 1RM4A 2HK7A 3GFGA 1YOVA 1J0XO 2EW8A 1EUCA 2B35A 3F1KA 4DLAA 5I7EA 1ZK2A 1XHLA 4WOKA 1R16A 3WBBA 1MV8A 3QVXA 3PWZA 1VM6A 3KLMX 2H6EA 1RYDA 4E5MA 5JPIA 2VZ0A 3ZU4A 5T8KA 1KBZA 2X9NA 2EKPA 2YUTA 3I9NA 5TC4A 1HKUA 1YL5A 2O3QA 3X2EA 1R4MA 4ZJUA 2JHGA 2OOSA 3OBBA 1X15A 5L7WA 2ZB7A 4Q3CA 1GL3A 1R0SA 2ZCUA 1UZNA 3EW7A 4LMRA 5DCYA 3G3EA 4D79A 3O8QA 3RI3A 5G0WA 3Q6IA 5FEUA 1IZ0A 3DO5A 3MJEA 2HMTA 2BD0A 3KOUA 1EQ2A 5COBA 5IN4A 1PQWA 1LRLA 1IY8A 4GGOA 1PSDA 1DHRA 1Y9EA 4LW8A 1WW8A 4J9UE 1X0XA 3L9XA 2W2KA 3U4IA 4DIFA 4DL9A 1YJQA 4BNJA 1UXHA 1DLIA 1HDYA 2VT2A 5COAA 3QW2A 1O94A 3DC2A 3PJDA 2FHSA 4M55A 4J49A 3ZWVA 4J3FA 4FOSA 1ULUA 2DTEA 2FPIA 3VC7A 4A2CA 4CMIA 3LF1A 1L1FA 4QO7A 1ENZA 4WCFA 5CEJA 5IXSA 1I2CA 5LDHA 1YB1A 4YTEA 2VYND 4OOEA 5DN9A 1LDGA 1YBVA 3QVWA 2YDXA 2O48X 5TX7A 4RQUA 2OFPA 1EK6A 3JQAD 7MDHA 1LQUA 4NK5A 1N2SA 2HCTA 2G82A 3JQDA 2NU7A 4K6CA 1AXEA 5FFFA 3W4IA 1E3LA 3IC5A 4EJMA 1GV0A 3KUXA 2FY8A 3K96A 4OQYA 3WIEA 4QFDA 4CLRB 4R5HA 1P1FA 2VUUA 2ZTLA 3RC2A 3ZN2A 1A7KA 4HBGA 1ZVMA 4K1LA 2HSDA 3UN1A 2A94A 3WB9A 3FPLA 4CQMA 4MDHA 5C5IA 2Q1SA 1GU7A 3DWFA 3H9JA 3JQ8B 1JDJA 2C29D 4MVJP 4UEJA 4WK6A 4XIYA 3WBFA 4YCAA 5JY6A 1GUYA 1BXGA 3TN7A 1F8FA 5A1TA 1ZIDA 1E1KA 2RCYA 2FN7A 2X0JA 4ONEA 5TSDA 3HWRA 5JS6A 2VHWA 4WJZA 4BO1A 3PRJA 3RSHA 2X5KO 4MVJA 3O38A 3INRA 2YY7A 1NM5A 4FFPA 1O0SA 3GVIA 1A5ZA 4M87A 2NACA 3PI7A 3NUGA 2O3TA 4Z3DA 2DUUA 4GBJA 3I9MA 3ICPA 1N92A 3P7MA 4JX8A 4BO4A 5CHEA 1MFPA 2QZZA 4FJ1A 1M6HA 3GEDA 1HDXA 4XB2A 4BB6A 4ZQGA 1TT5B 5COQA 4C7KA 1G1AA 1Z7BA 4XCVA 4MVJF 1C0IA 3BTVA 3HN7A 4J16A 2FR8A 4FGWA 5DP1A 1JA9A 3KRTA 2NV6A 2I99A 2O3RA 4DIBA 1DAPA 1JVSA 2OL4A 2G17A 4Z9FA 1GCUA 2RHRA 3FSRA 4YT5A 3ETEA 3WGZA 1VSVA 1NHWA 2W8ZA 2HRBA 1Y8RB 4E5YA 4GSLA 1SBYA 3CH6A 5JY1A 4CM5A 1E3EA 1U28A 4WEOA 2B83A 3OIDA 3KYCB 5G4KA 5BSEA 1GR0A 3PFFA 1LLQA 3GLQA 3PZBA 3OQBA 3WSVA 2J3KA 3DZFA 5EPOA 3K30A 3L4BA 3RUIA 2ZQYA 4XIJA 1BHSA 2NLOA 2ZQZA 4M86A 3COSA 4D3FA 3GHYA 1YS4A 3OP4A 4MP6A 3I4CA 4ALJA 5IDWA 4PG5A 3PLNA 5G0UA 5KJFA 3ZV3A 1O9BA 3HZZA 3K2EA 4ZQFA 1HETA 3VH2A 4UVDA 3ZCXA 3F46A 4K28A 1NASA 3AFMA 4OKNA 1NNUA 2GGSA 1IOLA 2PGLA 4GVXA 3V2GA 4ALNA 4LK3A 4Z9XA 5L4NA 2UDPA 2WJPA 1NQOA 1PGQA 2HUNA 1KEWA 4FGSA 5I9MA 4IJKA 2PA3A 1KVUA 3FCOA 2JKVA 2YV2A 2RBEA 4CMGA 5K6AA 1UXKA 1IUKA 3EYWA 2C7GA 3L0DA 4DYVA 1KVSA 5AVOA 4MIEA 4KWIA 4NBTA 2FR1A 4GKBA 3VZSA 4CR8A 4ZHSA 1BXGB 4CQLA 2V6MA 3ASUA 3EY4A 1ZJZA 3AU8A 4TVBA 3ADPA 2B37A 5L51A 2UAGA 4PLGA 4OQZA 3GZ4A 5G0SA 4NH4A 5ENDA 1FK8A 2EKLA 5F21A 1JLLA 3JCZA 3EVNA 3RC7A 3RUAA 1J5PA 2VUTA 4OIMA 4AG3A 4F46A 4D44A 1NWCA 4HFJA 4J1QA 4R3WA 4B7UA 2VYVA 2Y1CA 4OMUA 3UKOA 3RUFA 2JFFA 3F6YA 3TQHA 1BXKA 3AWDA 3D5TA 3ONEA 4Z0PA 1BXZA 3GHHA 3PJGA 1JKFA 4PZDA 1LLUA 1KIFA 3PVZA 3DEYX 5LC1A 1LUAA 2XAAA 4L4RA 5HTOA 3JQGB 1Y8QA 4BV8A 3AW9A 3B6ZA 1U8XX 3KM0A 3OIFA 1MP0A 2BGLA 1E92A 4J4TA 3ZU3A 2RAFA 4L4SA 4PLVA 4R54A 2VHVA 4N18A 4U7WA 2PZKA 4RDIA 1S7CA 2PD6A 4RPHA 3E03A 3JQ9C 1J49A 1T2EA 5KVCA 1KERA 4MINA 2PY6A 4TMFA 4JP3A 3U09A 4YJFA 3DOCA 2AE2A 1E3IA 1H5QA 2P5YA 5A9SA 2YV1A 3ENNA 3SBOA 1JWAB 1Q0HA 3VTZA 1GZ3A 4YRBA 4YXFA 1XLTA 3I9LA 4BHTA 4CLDA 3ABIA 3F1LA 4NFSA 4XYMA 4ZQBA 4EJ0A 5JSFA 1JAXA 2EW2A 3INTA 3RUDA 2NNLD 4BNVA 3E5RA 3C7CB 4IDGA 3I9OA 4JBIA 3WQSB 2NM0A 2BMAA 3NKLA 2B5WA 4YJHA 4GX1A 5H81A 3GT0A 5I9NA 4B7XA 4BNIA 4YQZA 1SB8A 4MVJD 4OSPA 2NVUB 3ITDA 3ZWXA 3OEYA 1ZSNA 1GY8A 3E5MA 5A3JA 4IY1A 1EE9A 2DTXA 1E77A 2X5JO 2X9VA 3RKUA 1TB4A 3KVOA 4PGFA 1ISGA 3VAZA 2OP1A 5CAEA 4L74A 4RF5A 4F6LA 3CZRA 3AJRA 4YA6A 2I65A 4WKGA 1NXQA 3F5SA 3L07A 3WJ7A 1QR6A 2G0TA 2E37A 3FNFA 1EFLA 4PIVA 5JAQA 4YYZA 5CPFA 1AN9A 3DZJA 4Y98A 3WGQA 4ZN6A 3E6AA 5IZ4A 4CL8A 1PJTA 1G0OA 4PLPA 1LSUA 5GZ1A 1WMAA 3NTQA 2DBVO 1VSUA 3L6EA 5A06A 5KJ1A 2PGJA 3PHLA 2J3HA 6LDHA 4DC1A 4II3A 1I36A 4BUCA 2EKQA 3V2UA 4BGEA 4R1SA 5KJ6A 3SVTA 2PH5A 1UH5A 3N58A 2CDAA 2EV9A 3F4LA 4WPGA 4CMHA 4E2YA 3ST7A 3JQ9A 3RU7A 4R9RA 3VZPA 3BMOA 3I23A 1LRKA 2LDBA 1YBMA 2D5AA 1KC3A 3GH3A 4JP2A 2VZ9A 3ITKA 4E2XA 5KJEA 5CG1A 4CMJA 1SEVA 4L4XA 5A5FA 1P77A 4IZIA 3RVDA 3BTOA 3Q9NA 4DPKA 3E9QA 1Y1PA 1Y8RA 1QYXA 1LC0A 3JQ7B 4KQXA 4IQ8A 1A4UA 1RJWA 4NK4A 1DJQA 4GWKA 4L73A 5HS4A 1DOHA 1LRJA 5DBGA 3N7UA 4MKZA 1M76A 3RFXA 3PDJA 3QWIA 4OHUA 1E1MA 2HAEA 1X7DA 3GDFA 1YH3A 4MVJG 1E1LA 2XXBA 1T24A 3CE6A 5ICMA 3ZHBA 4LGVA 2RIRA 1VJ1A 1YXMA 4CV3A 3A4VA 4OH1A 2VWQA 3I9KA 4HP8A 1BSVA 1IZ9A 2Q1WA 2VRBA 3B1KA 2DAPA 3GGGA 1WZIA 5I8WA 4OKIA 1BGVA 4BGIA 8LDHA 4RGBA 1ZK1A 3CMMA 3FTPA 4UREA 1U2GA 2OGUA 1NYTA 4ND5A 5F5LA 5AXCA 3WSWA 4CL3A 2WD7B 5TIIA 2ZTUA 3GQVA 4BKOA 1M66A 3LSYA 2DU8A 1GYQA 3OEWA 4CM3A 5IF3A 4D42A 1NHGA 1CJCA 1Z7EA 1U7TA 1K2WA 1T2CA 3FNEA 1A27A 3G79A 4HFRA 4DXHA 1YDWA 3GZNB 4XR4A 2QIOA 3KYBA 2DM6A 1EEHA 1G6KA 3BMNB 2C2YA 3GA0A 3VPGA 3HFSA 3GPDG 3AOEA 4AJ4A 2AG8A 5K6AC 3AI3A 2HMVA 1HYGA 2X0IA 4MP8A 3R3JA 3I6IA 4O59O 5G0VA 3FPCA 1WMBA 4TZKA 3ZV6A 4NBRA 2JCYA 4XJSA 4P4GA 4YJDA 5JDIC 5IG2A 4B8ZA 1H9BA 2D2IA 4WNIA 1P0FA 3TL3A 5C37A 1KY5A 1H2HA 3I5MA 3FWNA 3ZHYA 2BFOA 4BNUA 2D3TA 4RORA 3ZW9A 1V3UA 2FSVA 5U4QA 3OF2A 4PZCA 4WCFC 2Z1MA 2PR2A 3DTYA 1H6BA 3IOYA 2VOJA 3D4PA 5C7IO 3P2OA 5DOZA 1GPDG 3INGA 3VPFA 1DXYA 4AVYA 3EUWA 3LYLA 2JCVA 3E48A 1BRMA 2JCXA 1K3TA 2ZKLA 3ANNA 1F12A 4R5MA 5JO9A 4XYBA 3T7EA 4CM9D 2O3UA 2WYUA 3UGKA 3CMCO 4WLOA 1AGNA 1SCUA 2HO5A 1IHYA 3OJOA 3LT1A 3GN1A 1TT7A 4XJTA 5TNXA 3QWHA 1YE3A 1N9GB 3K6JA 4DREA 2V6BA 1KVQA 1R12A 3L9WA 2DC1A 4ROSA 3WGGA 4B4WA 3QRWA 2R00A 4CPDA 4EZBA 4NG5A 3KZVA 3UAGA 1KEVA 1E3SA 2I76A 2CF5A 4RVSA 5B4TA 4JJGA 1ZSYA 1EMDA 2C5EA 1Y7TA 1CETA 1UP7A 9LDBA 4KQWA 3K31A 3LU1A 2P9GA 3QQPA 4HFMA 4GPD1 3U4DA 5KNLA 3DZBA 5ITWA 4PLYA 5CP8A 3F3SA 1Q0LA 3PHIA 3ROQA 3GEGA 5L40A 4XB1A 1XWFA 2UUPA 4IUYA 4JROA 4XQGA 1PTJA 1QP8A 4YAJA 3SC4A 4PRLA 4L76A 1LSOA 1YGYA 3AY6A 2A92A 4RF3A 3NX4A 4B8WA 3GVHA 1KVTA 1ZZEA 1HZJA 3M2PA 2Y1FA 3BA1A 1K6XA 3QWFA 4M89A 3H3JA 1UAGA 1WXDA 4G65A 4IXWA 1V3VA 1ZMTA 1GPJA 1E7YA 3M6IA 4DVJA 5EQFA 4KTTE 3ZI0A 5GZ6A 2Q4EA 2DPGA 3DZHA 4PG8A 3W4JA 1PZEA 3V1YA 1DHTA 5JYDA 3CKYA 4A7PA 3ZWAA 3QSGA 5HS6A 4WLUA 3VVBA 5F5NA 1C1XA 2ILTA 3BMQA 1NFQA 1K0UA 3BIOA 3MTJA 1I5RA 4X54A 4XGKA 5DNAA 4QO8A 4F6CA 1Z75A 2E48A 2WE8A 3H9EO 3FWZA 2GASA 5IXYA 2DQ4A 3JYNA 4B4VA 4EBFA 3T4EA 1WPQA 1B16A 1H6AA 4NI5A 2Q45A 1QYCA 3UXYA 3EHEA 1RM0A 3QVSA 3KTDA 4ID9A 5T57A 1YKFA 3GUYA 4XD2A 1A9YA 1D4FA 1O8CA 4IPTA 1EE2A 1LXCA 1T4BA 1LDEA 4GKVA 3VDQA 3QP9A 1QRRA 1UXGA 2DFVA 2FWMX 5T64A 4UUOA 2Q49A 3VHRA 3DHEA 1ADBA 4IQ0A 4NFHA 4FOOA 1IPFA 3K2BA 4CV2A 5KCZA 1PGNA 4Y6SA 1BW9A 3JD3A 2J5QA 4XYGA 3OSUA 4TRNA 3IDSA 1N8KA 2NU9A 4EEZA 5I7VA 3ZH2A 4D3SA 4N7RA 5DBIA 3W6ZA 4R9SA 4EYEA 3TF5A 4WLVA 3S2FA 2XF8A 2GPTA 5HRUA 4BNHA 1LEHA 2RHCA 4MIOA 2DFDA 2ZIZA 4J0FA 2A4KA 2DKNA 4RVDA 5CG2A 1TLTA 2Q4BA 1QYWA 4XRGA 1LDBA 3LK7A 1IB6A 2QZ9A 2SCUA 1XG5A 4E0BA 4NIMA 2O23A 1PGPA 3AFNA 3RCBA 4CMEA 1VKOA 2VRCA 1QYVA 3AM3A 5TJHA 3KYCA 5G4KB 5HM8A 3D1LA 1Q7CA 1DO8A 3BMNA 3EZLA 1E5LA 3W6UA 5CPBA 1WP4A 3TZHA 4BL5A 4RJTA 3EZYA 1OMOA 1QV6A 3NTOA 1MC5A 2UYYA 1I3KA 3UFXA 4NNJA 3RC1A 3V2HA 3H2SA 1HLDA 1HE3A 3I4FA 3UW3A 4CODB 2VUSA 4IGFA 3AK4A 4J91A 5MGBA 1NR1A 2OBNA 4IS2A 1LJ8A 2D0IA 5T8KC 3TRIA 2D1YA 3FBTA 3TZKA 5B4VA 4D45A 5JYEA 3BMCB 3KSUA 3L4SO 1UAYA 3I52A 5JC1A 3TJRA 5ENVA 3BHJA 4LVCA 3GDGA 1PWXA 1U7HA 3IMFA 3K5PA 3GAZA 5JDIA 2AQIA 3O03A 3X2FA 5U9CA 4XDYA 4JGBA 3LDHA 5KIAA 2PWZA 3NDIA 3WTCA 4AJLA 4FPXA 1YL7A 4FR5A 2R6JA 1PR9A 4MVJH 4BNNA 3EDMA 4O0LA 1EK5A 3K92A 1GYPA 5JMPA 4LCEA 1E7WA 1TEHA 3PGXA 2GZ2A 4CV0A 2J8ZA 1VC2A 3RROA 3WYCA 1LC3A 1HL3A 2JHFA 3HJAA 8ADHA 2P4QA 2DT5A 4ESOA 2C82A 5BNIA 1N9GA 1GQQA 1XSEA 3GGPA 1PJBA 1ZEJA 1NQ5A 3L6DA 4BIIA 3C24A 4HX5A 3PQFA 2YQ4A 5TJ9A 1P44A 5FWNA 1GQ2A 2Y66A 1I30A 1E6WA 3F4BA 4OSOA 1IHXA 3ZNNA 3PQDA 1ONPA 1FDVA 4OXNA 5DDIP 5A02A 3OECA 1E7QA 3CPSA 2VTEA 1H2BA 1QYDA 3VH4A 4CM9A 1PJCA 3QJ5A 4C4OA 3WOHA 1NPDA 4IINA 4JJFA 3HDQA 3U0BA 4XYLA 3WFJA 1C14A 3PJEA 1D1SA 4NPCA 3SLGA 4EUFA 4CUJA 1F17A 2C20A 5KKAA 4J0EA 1R0KA 2NVWA 1YVEI 2J6IA 4WNCA 4XA8A 1VPDA 2Y68A 3PFWO 2GCGA 2Y05A 5CFZA 2OBYA 3IS3A 3QLJA 1ZJYA 3U62A 3NDJA 3WQQA 2IODA 4GX2A 3TOZA 3JQ6A 2DPHA 5L4SA 1VL0A 3FN4A 3DBVO 4DRYA 3ZV4A 2PKQP 3JQAB 1HZZA 1P0CA 4OO3A 3W1VA 4ND2A 4KTVE 1CEQA 5L4LA 4LRSB 4XZ3A 2BI7A 4E5KA 4BO6A 4YAIA 1HT0A 4WLEA 1PIWA 2BGMA 3EK2A 5AXAA 3PPIA 5CDGA 1S6YA 3TZQA 4JIGA 4TWRA 3NT2A 4W9NA 1VLLA 5TT0A 1W0CA 3BMCA 5L3ZA 4U0JA 1MXHA 1HEUA 1PWZA 3ZU2A 4YWJA 2YFHA 1QV7A 4YAGA 3ORFA 3O26A 4YVFA 4CUZA 3GR6A 4EI2A 5BR7A 1GADO 3RASA 4Q3DA 1RPNA 3ZGYA 4TRJA 4BKQA 1R4MB 2F1KA 1GTMA 3JQCA 3OQ6A 3MCVA 2H5LA 3D5QA 5JNLA 2IXAA 3DHNA 1I2BA 3H65A 1UXIA 5EQDA 3SLKA 2VNSA 2JD1A 4XKJA 4J7UA 1D8AA 5IZCA 1SOVA 3WQRA 4QECA 3ENKA 4KOAA 5GMOA 2ZATA 3M1LA 1LBEA 1RM5A 1QORA 3LLSA 4QQRA 1SAYA 4INAA 4MIYA 5ER9A 2J5KA 3KYDA 3WJAA 3PTZA 4D7AA 1ZBQA 1WWKA 4BKPA 4KMSA 5L45A 4GX5A 4FD3A 3Q2KA 3FI9A 4ZU3A 5I8ZA 5B1YA 1PZFA 3MJ4A 3I3OA 4RPGA 2WWRA 1H9AA 2Y93A 2I3GA 3ZV5A 3D3WA 1D7OA 4XGIA 4MPDA 2QRKA 3ONDA 3I9JA 2Z1NA 5JAMA 4L9RA 3U4CA 2ZCVA 1PS0A 5H83A 1UXJA 2JJYA 5T6BA 4AJIA 4YACA 4JNKA 4P38A 1GZ6A 4BNMA 3FF4A 4R41A 3JQFA 4HKTA 3JD2A 4RPJA 3GRPA 4CM6A 4DBZA 4J7CA 4AJJA 1PJ2A 2X4GA 4PG4A 2CMDA 1YWGO 4FFLA 4RZIA 3D3WB 3PLRA 3O8QB 3TFOA 2GZ3A 1R4NA 4HWKA 3IUSA 1BWSA 4IIUA 2Q50A 2WDZA 2ET6A 3R6DA 2AA3A 4NJMB 4DYDA 2X23A 4N5NA 3QE3A 4FFNA 2AG5A 1DC5A 3DBLB 3LT4A 4PLCA 5JDCA 3JQGA 2OUIA 2VQ3A 1XKQA 1IULA 2PZJA 4PLFA 3ZWYA 4BO0A 4DQVA 3U5TA 1N5DA 2B36A 3DXFA 1KOLA 1PX0A 4HV4A 1JKJA 1MFZA 3GNQA 4TKMA 4J1TA 2GRAA 1MB4A 1TA4A 3EAGA 4OJNA 3Q11A 1I2ZA 1X7GA 1R15A 3D64A 4GAEA 4IXTA 4Z6KA 4N5LA 1Q1NA 3VPXA 3WNVA 1NVMB 4UVEA 4WLNA 1LI4A 4P22A 3C1TA 2J3JA 3WG9A 4Q3EA 3JYOA 1E3WA 2QYTA 3JD0A 5EINA 5T5QA 3WYEA 1EVZA 2GN6A 1YB4A 3R3SA 4JBHA 4PFJA 4BQRA 2ZB8A 3QV1A 1T2AA 5A9TA 2W4QA 5T67A 1WLYA 3DMTC 4BO3A 3O4RA 2YQ5A 4CQLB 3L4BC 1MLDA 4W82A 1JN0A 4YJFB 4E32A 5ILOA 4A03A 1QG6A 2TMGA 3ZHXA 3IP3A 2CSUA 4GMFA 1Q7GA 1XA0A 4HNHA 4L0QA 3UCXA 3ZDFA 2HJSA 4PLTA 5BNFA 3CINA 4IS3A 4JK3A 1A9ZA 3GG2A 4MVJM 2VWGA 1E0DA 5KVQA 2VT3A 3DAGA 4FFRA 3JYPA 3WTBA 2V65A 3GVXA 4U6QA 3OH8A 4PG6A 3TDKA 1DFGA 1K89A 2UVDA 2I66A 3B1JA 3RFTA 3TZ6A 4B7CA 3UCEA 4IBOA 2JD2A 4BO7A 1LLDA 3AY3A 2AXQA 2GSDA 3LC1O 3GNTA 2GR9A 4IJWA 4NBVA 1U3WA 2GF2A 3WDSA 2WYWA 4Y6PA 4LN1A 1SC6A 2JL1A 3JD4A 4IDEA 1PGOA 4MKXA 1JAYA 1AUPA 3LC7O 1ZK4A 1P1RA 2OXIA 3CIFA 5IJZA 1F0YA 3HB4X 4O6VA 4F3YA 4XX0A 4PLWA 5G0TA 1N7GA 3F47A 4YRAA 4L8VA 1GV1A 3GMSA 4CLOA 1HF3A 4DUPA 3DTTA 1AE1A 1U2DA 3OHSX 4HY3A 1ORRA 3ONFA 1H94A 3DZKA 4O5OA 5B12A 3P2YA 4J9VA 4XRRA 4Y6RA 3ETDA 1LDYA 3MJSA 4CLRA 3MOIA 4C7JA 1UP6A 3SC6A 4CR7A 3RU9A 3W4KA 4TROA 4NZ9A 4XQCA 2BH9A 4ZD6A 1YO6A 2X7HA 1ULSA 2YHIA 4PZEA 4O1MA 3HSKA 5IDQA 1OOEA 5JO0A 3JSAA 1W8DA 3DBHB 1NQTA 1Y81A 4CLEA 5AYVA 2ZB3A 3KSZO 4RLSA 5JXWA 4II2A 1Y5RA 1OZAA 1PZHA 2BRUA 3DR3A 2EJWA 3DQPA 3PYXA 1B14A 3FR8A 3V1UA 1FDSA 3GFBA 1SOWA 4KUHA 3ZWMA 3RBZA 4JXKA 1K5HA 2H63A 4YBZA 3C3XA 3I6QA 5KOIA 2P2SA 3U49A 2E6UX 1ENPA 4Z9YA 3TOXA 1HWYA 3F5QA 4D0SA 2AQ8A 4CM8A 3IQDB 3VOSA 4QFCA 1HE2A 2G5CA 3HHPA 4XDZA 1BDMA 4CM4A 2B69A 3DZGA 3LZ6A 2Q2QA 2Y1OA 4ND3A 4A26A 4P8RA 3AUTA 4RZHA 4MVJE 1J6UA 3JQ8A 1YJ8A 2CDCA 1ZNQO 3S8MA 1MG5A 1ARZA 1HDCA 2Y1DA 3B20A 2DBQA 1PQUA 2FPPA 3RJ9A 1C0KA 6ADHA 3EVTA 2OORA 4FFMA 3EMKA 1N1EA 3CZMA 4PG7A 1VI2A 3E18A 2E82A 3ON5A 2X86A 4GGPA 4NU5A 4J1NA 1ISFA 4GVLA 4YJGA 4IM7A 4BVAA 5DULA 2IEBA 5EMHA 4I8XA 5K0ZA 5F1KA 3DMTA 2BFAA 4RPKA 5JBIA 3G17A 1B7GO 2GO1A 2NUAA 1U3UA 3TNLA 2X8LA 1UR5A 1NVGA 4LSWA 5DF1A 3VZRA 1GEEA 4WASA 4CM1A 4GWGA 1KVRA 2O7SA 2C54A 2NADA 4DLLA 5GY7A 2P5UA 4RVFA 3CXRA 4CJXA 3MWDB 4XR9A 3AOGA 2VHYA 3HQ4O 2Y99A 3JQAA 4YDRA 1E6EA 1O89A 2P9CA 2WM3A 2FRDA 2JFGA 2OO5A 4DPLA 4MJLA 1VKNA 4B4OA 4I08A 4M49A 1XU9A 3PEFA
chains in the Genus database with same CATH superfamily
2ATCA 1UXOA 4RFSA 4YMIA 1OGJA 1R0LA 4H18A 1XLTC 2FLWA 1F8UA 1NBHA 2IUSA 3QA9A 4BATA 5FPHA 1RKBA 3GT3A 5C80A 5J1SB 3FPGA 3M2TA 1BE0A 2YJ4A 4GLOA 1QPBA 1R3UA 3U56A 4TV8B 5KKNB 2IS6A 1AZSC 4C78A 2NP7A 5FHQA 5IVIA 4AMVA 4D25A 1H0KA 2XGGA 3ISJA 2HIMA 2GPAA 4YIHA 3H4IA 2CZGA 2NU6A 2VBIA 3A4MA 4C29A 5JRZA 1IBCA 5ALTA 1KO5A 1K6JA 2JIZD 2QMZA 3IJRA 4JB2A 4LWZA 2FZCA 3KZKA 4CRWB 2YYYA 4HDRA 5DI3B 5E2AA 3CJQA 3FTDA 3OU6A 1F8XA 1SO8A 2PX3A 3H5LA 3QU2A 4FIDA 4F9EA 3K0CA 4NTZA 4IQGA 4GI5A 1KWGA 2LDXA 1ZAYA 3OY2A 3E2PA 4H77A 4BZXA 2VDNB 2X14A 5L3QA 2CK3D 1DBVO 1DQZA 3SYLA 4BVKA 3ZYCA 3LVFO 2X8BA 3E9CA 3EZNA 3FPEA 1E2JA 2FJPA 3LVRE 3MQFA 1NVAA 1I4EB 1E7RA 4NOJA 4W8GA 4LHVA 4D9NA 3HMKA 1K8YB 2VPQA 1UZAA 1ZGCA 3EAQA 3RUCA 3T7AA 4AF6A 1M2GA 1PWYE 1R10A 2WKRA 4LK2A 5ED0A 4XIIA 3MBIA 4Z0HO 1X74A 2BFCB 5JSUA 3FWPA 4F7WA 4KC0A 3B48A 4OJKA 1QLHA 3I42A 2PZMA 2CK3A 3H8VA 4M46A 4C43A 1EVJA 2IV3A 4B09A 3UMRA 5KEIA 1PJ3A 2DE0X 2BW0A 2BWJA 1SKYE 3CNEA 1ZSVA 4J29A 2WWFA 4RELA 4JMPA 4UPDA 3ILYA 5HGXA 1G8SA 3PEVA 1RQ2A 1YHNA 1EFVB 1YHYA 1HORA 1P4GA 1E2QA 3DDNA 1RXVA 4IDBA 1HQDA 4TWZA 2D7CA 1ZRSA 2FR0A 3TL2A 5IF9A 3GMTA 1WSBA 1G38A 4YCCA 1M34A 1R00A 1E2DA 3LFUA 1QTRA 4J43A 4A8PA 5B55A 3SQLA 5KYWB 1AX9A 2G4CA 1KEKA 1NVXQ 1JZSA 1T1JA 2YHBA 1I7PA 1MW9X 1Z5GA 3HV0A 4NZNA 3OJXA 4BLQA 1D0VA 3CURA 4ZZ3A 4R7GA 5B3JC 1Y3CE 4U7GA 1KEUA 2INGX 3QFHA 4M9XA 4NR0A 1PS9A 4XCQA 121PA 1L5VA 4ENUA 3UUEA 4BRZA 1LQ2A 4J0CA 4KDRA 2HEIA 1LA2A 3NVMB 4L5IA 4LBZA 3ZE8A 5B6JA 1QU3A 1W9MA 1EUDB 1F14A 1CHNA 2HX1A 3KS9A 1XZIA 2VDWB 3H5NA 3HB1A 3LLMA 3P4UA 3PDUA 4NX2A 4P54A 4JT2A 5IC4A 2YWFA 1TD9A 2YRFA 4G0WA 1LBHA 2PKRA 4Z1MD 3P27A 3I6MA 1NC3A 1RWQA 2LCIA 5IN5A 4Y2RA 1ZBDA 1NUUA 2PXCA 3KZNA 1GAEO 1BS1A 4H4EA 1LTHR 5IYZB 5GONB 2WWXA 2FPWA 3G85A 4CQMD 1QHFA 2B4QA 1BU8A 4KPGA 3TEFA 1VPWA 1XMOB 4J6FA 4MJXA 1PL0A 2ZRQA 4EZIA 4MV4A 1G17A 1H2YA 2NSYA 2VOEA 1KMMA 1VPLA 5BWOA 2HSWA 3BWVA 4CEHB 3SN6A 1HTBA 1NVVR 2VPXA 5FJJA 1SOUA 4IGAA 5E8JA 2R5NA 2HT1A 3VNBA 3F90A 1YQ9A 2GUGA 1V11A 3UYKA 5BPHA 1FSZA 4N0EA 4PX9A 5CNKA 3TTVA 1BDIA 1SKUA 3I04A 2W70A 5B3LA 3L02A 1MAUA 1ZGBA 2QN3A 3QVVA 1NBMA 1YA6A 2R7AA 2GD2A 2BFNA 1D4ZA 1SEPA 3I58A 3HCFA 2VPIA 2C2ZA 5FPYA 3F2IA 1HFWA 4LHSA 3UHPA 2C94A 1FP4A 1V4VA 4KQCA 1NKVA 3V7UA 4K9RA 4DJ5X 2HIAA 3C6QA 1U4NA 4B40A 2C2HA 1WCXA 1CJBA 2REQA 3C85A 3KPWA 1VHJA 2CYAA 4N9WA 2ZYHA 5B1SA 4LZOA 4EHKA 2FUG6 3GO4A 5KNCH 1ZHFA 1R7RA 1U8ZA 2BF7A 1Y5LA 3KWLA 1FTNA 2GJAA 4BO9A 4FBLA 4NXNB 1AN0A 1GEGA 3FHOA 3AIIA 4ZMBA 3PTAA 4QDZA 2MIIA 3KB2A 4ND7A 1LPSA 1V8BA 3D0OA 1OC2A 3LF2A 2GESA 3N2KA 1WHTB 3KQLA 2DCUA 1TA0A 2V7UA 3PF9A 4OCZA 5CT8A 3T41A 1EXNA 2FW8A 3KO8A 4HUQB 2H1FA 3LQ4A 3R5FA 4Q3AA 4PC2A 2CHGA 1ID8A 4I50B 1W73A 3AM4A 4GYYA 4ZO8A 5GV7A 5K7SA 5KTKA 2Q5FA 5AJVB 2QAGB 4US0R 2H4HA 4IV0A 1QHEA 3PUKA 1ZRHA 1FQOA 3S2IA 1KI4A 1X1CA 1VSBA 3EOAI 4MKIA 4RCVA 5JYBA 4XAQA 1JEYB 5EHQA 2XMBA 1MX9A 3VO8A 2B4AA 2AW5A 3NBQA 2H2HA 3ZWCA 4JI5B 2ZIEA 2F55A 1KH3A 3PYMA 5A9SB 1H2WA 2P2YA 4WBNB 5IS2A 3WB0A 4K05A 4H3VA 5ELXA 2B0JA 3NRJA 4DR5B 1I01A 4R81A 3PWSA 4TVKA 5EERA 2HF7A 3LDUA 3RS7A 3TIXB 3HXMA 1JVNA 3GPIA 4IDHA 5CVDA 3GQBA 3DWEX 4I50F 4MUHA 4B3CA 3SJ7A 3D7RA 2RAVA 3OZVA 4R4JA 4CLHA 2F3TA 2YDYA 1VB3A 4HQNA 4U2GA 1LU9A 1E79D 4U5QA 4BFWA 4TVOA 3CUWA 3KUUA 5CFLA 2VTDA 3ESQA 4HRAA 1GA4A 2WI8A 3VZCA 3ZTYA 5ERGB 3OIGA 5HMMA 4PSKA 2R8RA 4DZTA 2GXQA 1N5MA 1Y3FE 2XY4A 1RBYA 1HYHA 1DIOB 5ECGC 2C8JA 4FNMA 3WX0A 1IWPB 1H2FA 2A7QA 2P4SA 3WNZA 4RKYA 1QIKA 4RBNA 1C7EA 1U1EA 2PRIA 1PWHA 3DAYA 4O25A 3IUMA 1AU9A 1BTOA 4ER5A 3FNRA 1QP4A 1SN7A 1EU1A 3Q88A 1QK5A 3DKVA 3QHPA 2ASEA 4I9HA 4R3UC 3QYFA 5IH3A 4BV3A 1GNPA 1W29A 5IBPA 4TKVA 1GU0A 1D1QA 2HBZA 2Z09A 2Z30A 4B2LA 4BNKA 4OYRA 2R86A 3G5TA 3CW9A 3IURA 4B3DA 2CXSA 1N6OA 3KLPX 4KXXA 4NJEB 5JAZA 3A6PC 5K1ZA 1BMDA 4R9UC 3UUWA 3HMQA 5LCXA 1VE9A 3MRXA 3VKGA 2D1TA 2R8ZA 1ISJA 1BS9A 1S8NA 2AI3A 2HCFA 3C8ZA 3H6KA 1I8TA 2XAUA 3PNYA 1WMDA 2WJVA 2QUZA 3BILA 1CUVA 1RCFA 1REQA 2B94A 2FWPA 4HTFB 3ZQ4A 2A30A 4KG7A 5DWVA 1A98A 1JFFA 4ZODA 2HJHA 2RAUA 1OW3B 2YJGA 2GX6A 3CW2A 4YH1A 3KDAA 4MOWA 1NG1A 3NJ8A 1ZXLA 1D5WA 1NVWQ 2JI4A 3MWJA 4TV9A 3DO6A 2D4HA 3ULKA 4ZYUA 4YRIA 4W5NA 5FO1A 3IR6A 3T9AA 2C4HA 5I7WA 2AFHE 5KNDA 1LS1A 1PN3A 2QF7A 2C7RA 2F8TA 4R51A 3V8PA 1G64A 1DBIA 1JHPA 3CTMA 4XVCA 1ZS9A 1O4VA 3ADOA 1Z9BA 2GEFA 4DDTA 2IHJA 5EMNA 1U63A 2G1KA 2BEKA 3MC1A 2QRHA 2GSWA 2LBPA 3FCUB 4AO7A 3LGXA 4K46A 3KUKA 3GUCA 1TO1E 3T7KA 1W5EA 5BW4A 1SXPA 4GL4A 3ND6A 2NQTA 2PA0A 3D4NA 3H19A 2H1SA 4CTJA 1JPNA 1JDBB 3WXBA 1JG6A 2BI8A 1ISHA 2ADMA 4B48A 3O3OB 1E6CA 3LCJA 1ZKMA 1P5RA 2C7OA 1JEJA 3GEBA 2XNJA 2WNSA 3WGTA 1ADGA 3D6FA 3VR3A 4C04A 1UDBA 1OXTA 4HUJA 1YI1A 1VKJA 2CJFA 3B82A 4QDOA 3CUVA 2JFNA 3VNVA 2ZE6A 4RL6A 1K75A 2XD9A 1WSAA 1IBKB 3SQWA 4ZC8A 4KB5A 4QEDA 4P82A 4PICA 4TXHA 3F8SA 5TQJA 4HAOA 2XCIA 4DA8A 1AO3A 1FB5A 1PVVA 2BVNA 1TYEB 2ZXEA 3EB9A 3OOEA 4Y9UA 5C3UA 4QSHA 4D46A 1WHSB 2MMCA 4V3BA 1YVPA 1Z0IA 1BVRA 2VAMA 3C8HA 1XAHA 3PFNA 1T1RA 2IE0A 2PD3A 2W5UA 3ZJTA 2WKQA 3DFUA 3E82A 1EINA 3ZX4A 1JG4A 1J0CA 2GTHA 2C31A 2N46A 3AIOA 5D87A 2VHXA 4MWGA 3IT2A 1V6AA 2RC5A 2AVNA 4FE4A 3ECSA 3A10A 4MQLA 3R9WA 2X58A 2X0KA 1GNRA 1U0HC 4IDDA 3VDXA 1ESEA 1VCMA 1B8PA 2JIOA 2OCLA 1XD2B 3LL4A 5AJYA 3LTNC 1ZVVA 4M1MA 4W99A 2P7HA 2WJJA 4S3MA 1X87A 1Q14A 2O8VA 3TWOA 1R64A 3EDYA 3W3AA 2XXAB 1U0JA 2CVPA 2Y0EA 2YFQA 1R3DA 5J43A 1M2EA 1I3NA 1DIRA 2GJ4A 2OLEA 3BSFA 1FP6A 1HR0B 3P71T 3MELA 3EPPA 3P2EA 2WIJA 3KWJA 4UMFA 3OI7A 5LQDA 2JFVA 4D56A 3RBXA 3E61A 1V8FA 1U5AA 3RIHA 1JWBB 1GAJA 1ISMA 4WUVA 3DPSA 1K9SA 4HAVA 4KXQA 4BO8A 3KTAA 2EJVA 2H92A 2WKWA 1HLPA 5LBTA 4BVLA 1O57A 5KDLA 3T3EA 2ZTVA 1KYZA 3MAGA 3O82A 4H7PA 3QJGA 4A36A 5AW8A 3WNQA 2XSZA 1CVRA 1E58A 4ZGBA 1L5FA 1O03A 3TSAA 4UU7A 3UJNA 1GUZA 1E1QD 1Z4KA 1VPTA 2C78A 5E95A 4LRWA 1IL0A 2AOWA 3NHZA 4CF4A 2CHEA 1V41E 4V0KA 3SK0A 3TQIA 5GGXA 3AB3A 2GAOA 4YREA 3GFQA 1EDOA 1N2HA 2EX1A 2XE8A 3OTIA 5J59A 4Z2AA 5IUJC 2DY1A 3CN9A 5IFLA 1S8OA 4KXLA 4YMWA 1AKUA 3B70A 1H0RA 3Q7TA 2EG9A 5G4LA 3F6BX 1L8QA 2PIDA 3H7IA 3LUPA 4RF2A 4ALIA 5HX7A 4UEWA 5BQPA 1YV9A 5CA1B 1VYVA 4WCFB 4BMZA 1E1QA 2DBRA 3AR9A 3DE4X 1CQIA 5ADHA 2RFLA 1Z7WA 4J2TA 3EXHC 1AKMA 5BNWA 4JKYA 1XHEA 2GN9A 3F3MA 1ZNWA 4ZI7A 4PQGA 2CBZA 3DYIA 3RD5A 3AOEC 4I1UA 1C9KA 4FC7A 2X22A 4U7DA 3TOCA 4P86A 1UJMA 3OZDA 5EEGA 2WFMA 1OZHA 4IRMA 3RGWS 3CRZA 4M83A 5LP6C 5HJEA 1D2HA 3TPFA 3TOSA 3QQ5A 1Z16A 3H7AA 3NPMA 5EIOA 4L4ZA 2HDNB 4ALLA 2BGKA 3AESA 3U2QA 1E60A 4YPFA 4MLCA 4G0NA 2DFLA 3EIEA 1FFEA 1O95A 5ALXA 5C4IA 1UPFA 1Z73A 2ZI6A 3M3HA 5CK4A 3K71B 1UUFA 3ICCA 1BE8A 3KIPA 4B31A 5B7PA 3H4VA 3HVJA 3CLSC 3ZZNA 2PBLA 5FX2A 4N54A 3GCGA 4M1SA 1FLVA 3LOQA 4WNAA 3N39C 1YR6A 2HJRA 3JAWB 3SP1A 1CZNA 3DPUA 1DMRA 3LGSA 5B1IA 4D4KA 1YMQA 3AF5A 3V1KA 1Q95A 1I1OA 5CFRA 2NN3C 1KZ7B 1SU4A 5A5DA 2MSNA 3G8DA 2ZVJA 2I5PO 4N6OA 4OXYA 3LLUA 5CYGA 3MBKA 4IEIA 4P6VF 5DWDA 4K9OA 5EUQB 4ZU6X 1W93A 1V37A 2R48A 1EM8B 1UJCA 3QVUA 3G88A 4B3XA 4BLUA 4O4HA 2Q21A 1GHTA 4MA5A 5BSWA 1QHHB 1W9HA 2Z4TA 2X4LA 4QG3A 1NTOA 1A4XA 3I1JA 3GCZA 2YXBA 1TAQA 4V3CA 2EW1A 4QYSA 1ADFA 1N5KA 3WGUA 3RYCA 1T3HA 4AKGA 4MYTA 3QU9A 3E15A 4OU4A 4ZP1A 1Y7LA 1AHNA 4Y2QA 1EGHA 5ENZA 4Z2YA 4LF4B 1YK0A 1KJNA 1NIPA 1G2OA 2CNLA 3GBSA 4Q4HB 1U2QA 1UFRA 4F4HA 2R97A 1RJFA 1SELA 2QMYA 2CFSA 3O1IC 1XZPA 1NJGA 2PJZA 4LZNA 1JEOA 1PV2A 1M73E 3DFZA 3AUXA 4KYTA 4FJ2A 4FXPA 4M1OA 4GZ6A 4DCMA 3HBMA 6REQA 1GU1A 1X80B 2EJUA 3F5FA 4WXRA 2QTTA 3ESXA 2CJXA 4X95A 3L0SA 2PL9A 5HZMA 2G77B 3H3FA 4B32A 1SUFA 4EGAA 3A05A 3WLLA 2H1RA 5JFOA 5K3BA 4GXNA 4IOMA 1KORA 3HM2A 3VU0A 1DIAA 1Q1AA 1XIVA 2Z8ZA 1C50A 3C5VA 3R6WA 3SBDA 3HNPA 4ZT4A 4XJVA 4E12A 2Z57A 5A3RA 1XNQB 4EJ6A 2FW1A 3T7DA 2YJTD 4W5HA 2EIHA 5KQRA 1U1IA 3G1TA 1NBWB 3AFIA 4ZKDA 5HP4A 5SY6A 1A71A 2YRWA 3Q8WA 3RWBA 1T9KA 3GPLA 3B6KA 2OV3A 3NDRA 1SVNA 1JKIA 1U81A 3EG5A 3KZMA 2QUKA 2R7KA 5JCOA 1FTQA 2A3RA 3CLTC 3NYRA 4RZQA 3TLEA 3BHMA 1GNLA 1H4TA 5CM8B 1I4DD 3HDVA 1JEAA 4R1NA 4JN6B 4NJEA 1A5AB 3F96A 2P2CA 3T94A 4PRKA 2G6TA 2MYUA 4X93A 3PF8A 2CLHB 2EZ9A 2ZRBA 3TQOA 2ZYIA 3HEMA 3B51X 1ZGAA 3GAAA 1IY9A 3LKZA 3NHKA 1XU7A 4J0GA 4P4SB 3TMAA 4ITUA 1ACMA 3O74A 2YIJA 4NS4A 4YJ3B 3FG9A 3G9UA 2E87A 4HEQA 4BNFA 1DEAA 4RD3A 5EHNA 4JNCA 1CT9A 2E5FA 1Z3CA 3PQEA 4TXMA 3RS0A 4ALKA 1R27A 1OU4A 2WG0A 3OE5A 3OFKA 2PMKA 2QLFA 2WTBA 1I0IA 4E3WA 5LLDA 3KXPA 5DEOA 5K8VA 4AU1A 3IFSA 4RULA 1WG8A 4D0GA 5BVHA 4BU1A 3RJTA 1Z6GA 1WW2A 2HBRA 4U63A 3C43A 4HGYA 4FYPA 2FFAA 4L8GA 4U3JB 1IEWA 3RTAA 4ABYA 4B4UA 5JD5A 5H8WA 5JC8A 5TQ0A 5A4DA 2BKUA 5CX1B 1WXEA 2Q6IA 4D9CA 5FPPA 2IYWA 1FDWA 3F5DA 4IRXA 1VL8A 2PT5A 1W4LA 2CXTA 4C7BA 3DDWA 3ETNA 5HRCA 1H3EA 2ZDHA 2AJDA 1JHRA 3QYJA 4ISCA 2AD5A 2H4WA 2D1QA 2P65A 3PQ2A 2RGYA 4O2BB 5B7QA 5JXIA 1DIGA 4PANA 2BBSA 3SGLA 5FLYA 1HI9A 2Q5CA 1JSRA 3AR7A 4PGAA 3R7LA 1FXWA 5HWSA 4XD7A 4PX3A 3SG0A 4YCNA 4BQFA 2I9PA 2Q1YA 3R44A 1TU4A 2OVFA 4XSVA 4ZJYA 4GBED 3F3KA 3B1ZA 3G7NA 3DF9A 1JEYA 4OYHA 2RH8A 3D6JA 3OCJA 3PYLA 4IF6A 1XQ1A 3MYYA 4DN6A 3FOBA 3H9CA 4A2WA 2A1TR 1OFHA 2X8AA 3HKDB 3QBDA 5D6NA 4MX8A 1RJEA 4G5OA 3JYQA 1X42A 2W43A 3PGJA 3TZCA 3BORA 5ALDA 3CXUA 1YC5A 1W88B 2HBQA 1CU1A 4IWNA 5KU1A 1ZVQA 3L4JA 1M72A 3C4QA 3H0EA 1NWHA 5C52B 2LUOA 3TDMA 2R44A 3HJBA 2IYOA 1VLHA 1FRFS 4AC9A 1H5NA 3UKJA 5ALVA 2E21A 2PMWB 1W34A 4WBSA 4PBSA 2XH8A 1XRLA 3W78A 1ENOA 1G5RA 2J4CA 3BG5A 3CEAA 1BCSA 5A7HA 5JBNA 1V5EA 4IX9A 3TM4A 1NQUA 1QG0A 3K70D 1UP4A 2MINB 1O77A 2HWXA 4D99A 3UJHA 1FSSA 4FOPA 5KINB 5E3HA 1A9TA 1K7FB 1TUEA 4DGQA 4C2TA 2HFKA 2QPLA 1RWWA 3TXAA 1YFKA 2UYGA 3GWZA 1DWPA 2W71A 5JUWA 1JEQB 1OBHA 2FGKA 2IP1A 1IE3A 1F06A 4IGKA 4EPVA 1SC3A 2XOXA 3BZUA 1M2NA 1CUEA 3PQ5A 3BXXA 3N8IA 1RHMA 5JNSA 2QGZA 3TINA 1IQRA 1E96A 1KDOA 3A4YA 4XM2A 3PICA 4X92A 3QELB 1LV7A 3BXHA 2AEFA 5ANRB 1YZVA 2NXWA 3VU3A 4UTVA 3IHKA 2XBUA 4UXIA 3RVBA 1C7RA 3K8YA 1KK0A 3Q87B 4L75A 4WRRA 4RKFA 5H59A 3T6KA 4DIOA 3OQ1A 3R5XA 1W85B 1XZ8A 3IDZA 3U3XA 3M1IA 4UTOA 4MRRA 2YN0A 4W6ZA 1J42A 2FSGA 3K9CA 1FZQA 1I9GA 3O47A 3OZIA 3EGOA 1ECBA 3HB7A 3F8WA 5FPKA 1L7BA 4FFBA 4L2IA 4J7XA 5KYKA 4M8SA 1U3TA 1BH6A 1PL7A 2FPGA 3JVEA 1MA0A 4KAXA 1Q2XA 2PRSA 4RJ2A 1MOQA 3BH0A 3ZK8A 4F9FA 4ZCRA 1SGWA 1ZM3A 2VJLA 2FZWA 1FNNA 4V0MA 1ORIA 1TZKA 3IVMA 3JASB 1V1JA 3WLHA 2OAEA 2G88A 3NW9A 1BA3A 1QJCA 2G4VA 5GIPE 3CVUA 1H6CA 1P1JA 5HPYB 3GK3A 1B15A 3EEYA 2EFEB 2F3PA 4QUBA 4O0MA 1KP2A 2VYVD 3COZA 2FB9A 5BURA 1Z56C 2BM1A 4NLLA 1MB0A 4QDUA 1SURA 2GFQA 3IIJA 2P6NA 3RANA 5L3SB 3VSBA 4CKZA 4F3KA 2LWIA 2N3ZA 4Q18A 4Q01A 3HV2A 2EFDB 4H4CA 1RPTA 4H7HA 4D9EA 4EYQA 4EFNA 3GEPA 3GBPA 1RWNA 5AHOA 5C4GB 7MHTA 2E1RA 3NWPA 1FFBA 5IDXA 5H1YA 1YRLA 3HUEA 4FE3A 1Y5IA 1LPMA 1AK9A 1TYDE 3AU9A 2C4TA 3D7LA 4QOGA 2G83A 3ER6A 5DOVA 3DMPA 1XPRA 1M8PA 1KJIA 3DEJA 3I8OA 3LWZA 1EIWA 1P62B 4KKVA 2PL5A 4M9SA 3MG9A 1O5IA 2A2ZA 3DGEC 1V8DA 2LD4A 4NJMA 1K6EA 3ND9A 1WBJB 2ZSFA 4UAGA 4YECA 5IZCC 2RGBA 3L0BA 4R8SA 4FX2A 1VIDA 1Q91A 3WIVA 5CVJA 4QULA 1WB9A 2ZT5A 4KR2A 4R2MA 4Q4JA 2Q3HA 3RYIB 1EJBA 4AKIA 1MR3F 1EGAA 5FA6A 2IBTA 4G8BA 1V96A 2I3DA 2QRQA 5H82A 2YBDA 4E30A 4OXKA 3TX2A 3W0LB 1G3UA 2VO1A 1IM5A 2FFRA 2VP2A 1RWKA 4ISBA 4MKRA 1KAQA 3ZXUB 2Y4NA 4EECA 1UT6A 1CERA 2QMQA 1QRSA 1N1GA 4FZJA 3FTEA 3A9WA 3UIEA 2CZCA 2Y0CA 1SBHA 2D59A 3OJ0A 4NEQA 1E5XA 3GUVA 4S1OA 1HT2E 5MN6A 3RAJA 4A1OA 5L3QB 1AZWA 1VHDA 3CLUC 1OXBB 2VCEA 1QFZA 2RGWA 4W9NC 2H5IA 1OI7A 4WA7A 3BEDA 4DLTA 1S2LA 4ZMRA 1Z3IX 3MS7A 3OJLA 1Y8ZA 3KHTA 4PO3X 2OCYC 3IT0A 3UXEA 4COOA 4QU0A 4K2AA 1ZIYA 2WMDA 4EO9A 4J1SA 5D3KA 2E49A 2Q3JA 3RIMA 5CNIA 1YF3A 1W87A 4MQ5A 5F9FA 5JATA 4MQ6A 4MH0R 5JLAA 1IG3A 4K2HA 5JSKA 3IB3A 3BMXA 4QUKA 1CQZA 4K9DA 5H3CA 3HP1A 5A6SB 1QAOA 1OI3A 2ZG6A 3FBGA 4WZAE 1FJXA 3ZE9A 1YKSA 3FOAA 1RYFA 4OB6A 5ESRA 2VZ8A 4J2HA 3G7UA 1E8DA 1DFHA 2EDAA 4BJ5A 1QMGA 2WWHA 3H5AA 1JB1A 1JG1A 1WDLA 1GFIA 4IIGA 5JAHA 2O19A 2O8EA 1YNSA 3LWBA 1P3DA 4PGHA 5T4EA 1UJNA 1TLLA 1IYZA 2YHSA 3TGWA 4B35A 1AB5A 1BO6A 4B73A 2GUWA 3QKRB 4RH3A 4N5DA 5DNCA 2WF5A 1N0VC 1HDGO 3Q5GA 1W1UA 2WSBA 3NNNA 2B2CA 5A7GA 4ATNA 4NYIQ 4CIDA 5FEMA 1OLSA 3R24A 3HE3A 2ATEA 1RQRA 1ISIA 4RJKA 2IVFA 4TX1A 5THQA 2QTAA 3RS8A 1MOSA 3EC7A 3VRHA 5GWXA 2YV4A 3ONWA 2JLCA 2O7RA 4GGMX 5SV2A 1GL9B 4E5VA 4C08A 1TTTA 3N2GB 4PNHA 4C4PA 4Z51A 1ZGGA 3RADC 1OTYA 1PZXA 1UMCA 1D9ZA 2IZ5A 2DLDA 2P1ZA 2ZE7A 1WXXA 4GE3A 2IT1A 1RI1A 1ZD8A 1JU9A 1T1SA 4GM0A 5DH9A 4ZRMA 3OJWA 4AJEA 5A2GA 3NAQA 5FBRB 5BSHA 2I2DA 2CVZA 3O9ZA 3N74A 4RMJA 2ADFA 2BJVA 1H8HA 1XRNA 3WIBA 3GNSA 2QM3A 5C7OO 4BFCA 2B8TA 1R0YA 1JFRA 1SVMA 2WG2A 3QEMB 1UANA 3ZVKA 1O54A 3QLVA 3WMRA 2K7FA 3TUIC 3K4PA 3Q15C 1AG9A 4Z4HA 5CFMA 2B92A 4NBWA 3IE2A 1E61A 2JA1A 4J3NA 2VP5A 2VJYA 3QOWA 3NOVA 1SXGA 5AJWA 3DYVA 1EUZA 3PXXA 1A7AA 3N2LA 1MAVA 3ICOA 4BX2A 3AI2A 5F1OA 3VBEA 4B17A 2CY0A 1DTEA 1RM4A 1ND5A 4NYJQ 4S1NA 3ZGNA 2OZLB 1NY5A 2UZ1A 2VDPB 5BMOA 5H4GA 1RU3A 3R0QA 1W47A 4UHDA 1J0XO 2EW8A 1EUCA 2OHFA 4G26A 1N6NA 1WA5A 2P9BA 3F1KA 4LMAA 4PNPA 1ZK2A 4DLAA 3S68A 3GUZA 1NXTA 3OU2A 3A25A 3WBBA 4J8PA 2GZDA 3RSQA 1MV8A 4IUDS 4S1PA 4B6OA 3PWZA 4EWLA 1VM6A 5BN4B 4ECAA 3M8KA 1TCUA 2OSBA 4EB3A 4B6FA 2GBPA 1PDVA 1B8OA 4D9FA 3V8EA 1Y1KE 3AONB 1J8MF 3L1VA 4HDRB 3HJNA 1UOQA 3ZWKA 2F64A 2X9NA 2YUTA 3DE1X 3R9KA 1HKUA 1YL5A 1XVIA 2O3QA 3N0RA 4LHEA 1W5TA 4JLNA 2CZQA 3P9PA 1PR5A 1R4MA 5TGTA 4ZJUA 2JHGA 5LQCA 2OOSA 1X15A 1GPWB 3OSZA 1DINA 3I0MA 3FDZA 2V97A 3SE7A 3DUWA 3LTEA 5DCYA 4D79A 1GRRA 2YICA 4CE6A 3JZFA 1E4OA 3ZGLA 2VK4A 4NE7A 2ETVA 1PQWA 4P2GA 3T9BA 3RR2A 3F9RA 1DXOA 4G0OA 5IJ9B 4H3KB 5CT6A 4UM5A 2DWOA 5C51B 4LI0A 4LWPA 1YJQA 3VYVA 4BNJA 1UXHA 4RE6A 2AC2A 4F8YA 3I1YA 3DD5A 3PDHA 3QW2A 3S28A 2CUTA 3H99A 2IYVA 4EEKA 1ZESA 2FMFA 2R47A 3PJDA 4GRIA 1U7UA 2DPYA 3GGJA 1R1DA 4ZDWA 3K1AB 4A2CA 4RA9A 2PXAA 2Z4RA 3LF1A 1L1FA 2FWRA 4BKMA 4KJXA 3WNDA 1T91A 4NARA 4WCFA 5CEJA 5DU2A 2NZUG 2Z08A 4G0UA 2A6PA 1M0EA 3M89A 1JFTA 4XWWA 4C22A 1LK0A 4EY6A 3OIYA 1LDGA 3QVWA 3QPDA 5CITA 3W2FA 4I9GA 2YDXA 1J0EA 1R8SA 5F7JA 5TX7A 4RQUA 3T1YB 2M1XA 1SVSA 4KQKA 5DHFA 7MDHA 5EJ9A 1GJRA 3IJEB 2JDIA 4L3OA 5K3DA 3G6WA 1SUSA 3L04A 1FX1A 3A1SA 1JPUA 1MHPA 3EODA 1KR5A 4G09A 3TFWA 4B1FA 5IJ9A 1Y4DE 1IRXA 1E89A 2VIIA 2ZI3A 2Y1XA 3S7ZA 3WIEA 4RTLA 4JLJA 3D5EA 3GFOA 5EP4A 2G0AA 1P1FA 3S6JA 4BDSA 1BS2A 2ZTLA 3SSMA 3VKFA 2JI6A 4CDRA 1O9GA 3CKLA 4YRPA 2A94A 5LYJA 1T0HB 1U65A 4LQDA 2BR4A 4N3AA 1UFQA 1EB8A 2QD4A 4JX9A 5B58T 4JA2A 2O5EA 3CR8A 5T7BA 2ZJOA 3H9JA 2JK0A 2VS1A 5FNZA 4K87A 3O2SB 3UV6A 3NC0C 5E3JA 3ANSA 1BWPA 2CXOA 5JH7F 4UDYX 4URHA 1OH6A 5A1TA 1Y34E 4GP6A 1KRHA 1RCTE 2RCYA 2R2AA 1PG0A 2FN7A 2X0JA 2NO6A 4GXTA 1NLYA 1TJ5A 2E0IA 3PS9A 3N0XA 3PRJA 2WSLA 4UW9A 4MVJA 1Q0TA 2RE8A 1XD2A 2C2MA 1NM5A 2YY7A 4BBPA 1A5ZA 2QY9A 3BK7A 2IKQA 5CA0B 4YR7A 1IUPA 4Z3DA 4I2VA 4HG2A 3VHXB 1I6LA 1JALA 1I3OA 1EP2B 2R7MA 1BJTA 2X3UA 3FKSA 4ZWNA 4BO4A 4RXMA 1E69A 1MFPA 3NBKA 2WYIA 1CY7A 1F9EA 1HDXA 4TMYA 3L05A 4LJAA 3UWMA 2I4IA 1TT5B 3I39X 2P30A 3ZY4A 4BB6A 1KYIA 5D01A 4XCVA 4CKEB 1V5WA 3HN7A 4GMDA 4HLUA 5DP1A 3SZ3A 4DLWA 2V6IA 3PKZA 1JA9A 3KRTA 1XNJA 5T4FA 1TECE 3T9FA 4QE3A 1X1BA 2DUMA 3O4GA 3TMYA 1YQWA 1AH2A 2H9AA 1MO2A 4JVNA 4NAHA 3ZBPA 4E94A 3FSRA 4Q02A 5IBRA 3ETEA 3UQZA 1JHQA 4ZO6A 3R5TA 3PQ4A 1Z12A 4L8YA 1UJ5A 1YRYE 3RW9A 1QGED 3LP8A 2F6RA 2TRSB 4E5YA 3LFHA 5LZ7A 5AW5A 3A70A 1AJEA 3CH6A 3OKAA 3M9LA 3JZIA 4CM5A 3COJA 2AG0A 3BQMB 3FI0A 1U28A 3HCWA 1WETA 4R31A 5FLKA 2GFIA 1NW4A 2EF0A 4MS1A 4NCIA 4P5DA 1A95A 3Q41A 5I4KA 1DPFA 1PNTA 4KZKA 4YO7A 4DHWA 1AKRA 3KYCB 5LWQA 2FZ5A 5DYYA 3BCHA 3CF4G 3I8XA 2B1JA 2QL7A 2C2KA 3TLKA 3JRXA 3ZBTA 2JLZA 4URWR 3QTBA 1OKKA 3PSAA 2O54A 1KJ8A 3OF3A 2Z98A 1CUYA 3O83A 3C7KA 3PZBA 4NENB 3OPMA 1ICEA 4U2CA 1JHZA 4O1HA 2IWRA 3RUIA 4XIJA 5CYOA 4DG8A 1BHSA 2NLOA 4OI0A 4M86A 2QRZA 4UCFA 2W8BA 1Z26A 1UQTA 1WRBA 3I4CA 4PG5A 5G0UA 4MKFA 1NT4A 2XB6A 3UEOA 1J8QA 1VYUA 3ZV3A 1IPHA 3HZZA 3K2EA 2QEQA 3N75A 4IO1A 3OMWA 4R2IA 3GXOA 3HCRA 1UKAA 4ZV7A 4A91A 4R40A 4YRAA 3AFMA 2YOGA 1IVYA 1NNUA 3AO0B 1DT5A 2H7YA 4ZVTA 4F2PA 2GGSA 5HXAA 3V8RA 3H86A 2YBEA 4LK3A 4ZREA 1PR0A 1Q5PA 3KU1A 2WJPA 2IK8A 4LF7B 3E8SA 3AILA 1PGQA 4MNTA 2B9EA 2NOAA 3U3JA 2PA3A 1QANA 4F71A 3TTUA 1RBQA 5BMVA 2XYHA 3M6XA 2YV2A 1TADA 2XYRA 3JS5A 3QIAA 1UXKA 1IUKA 3L0DA 2C7GA 3A7EA 3MLBA 3QEMA 2O8CB 3A3NA 3BICA 3DTVA 3P26A 1N2CE 4FUTA 2I1WA 1KVSA 4UU8A 2QTVA 3IRVA 3O90A 2C4MA 2X40A 4IQFA 4G07A 3F7TA 1SZDA 2FR1A 4GKBA 4KWIA 4LYDA 5AKKA 3VZSA 4D81A 2AN1A 1QJ4A 4RX1A 3VDNB 4EY4A 2YIMA 2BV3A 3BXPA 4TUYB 2JATA 3W2EA 4CQLA 3QVJA 2PZGA 4WCVA 1RE0A 4NYIR 1ZJZA 4TVBA 3K9NA 3UK7A 1GLNA 4X90A 4NY1A 4TPKA 1GKLA 2P6PA 1DP4A 3GZ4A 4OQZA 4K9LA 3QI2A 3TLGB 3ZS9A 2ESRA 4WXPA 1FU8A 1FK8A 1KZ4A 2BP7B 1MIHA 3OD5A 5F21A 4MWSA 4Q48A 3ZE6A 2PL3A 3ZD9A 2E4XA 3SWWA 1LZLA 1VA5A 4EL5A 3AR4A 3HCEA 4ENVA 1HT1E 4OIMA 4AG3A 3AHIA 2I87A 4KWTA 5LR6A 1NWCA 3UHJA 4IYJA 4AP9A 4HFJA 4TKUB 2E3JA 1ZN7A 4B7UA 4M4SA 3RUFA 1Y33E 3F6YA 4U00A 3TQHA 3MJDA 2YNMC 4Z0PA 1MAWA 1YB7A 3QVGA 1KKLA 2P40A 1M0SA 1TYCA 2WFLA 5LDDC 3MN1A 5KYUB 3UJCA 1L5YA 2B6HA 1T0JB 3IKMB 4PZDA 3IAEA 4DLVA 5HOEA 2OD9A 4DAEA 1N34B 3GPBA 2A8YA 1M8JA 3W6NA 3B6IA 3FH0A 1NI3A 3HPRA 5IEJA 1LUAA 5H5JA 3F8TA 4QUDA 1C7JA 3KM0A 4A6EA 4JEMA 1MP0A 1SRRA 1E92A 3P2KA 4HDSB 4JJ6A 3RVSA 2CFOA 1Y48E 4YHBA 3U7QB 4NAUA 2RAFA 4L4SA 4PLVA 3U1TA 3BUSA 1KI6A 5DPMA 2CXNA 4ARAA 3D9QX 4KR3A 2A0WA 5E6SA 2PKXA 1KRXA 1VL1A 2AR0A 4FMDF 3NCHA 1PR2A 2VDLB 4L1KA 5AICA 4FN5A 3QE4A 2PD6A 3PD1A 3A1FA 2H00A 1M7GA 2XQVA 4CI9A 2HU5A 3DNPA 2WHQA 2FLKA 3HCOA 3OT1B 5K5EA 5KVCA 1AKNA 1WW3A 1GILA 1M8GA 2FQQA 2HXYA 2PY6A 2V45A 1X7ZB 4JP3A 4MINA 2AE2A 5TVKA 4BNDB 1CZRA 4CEJA 1K66A 3Q0IA 3IL2A 2VDJA 2FMIA 3WMFA 5A9SA 5KWVA 2F43A 3COVA 1FLDA 3ENNA 4GP7A 1AD2A 2RKWA 3E7FA 3GGDA 2I1QA 3SZRA 3VTZA 2GXAA 4HOYA 5WRFA 3AETB 1ODJA 1WMFA 4BHTA 2OFWA 1P0PA 3TIFA 1X7YB 4EJ0A 2GBFA 2JEOA 3IKLA 1OBOA 2BSXA 5KQLA 2EW2A 5B36A 4DJJA 1JEDA 2BGUA 5AT1A 4IMJB 5AVJA 3INTA 1XRQA 2BM8A 3E5RA 3FKSD 4MVYA 2B1IA 1II8A 2C8KA 3U4QA 1SQSA 3H4TA 3WQSB 9ABPA 3SFVA 5JNRA 4Y9SA 1NBAA 2O05A 2ZTSA 3NKLA 1TUBB 3QX9A 1HPLA 2W2OA 2XVAA 3GT0A 4MXDA 5H81A 3STYA 2OPBA 1A8HA 4AY3A 1ZJWA 1L7QA 2RGNC 4YQZA 2YWXA 4KW7A 3W5BA 4XI9A 4Z3OA 1BIFA 2IY9A 3ZWXA 4DEYA 2JBHA 1ECPA 1IN7A 3FLMA 5M3BA 3PKJA 3ZD8A 1KWKA 4IY1A 4WZAA 1PLLA 4QNMA 1MQSA 1RXEA 4JWKA 4BNDA 1E77A 5K8IA 4CEJB 2X9VA 3RKUA 3QEAZ 4XIFA 4EMUA 1UBFA 1ISGA 2V5VA 1XO1A 3RRZA 3ZJ4A 1RXSA 2QX8A 3GJSA 1XYVA 4L74A 1TVMA 4RF5A 5LBIA 3T54A 1NXXA 2ZRIA 3LHKA 4KVFA 1MRNA 3AJRA 3IYLW 1T6BY 5HYVA 4AZVA 2I65A 3F5SA 4MJ7A 1P75A 3OQMA 4PIVA 4YYZA 1EFLA 1TM2A 3P4YA 5JAQA 1YK1A 1WKBA 5C34B 3ZIAD 4ER6A 5BORA 1X7YA 3A9TA 3U3DA 4R9NA 1EFRD 5AKEA 3VNRA 3ZV7A 1AN9A 3DZJA 1LK7A 4LYAA 5SYAA 2BZ1A 4H6PA 3W1WA 1T3SA 2IYAA 5DGIA 4PC7A 2NUTA 1VQ1A 3WI7A 1M6VB 4O2BA 2Q7XA 2ZPAA 5KJ1A 5A06A 3D6VA 5D2CA 3LUFA 1L5OA 1FRZA 4L6CA 4DC1A 1I36A 1J8YF 4G0ZA 1DU4A 2DT8A 5IJ0B 5GONA 1YI0A 1UKVY 3LX5A 5I9IA 2XLCA 1T5DX 5K2OA 1G6OA 1GCGA 1TC2A 3RQIA 1JI3A 5KJ6A 1JI0A 1L4LA 3UFXB 2BEVA 2HA4A 4POOA 2BFEA 3N58A 1KJWA 3CVWA 1Q83A 4PV7A 4X1OA 1NNEA 4E2YA 3CPJB 3TD2A 2C2OA 5E4JA 1F0PA 3E9RA 3CGGA 1VRVA 4L72A 1EP9A 1KFEB 1UEIA 3EZXA 3I23A 4MHOA 4FDTA 2HTFA 1TVCA 1KC3A 5A71A 3A6GA 3M5DA 3SU8A 4UFOA 1RRVA 2EFHB 5KJEA 4WJKB 4CMJA