1E3WB

Rat brain 3-hydroxyacyl-coa dehydrogenase binary complex with nadh and 3-keto butyrate
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
255
structure length
247
Chain Sequence
SVKGLVAVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGGNCIFAPANVTSEKEVQAALTLAKEKFGRIDVAVNCAGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLLTFLASQVPFPSRLGDPAEYAHLVQMVIENPFLNGEVIRLDGAIRMQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of Structurally Diverse Substrates by Type II 3-Hydroxyacyl-Coa Dehydrogenase (Hadh II) Amyloid-Beta Binding Alcohol Dehydrogenase (Abad)
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Dehydrogenase
molecule keywords SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
total genus 92
structure length 247
sequence length 255
chains with identical sequence C, D
ec nomenclature ec 1.1.1.178: 3-hydroxy-2-methylbutyryl-CoA dehydrogenase.
pdb deposition date 2000-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1e3wB00
2B37A 5T57A 4AJ2A 2B5WA 1P31A 3INGA 3RVDA 4EI2A 4CLEA 3ZDFA 1NPDA 1EUCA 1FDVA 2C54A 3ZWYA 1XWFA 1AHHA 3AI1A 3DBHA 5FWNA 1SO8A 2DBRA 2HRZA 3CPSA 2O7QA 4BIIA 4BMNA 4AJ4A 3H3FA 4ND3A 2DKNA 5T8KC 4B7UA 4GSKA 1CEQA 1HYGA 1LDMA 1I3LA 3DZFA 1UXJA 5ITWA 4J7XA 2DT5A 1GV1A 2EGHA 3RSHA 1GAEO 4PG7A 5DBGA 4BGUA 1TLTA 4FS3A 4IXTA 1I2ZA 5CDYA 1S6YA 4IZIA 1DXYA 4Z9FA 1DFHA 1X7HA 1T4DA 1XSEA 1ZW1A 1ADCA 2EXXA 3DEYX 3KYBA 2H6EA 3DC2A 4XZ3A 5L45A 2HU2A 4BO9A 2AQKA 2VHZA 4BNNA 1GDHA 2W90A 5A3JA 4GKBA 3K96A 3A4VA 5F3RA 3UAGA 4CM1A 1WMBA 1ZSYA 3D4PA 2F1KA 3GZ4A 1DLIA 1EFKA 1YGYA 1F12A 2RIRA 4AL4A 2CZCA 1EZ4A 2DM6A 2G1UA 5THQA 2ZKLA 2DBZA 2HK7A 3VZRA 4J43A 3ASUA 1ULSA 5A04A 1HL3A 1QKIA 1M6HA 1NQTA 1JAXA 4BB5A 3HDHA 1A4IA 3SLKA 4F45A 3UKOA 3T4EA 3CTMA 2GRAA 1VL0A 3OQ6A 4JXKA 4CMIA 1A9YA 1CRWG 3AUAA 1E3WA 2R00C 2RAFA 4WK6A 2EKPA 2V6BA 1P3DA 4HUJA 5L9AA 1JKJA 1NNUA 4CM8A 1R16A 5HS6A 4II3A 2V7PA 3RBXA 1U3UA 2D5AA 3V1UA 2OORA 3GAZA 2J5KA 1T2FA 3G79A 4OQZA 3F5QA 4DQUA 2FR1A 1AE1A 2Q2VA 3QVXA 5IXYA 5BR7A 5EQFA 1DHRA 4A73A 2ZYGA 4W7HA 1LSSA 1DRWA 4I9HA 4LCJA 4MVJI 4FD3A 1E6EA 1R0SA 3GK3A 2BGLA 2VOEA 2IXBA 4MKRA 4UEKA 3V2GA 1PJBA 3ZCXA 1I3KA 1LDYA 1YQDA 2Q1UA 1FF9A 3EVNA 3WMWA 1DIRA 3JYOA 4WJZA 1Z7EA 1BWSA 3PWSA 2CFCA 1ARZA 2EP5A 4L8VA 3DXFA 4LSMA 4J6FA 1U1IA 4CMCA 3OA0A 3DZJA 2O3SA 2YUTA 2Q2WA 4RPHA 1AUPA 1T1SA 2Q45A 4I8XA 5EJ2A 3WNQA 4NG5A 3D3EA 3JYLA 5JO9A 2DLDA 4E4YA 1K6XA 2EW8A 4EJMA 5G0SA 2JFFA 5K0ZA 3MJVA 2YQ5A 4L4XA 4NBTA 2X23A 5F21A 1R4NA 3GVPA 3D5QA 4YQZA 4CMGA 1LX6A 4R1TA 4XX0A 1Y9AA 3QLJA 1O8CA 1PWXA 1PJ2A 5F1PA 3C1OA 3KLMX 4OSOA 4N54A 4WLOA 3B6ZA 3R3SA 3FWZA 2I65A 3LT4A 2PA3A 4A5OA 1Y9EA 2NU7A 3K6JA 1G0OA 3ANLA 5EESA 5DBFA 5TT1A 3C7AA 4O5OA 4BKQA 3DB2A 1U3VA 1ZK3A 4DREA 1VL6A 4DMMA 2FP4A 3I9OA 3WTBA 4Q3AA 1E7RA 4RF2A 3AM3A 3JQDA 3GQVA 4XWYA 5I7EA 3INRA 4DVJA 2ZTUA 4M86A 1SOWA 3ONEA 3KETA 2XF8A 2D2IA 2QW8A 1ZJZA 4IJKA 2GN4A 9LDTA 4DPKA 1LDEA 4F6CA 4WCDA 2UVDA 1PZEA 5CPFA 1UXKA 1YBVA 2WWRA 3LLSA 4GKVA 4R51A 5BNIA 5HBRA 3GDGA 3L07A 3AFNA 4J4HA 3U4CA 5EQDA 5ES3A 2HLPA 2P91A 1IPEA 1WZEA 1ISHA 3HE3A 1YJ8A 1V35A 4J9VA 1BVRA 1K6JA 1E7QA 1H94A 4QXMA 1I2BA 2O3JA 5CDGA 3BMQB 3AI2A 2UV8A 1HEUA 1Y5RA 4RPLA 1H5QA 4ALMA 1ZFNA 2AEFA 1I3NA 5U4QA 3H9JA 1FJHA 4HFMA 4EUFA 1MXHA 3DONA 2WSBA 3WDSA 3QSGA 4YRBA 1U8XX 4C7JA 3TN7A 2OOSA 3JQFA 1P1RA 2Y1OA 4KDEA 5GZ6A 5IZCA 1BDMA 1TI7A 3IP1A 3ULKA 4IDEA 3ZNQA 4BOYA 1J4AA 3TJRA 4BGEA 4LRTB 4R9RA 2B4QA 3BAZA 2DBQA 1FMCA 3JQAB 2OL4A 3TQHA 4IGEA 1B3BA 4YAIA 4ALLA 1JKIA 2V6GA 1WZIA 3JQ8A 3WXBA 2ZYAA 3SEFA 3KZVA 1B14A 4J2OA 1J5PA 2NLOA 5B1YA 4J1NA 3ETEA 2D5CA 2Y0CA 1P1JA 2O48X 2O7SA 4O0LA 2B69A 3PFWO 4MVJM 2ZATA 4DA9A 1ISJA 4HV4A 1YWGO 2H9IA 3CKYA 4E5PA 4RLSA 3JV7A 2H5LA 2O3UA 1C1XA 3EMKA 4ZN6A 4FW8A 4HNHA 4KOAA 4XYMA 4RPGA 5I8WA 3PDUA 1U3TA 1WDKA 3GMDA 4KWIA 2IYOA 3TL3A 3WWZA 3F6YA 4WEOA 5U9CA 5IDXA 3OFSA 2ZB8A 1C1DB 1H2HA 3GNTA 1GYQA 1JWAB 4BV8A 3GNSA 4B79A 4HFNA 1CERA 1KVQA 2R6JA 2IEBA 5JDCA 2VTDA 2P4HX 4FSHA 4RQTA 2O2YA 3TOZA 4BO6A 5IFLA 4FFMA 1U2GA 1DHTA 1XU9A 1Y6JA 3DZHA 1ONOA 4TKLA 3OMLA 5JC1A 1E1KA 4MIOA 4BO7A 1KVRA 4Q39A 1Z74A 3BTSA 5C3MA 2WM3A 5JY6A 1ONPA 4B7XA 3C8MA 3HG7A 1YB4A 3IJPA 4W7IA 4BO2A 1IY8A 4IQGA 4JBGA 4YEDA 4G2NA 3E9MA 4OYRA 4PG5A 1PJTA 4TVBA 2VN8A 1QYVA 2AQIA 2C5AA 2HK8A 5B4VA 4WLVA 3WGHA 4DBVO 1WAMA 1XYGA 4Q3EA 3X2FA 1PGOA 2IEDA 3B20A 4ZQBA 2QYSA 5JAQA 1U7HA 4YXFA 4OAQA 2O23A 3ZV3A 3QWBA 2AG5A 2WYUA 2I76A 1SB9A 4IINA 2O2SA 2SCUA 4OSPA 4OXYA 3M1AA 1HDGO 4E13A 4FGWA 3IOYA 2Y1EA 3ICCA 1NHWA 1R66A 3I9MA 4CUJA 5EL0A 1Y8RA 3GT0A 3IC5A 4OKNA 4RF3A 1M75A 1E1MA 1R6DA 2X0JA 2LDBA 1PU2A 1XDWA 4KDFA 4CUZA 4P8RA 1IHYA 4W4TA 1GFSA 1SEVA 4EJ0A 3VPXA 3PYMA 5TGDA 1TVEA 1MC5A 4E5KA 2OHXA 1B0AA 2Z95A 3ADOA 3AU9A 5CDTA 4B8ZA 2GGSA 2VHWA 3Q11A 4BQPA 1A72A 1EDZA 3L9WA 4XQ9A 4NJMB 3U3XA 4BVAA 1DIGA 4I08A 1ID1A 4ONEA 2EP7A 4HFJA 1NTOA 5HA5A 5LDGA 5KTKA 1WDMA 4R16A 3ZU4A 4CMHA 4DIOA 5CG1A 4URFA 2B5VA 1ENZA 1LNQA 3QJ5A 4BO4A 1GQYA 3U4IA 2DUWA 3JQ7A 4O1MA 3I3OA 3I5MA 3ZHBA 4PLPA 3UXYA 5JCXA 1HF3A 1EUZA 2Q49A 3NV9A 1NHGA 4R01A 3LT1A 4XQEA 4PLVA 4R3WA 2RCYA 4PVDA 3D64A 2GLXA 2HDHA 3NJ8A 4CLXA 4KWHA 1ORRA 1NR7A 3K8ZA 4PGFA 1XGKA 5IDYA 4G65A 4BQRA 1JW9B 3BTVA 3DAPA 1B26A 3F1KA 1M2WA 3ONDA 2C59A 1YBMA 4XEHA 1XG5A 1B16A 4MP8A 1BGVA 4A03A 2JKVA 4CQMD 2EW2A 4J1SA 4F46A 2RHCA 4U6SA 3C7CB 1KY4A 1PX0A 4XR4A 3DZKA 1ENOA 3TF5A 1QORA 3I83A 3PJDA 1NVGA 4J91A 4MVJA 1UJMA 4XYBA 4ZD6A 5JFOA 1KIFA 1Y7TA 3MWEB 1Q0HA 1FDSA 1U4SA 1I33A 1VJTA 3NJ4A 3DDNA 3UCFA 1E0DA 4RVDA 4XYGA 1IPFA 1JVSA 4BKUA 3DTTA 1M6WA 3FNHA 4GLOA 4CV0A 1AXEA 3GH3A 4YDRA 5B4UA 1N9GA 4N18A 1MFZA 2J3KA 5K6AA 2PTGA 5DOZA 3AM4A 1NASA 5HTOA 3WQRA 4MVJG 1RJWA 3H9GA 3JQ6A 3PQFA 1XIVA 3FR8A 4BMVA 3R6DA 3C7DB 3W4KA 2OBNA 1T2CA 4ZQFA 1DC3A 1WWKA 1F06A 3ZGYA 5LDHA 4J1TA 2O4CA 2FOIA 1E3EA 4YB8A 5C37A 3KM0A 3UVEA 3OJOA 1LLCA 2FPIA 2V6MA 4B4UA 1TB4A 1O9BA 3JQCA 3ITKA 3D3WA 4RF4A 3U4DA 5H81A 3DZBA 4ND1A 1WXDA 3EDMA 4DIBA 2JFGA 5L4NA 4PLFA 1HETA 2CMDA 1H6CA 4FOSA 2CF6A 3SVTA 3GLQA 3MOGA 4NK4A 5IDWA 5IF3A 1PEDA 5A02A 2X0RA 1E5LA 3GC6A 1CIVA 1Q7BA 3I4CA 3O8QA 4CM7A 4D43A 3AFMA 3ZHXA 2PZLA 3GN2A 3DBRB 3RD5A 1GY8A 3AUSA 3GZNA 3FSRA 1U9JA 1XU7A 3KOUA 4Z3KA 3LU1A 1XEAA 1VJ0A 1ISFA 4LVCA 2NVUB 4D0RA 1B8PA 1ML3A 2EKLA 4ND4A 4DIFA 4DWVA 3K30A 4ROSA 5I9MA 4FJ1A 2PZJA 4DLAA 3E5RA 3W8DA 4GAEA 4XIYA 2B83A 3DQPA 4R9SA 4AJOA 3AWDA 2NACA 3VH3A 3FRJA 4EITA 2AE2A 2UYYA 1LJ8A 5KJ1A 5CP8A 3ROKA 1NM5A 1C0LA 3U5TA 1FXSA 4RVHA 1LI4A 3ABIA 3DL2A 4RORA 3RUAA 1PGPA 2X5OA 4L4SA 4BNYA 3GGGA 4JCOA 4W99A 2Y1DA 3DR3A 3E48A 4NU5A 3INTA 3IUSA 1DJNA 2DQ4A 4IDFA 2PGLA 3BHIA 1K5HA 5K6AC 1CF2O 1DIAA 1M66A 5COQA 2JD1A 2HJRA 1PJ3A 3QIVA 4C7KA 4E0BA 1YOVA 1T1RA 1AN9A 1DC6A 3DHNA 3ZU5A 4BNMA 3V1TC 5KIAA 1Q0QA 4LVUA 4NBUA 1UXHA 1HE3A 1KERA 1PQWA 3W4JA 2X7HA 2P2SA 3L9XA 1C14A 2D8AA 5AXAA 5TQVA 1T26A 1A4UA 1DDOA 4GWKA 2Z1NA 3CEAA 4FOOA 4CL8A 4FFOA 1VKNA 4GPD1 2PH3A 3WYEA 4OGWA 1ISGA 2JCXA 5BSFA 1E3WB 3BHMA 1O6ZA 4WPGA 1N7GA 4JBIA 4OQYA 1JLLA 1KVSA 2R2GA 3EVTA 3GR6A 2VZ0A 3MJTA 3D4NA 3ZNPA 4IMPA 3I9KA 4BNIA 2BHLA 3OH8A 1YVEI 1R15A 2QHXA 4GSLA 3OEYA 5I8ZA 1YB1A 1MG0A 1RYEA 1DIHA 4MPDA 3JD4A 1Z73A 1PTJA 3KYDB 5IXSA 3DZIA 1HDZA 2BKAA 3MTGA 3CIFA 5AXCA 4ZQHA 3A14A 3H5NA 3WICA 3OQ1A 4DBZA 4TRJA 1E3IA 4P38A 4MINA 4TZKA 1C3VA 3GMSA 3B1FA 1O94A 2J6IA 3CMCO 3QE3A 3BMOB 1A27A 3VH4A 3S2FA 2WE8A 3GEMA 4NPCA 5GY7A 2DTEA 1JDJA 4YJHA 2BI7A 3F3SA 1Y8RB 3WGZA 4IPTA 3VVBA 1T2AA 1LQTA 4IQ0A 3F4BA 4MIEA 4OHUA 5ER9A 3DAFA 4W9NC 2B36A 3AK4A 3UW3A 1GUYA 2XXJA 3ZHZA 5J23A 4AVYA 2VRCD 2OFPA 4XYEA 3LT2A 1KYQA 3JSAA 3LVFO 3PHGA 4JGBA 5ENDA 4E5NA 3FNFA 5MDHA 1R12A 4N5NA 4D41A 1VSVA 2C2YA 1OI7A 2E6UX 5DULA 5CAEA 2FN7A 1JU9A 3PWZA 4K1LA 4BNZA 2GDZA 4CPDA 3GN1A 3RFTA 5IAAA 2BF7A 1W0CA 4OH1A 4FFNA 5CFZA 1XQ6A 1YKFA 3JYNA 3HADA 3WGOA 5G0UA 1WP4A 2E48A 3EZYA 3HHPA 1P45A 1DC4A 1H9AA 1NQ5A 1IB6A 4Q3CA 5JLAA 2EJWA 4RCVA 3HFSA 3DTYA 2PKRA 4CM8B 4BUCA 1YH3A 4JJIA 2A4KA 5ILGA 1BHSA 2JD2A 4J0EA 5JDIC 4L0QA 4BNLA 4Y67A 2WJPA 5I7SA 1D4FA 4GL4A 4EGFA 3UHAA 4D44A 1EE2A 1KEVA 1PR3A 3WGQA 2WDZA 5K9ZA 4JJGA 1X13A 2GZ2A 4TRMA 4L4RA 4E12A 4YRDA 1ZJYA 3GRKA 4M87A 1D3AA 2HQ1A 4XCVA 3WLFA 1VE9A 4PLHA 1HSOA 1PQUA 3N7UA 4ALNA 1C0IA 3H5AA 3L6DA 3MZ0A 5LCXA 3AOEA 4XJTA 4XB2A 4I1IA 4UVIA 1EE9A 4I9UA 4OJNA 2AG8A 1T25A 3ICPA 4Y98A 1BW9B 5A3VA 1SOVA 3Q0EA 1H93A 1SNYA 4XRGA 3BIOA 3JQ9C 3ZWVA 2X0NA 3NDRA 2AMFA 3ENKA 2DPGA 3H9QA 4GBJA 4MVJE 4X54A 4IBOA 2Q99A 2FPGA 1HTBA 3I9NA 3Q2KA 4J16A 3W6ZA 3FTPA 2GR9A 3NGLA 5BSHA 2VYND 5C7OO 1M67A 4P4LA 4EEZA 4R1NA 5TRTA 3ZNNA 4UUMA 3GEDA 4GX2A 4IGFA 5JS6A 5DZSA 2ZB7A 5EPOA 3H65A 1ENYA 3UH1A 4XQCA 4A0SA 3V2UA 3L4SO 1E1NA 3A06A 1BDBA 4O6VA 3OECA 3SXPA 4Z0HO 2ZTLA 3ETDA 2Q1WA 4MDHA 4IDAA 4Q3NA 1LSJA 1NFQA 1YBAA 4R68A 2I99A 4O59O 1HSZA 1RM0A 2EEZA 2YHUA 3MJ4A 2DPHA 4MVJH 2DFDA 3AJRA 4UVDA 4YRAA 2A94A 3WB9A 3ENNA 5TNXA 3GNQA 1NPYA 2NVUA 1GD1O 2CSUA 4GX1A 4CM9A 2W2KA 5DCYA 4BNJA 3DOJA 2I5PO 2YY7A 4QTZA 5KJCA 2VNAA 1D1SA 2TMDA 4FBGA 4M89A 2DVMA 2I3GA 4W6ZA 4D79A 3KBOA 4AJLA 1NXQA 3RBVA 4A10A 2BI8A 5A4DA 1Y8QB 1UDAA 2GUGA 4QQRA 4KTVE 3KEQA 3HN2A 4QSMA 3U9LA 4NBRA 3JD1A 3PI7A 1U5CA 3ZWAA 1DAOA 4FFLA 3TZ6A 1O5IA 4BHTA 3M6IA 1YE3A 5DOVA 3JQ7B 3HNPA 1Q7GA 1GEGA 3ONFA 1OAAA 3O4RA 3ANNA 4TMFA 3CZMA 4NJOA 4U6QA 1UUFA 4ZGWA 3JQAD 1NR1A 1ONNA 1DOHA 1X7GA 4CJXA 5H83A 3OIGA 1KS9A 4IDGA 2NADA 2EF1A 2O4UX 3WNVA 5AYVA 2ZB4A 3VKVA 2PY6A 4EUEA 2YFQA 5TSDA 3LYLA 2NNLD 3IUPA 4D42A 1V3UA 4N7RA 1N2SA 2G17A 3PWKA 4OIMA 4OMUA 1HYHA 4RZIA 3E5MA 3FF4A 1NP3A 3JQGB 1LLUA 3E6AA 2C0CA 2X9GA 1F14A 2VWHA 4A7PA 2VT2A 4PIVA 4BS9A 4DXHA 3TZHA 4MKXA 1F17A 3K5PA 4H16A 1EVIA 4GMGA 3TSCA 3GHHA 1V0JA 3C1TA 5ICMA 1QSGA 4FQ8A 5FI5A 1QYDA 2OGUA 1HE4A 1RWBA 3DHYA 1O95A 1ZK1A 3QVSA 1E1LA 2JJYA 5TIIA 4I5EA 2BELA 2VOJA 3I52A 2X22A 3WYCA 3ASVA 3GPIA 1LLDA 4FGSA 2X58A 1KEPA 4WE3A 4LISA 4YJHB 5EN4A 1T2EA 3IS3A 1L1FA 4BO8A 3WSWA 4QUKA 4LRSB 4E2WA 3KVOA 2HSDA 4RVSA 4BV9A 1Y1PA 1E3JA 2JHGA 3H6KA 4EEXA 2AE1A 1ZKMA 1QRRA 5T8KA 4NH4A 1IUKA 4E2ZA 4IS3A 2NM0A 5IG2A 4BKRA 4PLWA 4MVJD 2P9GA 4JP3A 4C4OA 1WVGA 1ZMOA 1PSDA 1ZCJA 1E3SA 4UUPA 3NUGA 3JYQA 4MOWA 4QECA 4D3DA 3E18A 4ESOA 4U0JA 2BRUA 4R69A 5DCWA 1JQBA 1EQ2A 4MP6A 2X5JO 4RVGA 3PZBA 3VTFA 3Q3CA 3OETA 1E7WA 1PL6A 4Y6PA 1I36A 3GVXA 3ROPA 1MGOA 1VL8A 1WNTA 2UUOA 3BXXA 2OZPA 4FB5A 3I4FA 3H7AA 3K2EA 3WBBA 2P4QA 4UULA 3IQDB 3FPLA 3QVTA 3ROQA 1MC4A 2E82A 3ANMA 1MLDA 1B2LA 1XELA 1HXHA 4IXWA 2NQ8A 3A1NA 4DYDA 3VZQA 1X0XA 3O03A 2V6FA 4NJMA 3PFFA 3NT5A 1Z45A 2ZJ0A 3PLNA 4XA8A 4R1UA 3ZW9A 4YJGA 1MB4A 1YQXA 3RCBA 1O0SA 4CM9D 2WD8A 3MEQA 1N92A 2CDBA 3BA1A 4RJTA 3WX0A 4MVJP 4MKZA 3K2BA 1LBEA 3HDYA 3KV3O 2NWQA 2Y1CA 4B4VA 3F4LA 4UEJA 4D3SA 3WFIA 4TRRA 3IKTA 4K6FA 1ISMA 4M1QA 3BMCA 5TJHA 1YOVB 1HKUA 5T67A 2HAEA 1X1TA 3JQEA 3QRWA 4IIVA 3QHAA 3JQBA 4NFSA 4WCFC 3SLGA 3OHSX 1DJQA 1PS9A 1Q1NA 2BD0A 4QT0A 4TROA 1PZGA 1H6DA 4R1SA 1LUAA 1R0LA 4ZRMA 1JKFA 4EUHA 2Q46A 3ON5A 1HLDA 4YAJA 1AHIA 4YWJA 1E92A 3OJFA 1EBUA 1OFGA 3JQ8B 3NTRA 5AQ1A 4OL9A 3VZPA 4LW8A 3RKRA 1N1EA 2A92A 1QYCA 1CQJA 1HZJA 1SAYA 3TFOA 3RIHA 4CM5A 4DLLA 2YHIB 4K28A 2FMUA 5COAA 2HMTA 1P77A 2CY0A 3ST7A 5JAMA 1X7DA 2TMGA 3GY0A 1QYXA 3GEGA 3I1JA 1U2DA 3ITDA 2QRJA 1E7SA 3WOHA 1GZ6A 1AXGA 5CDSA 3B1JA 3UICA 3O8QB 4JN6B 1XA0A 4BB6A 4NU6A 2XPCA 3KUXA 3AY7A 2NTNA 3KYDA 4WLEA 4PG4A 3C3XA 5JO0A 1PR9A 3RWBA 3B1KA 2I66A 3TRIA 4BO3A 3JD0A 4RLHA 2Y1GA 1EVZA 4GGPA 2E4AA 2QRKA 3RC9A 4GGOA 4DL9A 3WFJA 4PZDA 4Q3DA 3T4XA 4QX6A 3KB6A 4R5MA 1EEHA 2C7VA 3NGXA 3PHJA 4ZA2A 1GCOA 1L7DA 1NQOA 1MG5A 4BGIA 7MDHA 5JDIA 4J7CA 2IZZA 3TFQA 4BNTA 4IJUA 1ZK2A 5DP1A 3VTZA 1GYRA 2EJVA 2Y68A 3Q1LA 1NBOA 2BFPA 1LEHA 3RC7A 3U09A 1LQUA 2YW9A 3PYXA 3K9QO 2AEJA 1ZH8A 3ZWNA 3L4BA 1HRDA 1OZAA 2VWGA 4J90A 4HNGA 4AJEA 1FDWA 3ROMA 5JXWA 3D1LA 4FCCA 4YVFA 2BH9A 4B3HA 2WYWA 4TVOA 3ZH2A 2AXQA 4DTIA 4ZQEA 1G0NA 5GZ3A 2PD4A 3AY3A 2XAAA 4J4TA 4OXNA 1LC3A 1DO8A 1NX6A 2PH5A 2Y1FA 5I7VA 5JMPA 4CUKA 4FFPA 5JCJD 1NAHA 4HADA 1XKQA 3RUDA 5HM8A 2GN8A 4PLCA 1IE3A 3P5SA 3S8MA 3N58A 1YRLA 3FD8A 2G82A 3HUDA 4R5HA 3OQBA 1ZSVA 4AJPA 5KJ6A 4JROA 3AUUA 5G2OA 2X4GA 5A9RA 2GF2A 3VOSA 1MFPA 1SEPA 2DTDA 2LDXA 3ZNOA 4FC6A 4CLDA 1YO6A 5L7WA 4WOJA 5TT0A 2VHXA 2E49A 3GGPA 3Q9UA 2OBYA 1QR6A 5MGBA 2NTJA 3R0IA 4FJ2A 3WGYA 2CVZA 3RUCA 5DP2A 4ALIA 5A06A 1UAYA 3AOGA 5EIOA 3VH1A 5ILOA 4IZHA 1D8AA 3U49A 1XQ1A 2QZZA 3U4HA 3PZRA 4JNKA 4R41A 2F00A 1BG6A 3AOEC 3BMOA 3DMTC 1UR5A 1X1EA 4A2CA 3WIEA 3GUYA 3WJAA 1PS8A 2FHSA 5TX7A 2ET6A 4P22A 2QX7A 3S55A 3JQ9A 3TPCA 4PLGA 1K6IA 4WLNA 1GTMA 2YDXA 3IP3A 4HBGA 3E82A 2ZTMA 3ZWPA 3H9EO 2PR2A 2HK9A 3L4BC 5L51A 1O89A 3FWNA 2QRLA 4DGSA 2QG4A 5T5QA 2ZK7A 1EFLA 1RM3A 4ND2A 1U8FO 2HMUA 4S3MA 3SX2A 4E33A 1E3LA 1NFFA 1WPQA 2W2LA 3JD3A 3Q2IA 3PP8A 4JIGA 1DPGA 2C7GA 3LC2O 3W8EA 4ZJUA 4AJKA 4RPKA 2FZWA 1TT5B 3C1AA 3AI3A 1YS4A 3CINA 5A9SB 2O3QA 3DMYA 4BKPA 2ZB3A 3LC1O 5JPIA 4RPJA 1CDOA 2EWMA 3VZSA 4FR5A 1PIWA 2WE7A 5FEUA 1GL3A 2C29D 2CD9A 3P2YA 3G17A 3DOCA 3I9JA 5JE8A 5L3ZA 1QMGA 2GZ3A 1SC6A 2GO1A 1VC2A 4L74A 1BXKA 2C20A 5L7YA 4D3FA 1TEHA 2JAPA 1A7AA 2CDCA 3NX4A 5TS3A 2D4AA 4I5GA 2NV6A 4S1VA 3CSDA 3PXXA 3S2GA 3PHHA 3ZWBA 1R0KA 1A9ZA 3E9NA 1LA2A 3QVOA 2O3RA 1DC5A 4PLTA 3NKLA 2DUUA 3COSA 4GH5A 1LRJA 2GPTA 4EJ6A 1L7EA 2GNAA 2PWZA 1Q7CA 1BW9A 1LC0A 2EV9A 1XCBA 4RO0A 1GYPA 1AGNA 4CM4A 1UXGA 5G4KB 4LN1A 3ZWXA 2OO5A 4IDCA 1VLLA 1ZVMA 3V5NA 3AM5A 4XIJA 3W1VA 3ZW8A 2YDYA 1UH5A 3U0BA 4NR0A 1V8BA 1OOEA 3PGXA 1GADO 4Q3BA 2DBVO 1DB3A 2WD7A 1K89A 4E30A 2JD0A 4BO1A 3H5RA 1KOLA 2ZYDA 5L40A 4U5QA 4M55A 3DWFA 1HDXA 4CR6A 1ZXBA 4CR7A 3F47A 2RH8A 2Q1TA 4CMBA 1YXMA 2A9FA 3OJLA 3JYPA 3S1LA 1ZBQA 2IYPA 4PVCA 3QW2A 2CNBA 4BNFA 4CQLB 3HJAA 4B4OA 5JY1A 3OSUA 1BVUA 1E77A 3FCOA 1P9LA 1KY5A 5HS4A 1U28A 2HMSA 4FIZA 4I5DA 2Q2QA 4CMIB 5DDIP 2YYYA 1OC4A 3DOOA 3BMNB 3OF2A 2H63A 2FY8A 3TL2A 1T2DA 1EMDA 2B35A 4ZRNA 1IHXA 1UZMA 2JFHA 3ZV4A 3BYZA 4BNUA 4YT4A 3V8BA 2W98A 1LTHR 1HWYA 1E6WA 3RFVA 4QEDA 1Q0LA 4B8WA 3GPDG 3KRTA 3MCVA 4Z0TA 3U62A 3ETGA 3F5SA 1KC3A 3HSKA 2Q4EA 1GUZA 3G49A 3ZZNA 4CLHA 1B7GO 1CYDA 2D59A 4AFNA 4AJNA 5L7TA 1TXGA 1JTVA 4MIYA 4P4NA 1HDYA 3UUWA 3P7MA 2QQ5A 2EHDA 5KWEA 1FDTA 4GQAA 4QO7A 1PL7A 1V9LA 2A35A 4E31A 1OBFO 4L75A 3G1TA 5BSGA 4KUEA 3VHRA 3RJ9A 2VUTA 4E3ZA 4M54A 1I30A 4CQMB 3BTOA 1H6AA 1EVJA 3C85A 4ITUA 4DYVA 5C5IA 2G5CA 3DBVO 5THKA 3I9LA 1LRLA 1FDUA 2JHFA 3HDQA 4WUVA 1N5DA 1GQ2A 1BXZA 1YL5A 4F6LA 3GZNB 2PGJA 1KBZA 4M49A 4PLYA 3ZV6A 1VKOA 1QXSA 3QA9A 4Z3DA 1IYZA 3Q6IA 1T4BA 3H2SA 5A1TA 4JBHA 1TT5A 5I7FA 1EK6A 4CV1A 2YV2A 1YDWA 4CMJA 4XB1A 3ZWWA 3DO5A 1I0ZA 3D5TA 4K26A 3UOGA 4YQYA 3B70A 3DBLB 3WYBA 5JMWA 2NSDA 1HLPA 3VPSA 3WGIA 2AHRA 4CMEC 3ZI0A 2HCTA 2XOXA 1I10A 2CF5A 3NTQA 3FR7A 3HB4X 3PRJA 5ENVA 4NMHA 5JNLA 3VPGA 3EZLA 5JAZA 2OMEA 1PJLA 1ZNQO 2FSVA 3GVIA 1ZMTA 5F5NA 3GVHA 2IRWA 4YAEA 5C7IO 2HRBA 4ZVVA 1ZK0A 1PQPA 2HO5A 1XHLA 1A5ZA 2NU8A 1U4OA 3T7EA 2NU9A 2Y66A 2CDAA 2DTXA 3L6OO 1OC2A 5IJZA 4GVLA 4FFRA 1D1TA 3FNEA 2GZ1A 4Z9YA 3OM9A 4NIMA 3UN1A 5B37A 4CL3A 1K2WA 1KC1A 1NYTA 5DNAA 3C24A 1P0CA 2GN9A 1QLJA 1UZLA 1F8GA 1JA9A 4LMPA 1ZEJA 1BXGA 3F9IA 3FHLA 3BZUA 1KVUA 1YL6A 3X2EA 5KNLA 1H9BA 4E2YA 4ALJA 1B3RA 4J49A 4DUPA 3LT0A 4KQWA 2NU6A 5KVVA 4A27A 3KSDO 3G0OA 4LMRA 2X0IA 2J5QA 3VDRA 1YJQA 5JC8A 1VSUA 4E32A 4XGKA 2PFGA 3KSUA 3PLRA 3I6QA 4R3NA 5BNFA 4U8GA 3UGKA 3IL2A 4MJLA 2BGKA 2YHIA 4YAGA 4PRLA 3JTMA 3RUEA 4CLOB 1JAYA 1LDGA 1WDLA 2VHYA 4KQXA 4A26A 2OP0A 3OA2A 3JD2A 3JQGA 4B3IA 1UP7A 4BNHA 1R4NB 3FI9A 1WW8A 5AOVA 5FF9A 4AG3A 5JDCC 1P0FA 3OIDA 5GZ1A 4PZEA 3M2TA 1SMKA 5KOIA 3BMNA 3KYCB 2Y93A 4JQCA 4IMRA 3F1LA 4YJFA 4U0KA 1DFGA 4EYEA 5JBIA 3SC4A 1IOLA 1NVTA 4RZHA 3PJEA 3VPFA 1PJ4A 1PZFA 3RROA 5IN5A 4D0SA 5HRUA 3O38A 3GDFA 9LDBA 3LSYA 3NYWA 4BNWA 4PN3A 2YZ7A 2VRBA 2EGGA 2Q3EA 5CEEA 3WIDA 4J0FA 4IJWA 4ALKA 1X15A 1W6UA 4IM7A 3D7LA 4DPLA 1KETA 1H0KA 2J3HA 4YJGB 5DBIA 1WMAA 4WNCA 1J49A 2CVQA 3M1LA 1PJSA 5FI3A 2X86A 4LSWA 1CJCA 2EG9A 2IZ1A 3GDOA 3MOIA 2AA3A 5TLSA 1UAGA 3VAZA 4OM8A 1IZ9A 5G0VA 1LSOA 5JYDA 3SJUA 2X9VA 1X0VA 3WR5A 4YPOA 3BMCB 1DIBA 2GD1O 1B15A 2GCGA 2IZ0A 4NZ9A 3PJGA 4YTEA 2W4QA 4J7UA 3DMTA 4MO2A 3RUFA 5U1PA 3RC1A 1ISIA 1P1HA 2FWMX 4H15A 2C2XA 3IJRA 3P19A 4HY3A 1ZZEA 4D7AA 4DPMA 5T6BA 3UF0A 2D1YA 3QWAA 2Z1MA 2EKQA 3LK7A 3LDHA 1EBFA 4JJFA 4U7WA 4YT2A 5BSEA 1DEHA 3PQDA 5L4SA 3FBTA 1A71A 3GFGA 4NK5A 4PRKA 3TZCA 4J9UE 1ADBA 5KJFA 3D4OA 1JVBA 1U5AA 3GF4A 2PD6A 3KEOA 3KO8A 1C0PA 3WQQA 2QYTA 3F46A 4KTTE 2O50A 4YA6A 3K92A 3VC7A 5L95A 3GG2A 5HWSA 2X9NA 1Z6ZA 4Y9DA 1SBYA 5ITVA 4CV3A 3OP4A 3SBOA 1E6UA 2BGMA 4JX8A 4RVUA 2J8ZA 4WOKA 3KHUA 5A5EA 4GLLA 3OJ0A 3KLPX 3CMMA 4AJ1A 3W8FA 3DAGA 1QV6A 2ZCVA 5IZ4A 2FRDA 3RUIA 3WGGA 1BRMA 1PGNA 3BTUA 5F1KA 5H82A 3SJ7A 5BNTA 1F0YA 1P1IA 4WNIA 2P5YA 1C0KA 3UCEA 4G81A 5AXDA 1H2BA 3TOXA 3ZN2A 4Z9XA 4CM3A 1K0UA 1QP8A 4XDYA 4NQZA 4E6PA 4E5YA 3KSZO 4QFDA 4JK3A 1ZK4A 2UUPA 3PK0A 2BFOA 4J3FA 5AXBA 4PG6A 4HFRA 1N8KA 3WWYA 1UP6A 4NBWA 4DMLA 4YT5A 1I2CA 3NT2A 3PHIA 1BMDA 1P44A 5CG2A 8LDHA 4ZQGA 2Y0DA 4NBVA 1DFIA 1JN0A 3PYLA 1EQUA 4WLFA 4CMKA 3OICA 4AJIA 1RYDA 3NDJA 5KKCA 1X14A 4UVGA 4OXKA 4FN4A 2ZCUA 2CVOA 3H4VA 1TT7A 3M2PA 4N5MA 4NNJA 4J1QA 3IDSA 3MTJA 1I3MA 1VI2A 2FR0A 2PKQO 2Z5LA 4YT8A 3GOHA 3VH2A 3QQPA 1LSUA 4L73A 5FYDA 2VUUA 2J3JA 1ZUD1 3RI3A 3A28A 2Q4BA 1ZXLA 2O3TA 5KCZA 2NVWA 3NTOA 4NI5A 4CLOA 1SZJG 1MXFA 4O63O 3ZWCA 5L4LA 4Q9NA 2G0TA 3DHEA 2VWPA 4WKGA 1EK5A 4XDZA 3ZHYA 3GRPA 2ZIZA 4EBFA 5KVQA 2FSSA 2DC1A 2PK3A 2B4RO 3EYWA 1SPXA 3DBLA 4OOFA 4OKIA 3PGJA 2PNFA 4HX5A 1PWZA 5EMHA 3RBZA 4KZPA 4WLUA 3RJ5A 4ZICA 5ADHA 3QWFA 4J4BA 2V65A 1E7MA 3AUTA 1FK8A 1GZ4A 1H6BA 4FC7A 4PG8A 1YONA 1J0XO 2VHVA 3WTCA 3SC6A 2IXAA 4XJSA 3EY4A 3ZV5A 5COBA 1G6KA 4ZHSA 1I8TA 1RM4A 4CLRB 3TNLA 3RFXA 4XGNA 3ZU3A 4NFYA 2AW5A 2VQ3A 2W8ZA 1SB8A 3HZZA 5CDUA 3HDJA 1E5QA 2YFHA 2Y67A 3EK2A 4NFHA 1I32A 2X1HA 3OJEA 4Y8VA 2PV7A 2ZQZA 4E5MA 3GFBA 4AICA 3GUCA 4TSKA 2OUIA 1CQIA 2B0JA 1HDCA 2Y05A 5TF4A 1JWBB 4EW6A 4KUGA 4GMFA 4TWRA 1PJQA 4WCFB 3O26A 4QO8A 4XR9A 1T24A 4PZCA 3H8VA 4BNGA 1QG6A 4ND5A 1MUUA 4W82A 2EERA 2VYVD 2GSDA 1HDOA 1ZIDA 3R1IA 4PLZA 4D45A 2VYVA 3RAJA 2VZ9A 1U7TA 6LDHA 4RF5A 2JAHA 5F1OA 4XGIA 1CWUA 4INAA 2GYYA 4UVEA 1I5RA 4YCAA 1HE2A 3O9ZA 1J6UA 1ADFA 3Q9NA 4WASA 5CPBA 1BSVA 5A9TA 3MJSA 4R54A 3GGOA 1P33A 2YQ4A 2JCYA 1W73A 3AW9A 3QWIA 5GMOA 4BMSA 4BL5A 1GU7A 3TZQA 1CETA 2DFVA 3V1YA 5IN4A 5JYEA 2P9CA 4IDBA 3WJ7A 3PJFA 3FN4A 4GX0A 4DQVA 1Y5MA 1Q2XA 3PTZA 4LK3A 1DLJA 3NAQA 2I67A 3AY6A 2AEMA 1YQGA 3E9QA 3IIEA 4WGGA 5G0WA 1GR0A 4DRYA 3BMQA 3VPHA 1V3VA 4IQ8A 1NQAO 3AU8A 1NPTO 4LCEA 1Z82A 1GPJA 2BMAA 4KP7A 1IZ0A 3PIDA 4K9DA 4CMEA 4N5LA 3L77A 3E03A 1QV7A 2ZJ1A 2VZ8A 2R00A 3GAFA 1SCUA 5A03A 1DSSG 3OEWA 1UDBA 3UCXA 1EDOA 4YYZA 3FBGA 5G4KA 2IODA 4ILKA 1UXIA 1DRVA 4NDNE 3S2EA 1R4MA 2BLLA 3LLVA 5KKAA 2VT3A 3G1UA 1Y81A 2FZEA 5DF1A 4I9NA 1P1FA 1MV8A 5A9SA 2WD7B 4YACA 5L53A 3A9WA 3H2ZA 1GCUA 4XRRA 1W8DA 2VCYA 3HQ4O 3ADPA 4R4JA 4WECA 2RBEA 4GVXA 1GQQA 3OBBA 1IULA 2X5KO 3RC2A 1ADGA 3ORFA 2C5EA 4BO0A 2P9EA 1A7KA 4IS2A 3I23A 4W9NA 4ZU3A 5B4TA 3JQAA 3JCZA 2GASA 3LQFA 2OP1A 4UAGA 3D0OA 2UDPA 1C1DA 3CH6A 1NWHA 3ZWMA 3NT4A 5TJ9A 1ULUA 4TRNA 4EZBA 1LXCA 1D7OA 3ZWOA 4F3YA 5CEJA 1LRKA 3EAGA 5CHEA 2NUAA 3RASA 4Y6SA 3QVWA 2QIOA 5F5LA 3G3EA 3TDKA 2QZ9A 2OXIA 3RU9A 4CM4B 2IDZA 2GN6A 2WEKA 4UUOA 4HWKA 2NVBA 2Y99A 3PPIA 4E21A 2J5RA 3E8XA 1S7CA 1HZZA 1UDCA 4P4GA 2VNSA 5ER6A 5CEFA 1I24A 3S2IA 3EUWA 1V6AA 2D0IA 4NHEA 4XD2A 1ENPA 1KEWA 5IDQA 1M76A 1OMOA 1MX3A 3LF1A 2VTEA 5JW6A 2YV3A 1NAIA 4TQGA 5ICSA 1XR3A 1LLQA 1DAPA 5A5FA 4BNKA 4CR8A 1W4ZA 1ZSNA 1NVMB 5KVSA 3CUKA 3RUHA 3VKUA 1VRWA 3N74A 4DC1A 4IY1A 3CXRA 2I9PA 2AQHA 1RKXA 3K31A 2I6TA 3IAHA 1ZEMA 1VM6A 4L76A 4IIUA 2YJZA 2W2LD 1IL0A 2HMWA 1Z75A 3JQFC 4CQLA 3NRCA 3HWRA 3KXDA 4RVFA 4UVHA 3RU7A 4B7CA 5BT9A 4GI2A 1MP0A 2I3AA 3OIFA 4DQXA 2IE0A 2DU8A 2EIHA 2AQ8A 3BHJA 1VJ1A 1EVYA 3WS7A 3WQSB 4L9RA 4WCFA 3JQBC 3P2OA 4JP2A 4B3JA 3QY9A 4YR9A 3PEFA 1UZNA 4HKTA 4D46A 5KJEA 1KEUA 3KTDA 4HXYA 3K73O 2WTBA 4RGBA 2VUSA 3GA0A 3DBHB 3NDIA 3STHA 2CUKA 4IDDA 1B8UA 3EHEA 1TA4A 5G0TA 1NFRA 1ZO8A 4RV9A 3WLEA 1V3TA 2PD3A 1F8FA 1GEEA 1K3TA 2X8LA 4JLWA 4II2A 4PCVA 1GUFA 3GG9A 3W6UA 1MA0A 2POQX 2NQTA 5JSFA 4YJFB 3MJCA 3HN7A 3V2HA 4CV2A 4K6CA 5IZCC 1N9GB 3WG9A 4FPXA 2H1SA 1N1GA 1PJCA 2RH4A 4RQUA 1WLYA 4Z0PA 4PFJA 4YAKA 1LDNA 4XYLA 4H3VA 3RKUA 4EDFA 2HJSA 3MJEA 2HUNA 1R37A 4BKOA 1PZHA 5BQFA 4BNXA 1RPNA 4FJ0A 4CQMA 1YDEA 4RDHA 4XKJA 4KUHA 3GVCA 5DN9A 4IUYA 2X6TA 2PGDA 3I6IA 3L0DA 1PS0A 2RHRA 3PVZA 2GERA 4RL6A 4CMAA 3EC7A 3EGOA 2VWQA 3FTNA 3L6EA 4TZTA 3H9UA 2C82A 1QLHA 2J3IA 2HMVA 5EINA 4UEOA 4CLRA 1E7YA 2YV1A 3D3WB 4AJJA 1HE5A 4UUNA 5DT9A 2D3TA 1DBVO 5KVCA 3WMXA 1R4MB 1BXGB 2BFAA 1BTOA 2Q50A 4M8SA 4UREA 3PQEA 1N7HA 4J2HA 3HFGA 2Q1SA 2FR8A 3CE6A 2G76A 6ADHA 3ZU2A 3DFZA 1LDBA 5EERA 3FNGA 3DBRA 3T7CA 3CZRA 4DC0A 5JCJA 1P1KA 2C07A 3RQSA 3WBFA 3WGTA 1Z7BA 2DAPA 2Y0EA 3LF2A 2ZTVA 3IMFA 3LZ6A 3DFUA 3QP9A 5AVOA 1G1AA 2B4TO 3PIIA 1GV0A 4FDAA 1NWCA 3TZKA 2PLAA 2PKQP 1PGQA 1UP4A 3IKVA 5DCUA 3QWHA 5TC4A 2JL1A 4AJHA 2JCVA 4GWGA 2UAGA 1HT0A 1PGJA 1GZ3A 1YL7A 1EUDA 2W2KB 4MVJF 1I01A 4KMSA 4YJDA 3EW7A 3UFXA 1HDRA 4ID9A 3NEPX 4BO5A 2NTVA 1U3WA 3W4IA 3KYCA 1HYEA 1XLTA 5G4LA 2P5UA 3E1KA 2BFMA 1YB5A 3FPCA 4Z6KA 4B4WA 4WEQA 7ADHA 2ILTA 2P68A 1LU9A 5I9NA 4G5HA 2HKIA 1Y8QA 3GHYA 5LC1A 4BGVA 1KVTA 4YBZA 2VRCA 2FPPA 5C7LO 1PL8A 4MP3A 4RDIA 4OOEA 3TWOA 2E37A 5JAIA 5B12A 3H3JA 4TKMA 3WSVA 2VYNA 3LC7O 3R3JA 3QV1A 3PDJA 4CODB 4DLBA 2WMDA 3VDQA 4Y6RA 1RM5A 1B8VA 5A05A 2PZMA 3MWDB 8ADHA 2XXBA 5T64A 4QFCA 3VVCA 5FFFA 4CM6A 4BNVA 2PZKA 3DZGA 3PHLA 5I9LA 1C1XB 1GPDG 2ZQYA 1QYWA 4GX5A 4HP8A 4LGVA 4E2XA 1VPDA 4I5FA 1DRUA 3HB5X 4OO3A 4H7PA 4IJVA 4XQGA 1P74A 2WYVA
chains in the Genus database with same CATH superfamily
2B37A 5T57A 1JHZA 2ZUTA 1NP6A 4AMZA 4BQNA 5B3JC 1SU8A 3ZDFA 3NHBA 2V7VA 1SXQA 1LV7A 4EF5A 1EUCA 1SUDA 2C54A 1CP3A 3A6EA 3CUWA 4JDPA 4KK4A 1HE1C 2XNKA 4WZAB 5KYYA 4MQLA 2JLSA 4O4IF 3ZD6A 1KRWA 3AI1A 3JAWB 2Q0XA 4YO8A 1IUOA 1H2WA 1PR6A 1RHRA 2HRZA 2OAQ1 4BMNA 4W8OA 1T8YA 1WUYA 2RGNA 4ND3A 2PH1A 2VH5R 2ZT8A 4J94A 4IICA 5T8KC 3EOZA 2AFIA 2P69A 1CEQA 2QX8A 3MQFA 3IMCA 3NYRA 4H1UA 1DE0A 4JJ8A 5TMEA 2HRDA 2CT8A 2R8ZA 1OYOA 1LZLA 3IKMB 4IXTA 1WVIA 1BJTA 3H19A 3RTEA 1GSAA 3GRFA 2I6XA 4KVZA 4UHEA 2JIBA 4TL6A 1DFHA 1G7SA 1XSEA 4M1MA 2BBSA 5T6MA 3HTXA 1CY6A 1P0QA 1IIRA 3DEYX 3KYBA 5AVTA 1J1ZA 5KSYA 2R5FA 4UZSA 1U0SY 2R3SA 2AQKA 4BNNA 1IC6A 5A3JA 3K96A 3A4VA 3UAGA 4EI9A 1ZSYA 5FWDA 5JAHA 4G1BA 1EFKA 1YGYA 4DLZA 4LRWA 3GNLA 2HF7A 3RVBA 4Z4CA 2VF7A 3A36A 3IODA 2Y9PB 4BN5A 4RS3A 1QK3A 4DS3A 1ST3A 3Q88A 1KP2A 3HEMA 1TL7C 4G0OA 2YBDA 4J43A 1JHPA 4ZVRA 1HL3A 1QKIA 2G08A 4F5ZA 4BB5A 5IT5A 4KQ9A 2QMOA 2XAUA 4O08A 3SLKA 4WZ6A 4F45A 1FSFA 1PDWA 3GEBA 1XT6A 4B32A 5BYKA 2GRAA 4WCVA 3IP9A 3OQ6A 1VJCA 4JXKA 4O4IB 3SZLA 3IGFA 2Y2UA 4ZT6A 3AUAA 1TX4B 5CXQA 4LE1A 3QPDA 3IUNA 4WK6A 1FVOA 4FYHA 4KO2S 1JAIA 1KI2A 2EKPA 3ESDA 2V6BA 721PA 2VDJA 1DU4A 4C2AA 2BR5A 5K1ZA 2FG5A 1VKZA 4IF4A 1P4SA 5IUKC 4CM8A 5C32A 5IAJA 4HWTA 4D99A 3LFTA 4EATA 3RBXA 5LZ8A 1D2RA 3GAZA 2D1SA 4OQZA 1NW6A 3FG9A 3PC4A 4IEEA 3QLVC 5EZ5A 2Q6LA 4LJSA 5BR7A 3SVLA 4DILA 2WT8A 1UJCA 3G2KA 4TTTS 4A73A 4LCJA 3ZHSA 1KK3A 2VF2A 1DBPA 5P21A 1PG2A 2YASA 1L7NA 1W30A 2B1GA 2ENUA 3A9CA 4AN0A 3VUFA 3ZHQA 2YRWA 4UCQA 4EPWA 1G38A 3ZHUA 2Q27A 3FHTA 3DTVA 1FFXA 5KNDA 2HNKA 1YQDA 2Q1UA 1FF9A 3CF4G 1DIRA 2ZVDA 3QF4B 3PA8A 5AI9A 3A2LA 2RHLA 4NU0A 4WJZA 3ISJA 4FZJA 1SUBA 2YFKA 3PI6A 3I30X 4C7OA 4AUKA 3X1MA 3LL7A 2XIJA 3COYA 4LSMA 4CMCA 6AT1A 1F1BA 3DZJA 2O3SA 4Y6OA 1E2LA 1XQXA 4J3JA 4R2IA 2HBRA 5EJ2A 1MJGA 3MTDA 4P3YA 5JO9A 1XKTA 2EW8A 1XQWA 3KR1A 2ZJZA 3IJ5A 3JPWA 3RB8A 3V4PB 3OFJA 4B09A 2EQAA 5K99A 2DEUA 1MO2A 4C2BA 1AZWA 3T3IA 3HJGA 3VDXA 3T3NA 4ENPA 3OM0A 4L8WB 1FBTA 2CUTA 1XL0A 4L4XA 2X23A 2IZ5A 3GJ0A 5F21A 5LN1A 5C7YA 4XM0A 3FFAA 3DWGA 4RHEA 1FFYA 2RG1A 3IDAA 3WNBA 3IUQA 1SOMA 3V4FA 5F1PA 3SIXA 1N7IA 1C50A 3L8ZA 3EGIA 3KKMA 3T4UA 1JEAA 2Q62A 3FB1A 3VC1A 1XMQB 3F5MA 2B2XA 1OJLA 1A98A 3G0BA 3N59A 3EY9A 4U7TB 5FFNA 1Z3IX 2ZKIA 1TQ4A 4F84A 1LW6E 2Q5HA 1M6NA 3DB2A 3NWEA 4B3RB 2BONA 4GYKA 4PC7A 2GXSA 2OHHA 4Q3AA 4DVGA 3A25A 3T7KA 4KQKA 1Z26A 4Q7MB 4Y0AA 4XWYA 2CWWA 2ZU6A 1FVXA 1YRBA 1XI2A 4KC0A 3RGGA 1IZ8A 1U4NA 3N2KA 4M86A 3KETA 1EIWA 1RE0A 2V98A 3JTEA 5I01A 2FK8A 2GN4A 1LDEA 4F6CA 2P62A 2UVDA 4QRHA 1CY8A 1PN3A 2O2IA 4MX8A 1UXKA 3R0QA 1JR6A 3T1YB 3V4ZA 3IT2A 1QIFA 5CLGA 3L07A 2PCLA 1IPEA 3HE3A 1UKVY 3IEUA 3IQWA 4J9VA 4GOMD 2OBFA 4DDWA 1UBRS 1K6JA 3BWMA 1VYUA 2IGTA 3GJYA 3NTUA 1I2BA 1NXOA 4BV2A 2BKUA 3NS7A 2O3JA 1AKMA 3BMQB 5EXPA 3GCGA 1RBYA 1PDOA 1U7XA 3AI2A 3AG5A 5ALLA 1Y5RA 1U3FA 1JQJC 2FPRA 4RPLA 4B47A 3C7KA 4KBGA 2ZANA 1FJHA 3UHFA 2X5XA 3QSGA 4CT4B 4YRBA 1U0RA 1WA5A 2I1WA 1RYBA 3N0VA 4JC0A 2PUJA 1I7DA 2VG8A 4AMBA 2D1TA 2QN1A 2D2XA 1N34B 1CKEA 1Z5OA 4LE0A 3ZNQA 2WM8A 3DJFA 3BXGA 4DHEA 2WIGA 3TJRA 3W5UA 2ADOA 1A2QA 4LYAA 4R9RA 3KEFA 1YI1A 2DBQA 1YASA 2VAWA 3LQRA 1L4EA 2OL4A 1R8YA 1HPLA 4GPZA 2EG5A 3FUWA 2R62A 5TPZA 3DXZA 1O97D 1UINA 2REQB 2GK3A 2YR0A 3EXEB 4FYIA 3SOPA 4D9FA 3JQ8A 1WZIA 1NDHA 2OZEA 1TIBA 3D6HA 3F0TA 3KZVA 4NC9A 5J5AA 5CB4B 3DVSX 1N3LA 2JANA 3PUXA 1ECJA 2D5CA 2OMKA 2Y0CA 5ECYA 1U3GA 2EDAA 2PHZA 3D8NA 3OF5A 4XVUA 3UPUA 2ZATA 1T3ZA 2BGUA 1K63A 3PC2A 1X39A 3EUFA 2WFLB 4E5PA 5JVDA 4B6RA 3ZJYA 1IPHA 2LZ0A 1U8ZA 5F98A 2WINI 4KIUA 3NM6B 3PQ7A 3N8GA 2WNIA 1QRAA 4EFKA 2O57A 4DUZB 3O93A 5K7SA 1N75A 3LIPA 3RSLA 1AG9A 5HPYB 3NKVA 4FW8A 1XPUA 3IA7A 4RPGA 3PDUA 4KWIA 1GCGA 3DHVA 2A7XA 2XH8A 4NYMQ 1PI3A 3I8SA 3PGVA 4WEOA 4HAIA 3HPQA 1T5BA 1TMYA 2M1XA 3OFSA 4RHTA 4WOPA 4OB8A 3GT3A 1P1BA 5GOTA 4GSYA 4TUYA 3E0QA 3SR0A 3T5CA 4MS4B 4CEIA 3G0HA 4KR2A 5K0FA 3T7DA 1KYTA 1UC4B 2XKJE 4LI0A 1FFGA 3SJZA 1NJ2A 5CFOA 4HQLA 3CWQA 5EZYF 1UXOA 2JK1A 2WVAA 5JDCA 1FFXB 3G1WA 4X66B 1QP4A 4FFMA 2PJRA 3AEKA 3IXLA 4F56A 1GHTA 5E3IA 1ONOA 2DOKA 1QANA 4HGPA 2BYTA 2ODNA 1JYEA 2Q6OA 1E8DA 1QG0A 3IB3A 1QZ3A 1XEWY 4BO7A 4KHPB 1QQBA 1Q11A 1H0RA 5JAUA 5JY6A 1ONPA 3LDFA 2PE5A 1MH9A 3C8MA 4BJHB 2J9XB 1YB4A 4O4JB 5TGTA 1EP3B 2AR7A 1JSLA 1VI5A 2H06A 1DCKA 3FVVA 3WKCA 4ZO7A 4DNFA 4DDTA 2W4MA 3L0PA 1C7RA 4G2NA 3E9MA 3VU0A 2AG6A 1PJTA 2X4DA 3G6WA 2XYQA 1ACLA 2VN8A 4PF1A 1HNNA 2YNMC 3AFHA 2HN9A 3C3DA 1TMKA 2C5AA 4L85A 5I9SA 4DA4A 4WLVA 1OGJA 2OK7A 2WRZA 4DBVO 3AF5A 1XYGA 4Q3EA 2IX9A 3SBXA 4YMIA 1B6RA 4A0GA 2R6AA 4DJJA 1PFVA 3NOOA 4QHTA 5AKLA 2O20A 5EWJA 2FW0A 4LY6A 4UBMA 5H9VA 5JAQA 4YXFA 1V4NA 2O23A 1TCBA 3ND8A 3WNCA 4EZIA 2ZWMA 3TJZA 4IINA 5NLLA 2ZRCA 4ENUA 1B6TA 1Q74A 3CISA 4BZQA 3O7WA 5NULA 1RPJA 3P9PA 1PT5A 1LFAA 4F1KA 3OHPA 2J0QA 2JB9A 2PFSA 4TZ0A 1QUEA 4MROA 1YBHA 1OBVA 1SD1A 4DLYA 2HC9A 3KVRA 1WXQA 4OKNA 4CTKA 5JFTA 2QVBA 4C1BA 2F8LA 4N48A 2ID7A 1UOEA 1PU2A 3G0DA 4ZDKA 4ZT7A 2DUNA 3WLNA 2XJ4A 4Q4HA 1IHYA 1O6CA 1GFSA 1SEVA 1VCOA 3GRAA 3HCBA 3T7JA 3VPXA 1AK1A 4KQ2A 5AT1A 2OHXA 2Z95A 3DAOA 2X4IA 4RJJA 3ADOA 3AU9A 1E6MA 5F1YA 1UK9A 3OTHA 3TIIA 3USES 2A58A 2VF8A 4B8ZA 4ARZA 3NH6A 4BQPA 4D6PA 5JQGA 4G56A 3L9WA 4GM1A 4HWPA 1WD5A 4NJMB 4XQ9A 2R7AA 3U3XA 5F9HA 3AERA 3LC0A 1ETUA 2IDMA 4JYBA 2EP7A 4HFJA 4ZDIA 1NTOA 5LDGA 3DW1X 3AHDA 2WDPA 4LZNA 2B5VA 2Z2IA 1ENZA 3K1YA 3HJRA 3QJ5A 4Y2JA 1W5FA 2DUWA 3GJTA 4GI1A 3C5EA 4AO6A 2OO7A 1JXMA 1XCLA 2XTJA 4PLPA 4H08A 4X6LA 3UXYA 1HF3A 5JCXA 3QVUA 4IIYA 4PCLA 3DYBA 4XQEA 4YDHB 4R3WA 2QENA 1WP9A 2IU3A 2NXCA 1CR1A 1S01A 1J9EA 4KWHA 2ZBQA 5J4YA 2DGDA 2FUKA 4C4RA 3IPRA 3O4IA 3RABA 2AB0A 1JW9B 3BTVA 3TNFA 5D3KA 1KQOA 1WETA 4G6ZA 4KH0A 4DY6A 4X8LA 5JZVA 3E2IA 3JXEA 3KPJA 2XE8A 1XC7A 1IU9A 4HDCA 1MC8A 4P2BA 3LY9A 3P0EA 4YLEA 3N5KA 4YGYA 4Q3KA 3MSCA 4HZIA 4N8EA 3KDSE 2WC1A 4TV9A 3AHIA 5UKDA 4KV9A 4XR4A 2RIPA 4C76A 4LQ4A 1ENOA 1K7XB 1PT9A 1GZ7A 1VPLA 1OX4B 3T94A 2MU1A 3UJAA 4ZD6A 5KKNB 3HU5A 1OA1A 3LXUX 3BPSA 2IYNA 2JFVA 2R47A 1CDZA 4X9XA 1JTFA 1IQRA 1VSQA 2ZAMA 3NJ4A 1BHO1 2RGRA 1P9NA 3ZJ4A 2E6KA 4BKUA 2ZDHA 5B1EA 3B3GA 2XYPA 3PC7A 3GH3A 4YDRA 1DO0A 4YHBA 5B7PA 1R7RA 4DUYB 1MFZA 1P75A 4N7BA 2R6FA 1L8QA 2BDUA 3RR2A 3TVDA 3B12A 1AVTA 5BURA 3HV2A 3H1FA 4MVJG 3SM3A 1RJWA 3QI2A 2C9DA 2EZ8A 3H9GA 4G4SP 4MI6A 1FTNA 3U7RA 4K2HA 3WDLA 5HX7A 2CFOA 3C3AA 4D97A 2D1QA 2FPPB 5KNDH 2N3ZA 3WGNA 4NPAA 3R6DA 1Q0TA 3OFKA 4PXYA 4ZQFA 4M9QA 1DG1G 4YV7A 2A6PA 1I9GA 1RZUA 4GQIA 1ECBA 3NMUF 4TX1A 3AKCA 2YMMA 1RQRA 4JOQA 1Q44A 2O8EB 3ML1A 2FMXA 5LDHA 2IHUA 1AQNA 4P34A 2OUKA 1T5IA 3AQ4A 2O4CA 2CMGA 5J40A 5HQTA 2KHZA 5I45A 1HDEA 4YB8A 3KM0A 3UVEA 2O1WA 4GZ5A 2V6MA 2ZBGA 4B4UA 3J80A 1QCCA 1O9BA 1TB4A 2XZDA 3JQCA 4FONA 4G8CA 4RF4A 5C8ZA 1PJZA 5M3BA 5BV0A 1JQKA 1EJ0A 1VCHA 3ET5A 2NX2A 1R4AA 2B34A 4LF4B 1TVCA 4NCIA 3SVTA 4TT8A 5TGZA 4KR9A 5IDWA 3P9XA 2H4WA 1EG7A 2YCLA 3CRNA 4GE0A 3GC6A 3SZGA 3O8QA 3N76A 1KFKB 3CN9A 1HE8B 3AFMA 4C7VA 5A7FA 5DW3A 3RD5A 5LLTA 3H6HA 2M1ZA 2X2FA 3F5FA 3FSRA 3GZNA 5E3HA 1A3CA 1JFTA 3IOCA 2PZEA 3KOUA 4Z3KA 5KX5A 1XEAA 5HJ7A 1ISFA 1KRHA 3PQ8A 4B84A 3KK0A 4D0RA 1YTLA 4I55F 3CQ9A 3I8OA 3KE9A 5A0FA 4NMMA 4BN0A 5EJGA 5BV8A 2PBLA 4FJ1A 2YOFA 4U9HS 1UKBA 3SY8A 4HNAA 3UWKA 1QIJA 3VR3A 4HX2A 3ZQUA 1LPPA 5KYGA 2VF4X 5K09A 3EGCA 3VI4B 2NACA 2P7IA 2QVCA 5CH5A 2VPWA 2AE2A 2QZJA 2QA5A 5EVCA 5KJ1A 3K9CA 4Y1RA 1T3LA 4I66A 1NM5A 5A7GA 2PH7A 2VQFB 3VSBA 1FXSA 1L4FA 2MR6A 4A0SA 3DL2A 4I1YA 1PGPA 3CNQS 2LWIA 4L4SA 4ZZ2A 3WL8A 5EXSA 4BNYA 5JD6A 1MQSA 1NIJA 4JCOA 4EO7A 3MFYA 1C7IA 3UKJA 1BFKA 1DJNA 1KYZA 4G3XA 2HCRA 1G20B 3ZKWA 4JYZA 3T1HB 4PYOA 5B3KA 1IY1A 2J3EA 1JHAA 4FCWA 2JD1A 2UXCB 2EWWA 3B1WA 4O4LF 2NSLA 5E9AA 5JHHB 4Z4IA 1YOVA 2W93A 4UM9B 1AN9A 1SUSA 4F86A 4S24A 1TKBA 4LVUA 4KX5A 4W9RA 4YUVA 1UXHA 3IIMA 1KERA 3C5HA 1DGQA 1X8JA 1U5BA 1YE8A 1B74A 1DBIA 1EFVA 1L5HB 2D8AA 5LJLA 3DCNA 2BGIA 4IR7A 4I2NA 1XZMA 4N6GA 2Y1XA 2VTBB 5F2EA 4B76A 3CEAA 4FFOA 2GO7A 2J3QA 1CHDA 1VKNA 3GBSA 3PGMA 2WR8A 3B7WA 2PH3A 3KWFA 3H8JA 4GR5A 3WYEA 3C2QA 3ZWDA 3BHMA 4WPGA 1N7GA 1Y5IA 4JBIA 4PZAA 1M1YE 2ZJ4A 1QVAA 2G83A 4JJZA 4EA9A 5KB3A 5FA8A 4C4YA 3BSYA 3HR4A 1O1YA 2F2TA 2IWHA 1JLKA 3ZH9B 4AZTA 1ZCZA 3AFIA 2VDWA 4PAWA 2VDNB 2CEAA 4BNIA 4MRRA 4FHDA 5EE1A 4ZZ1A 4MKHA 2ODBA 4JBYA 1XTIA 4KGVA 2O5RA 2QJRA 3RE1A 1YAHA 3L3BA 3LJKA 4GSLA 4CIWA 1L7MA 3SF8A 5JMTA 5J3JA 1DIHA 1I4DD 4DWOA 2ZIUB 1DAHA 4DLKA 3KYDB 1KARA 1IBLB 2COUA 5IXSA 1FP4B 3UUEA 2YXPX 3MTGA 1A0OA 3CIFA 5AXCA 2YVAA 2E55A 2V7XA 1XVUA 4RENA 1E3IA 5AW2A 1XBTA 4MINA 4PAQA 3NTLA 4P0QB 2HOQA 3RG8A 1U9YA 3B1FA 3QF4A 5K05A 1O94A 2J6IA 3CMCO 1E2MA 1XNRB 1Y63A 3E2PA 4P3KA 3MS7A 4MDYA 4NPCA 3EEIA 3MS2A 1H2ZA 4TPKA 1MKYA 2YVLA 2XB6A 3MTBA 1P5JA 4W8GA 4I50A 3BD9A 3SHTA 3G8CA 3RODA 1Y8RB 3CUSA 4MQ5A 3V8QA 4ZYXA 4GOXA 3K72B 5EXDA 1XJQA 4LFAB 1NURA 4FEYA 1JR3E 4IZOA 5CB0A 2SNIE 2W9XA 1N6HA 3TIVA 5ER9A 1TZJA 3KQQA 2XUFA 4W9NC 2B36A 4RFLA 1GUYA 3SD7A 2K5UA 1IJBA 1ZDMA 3PQCA 2VRCD 2WZDA 4OMFG 4UU0A 1V5FA 4XYEA 1KSFX 5SZIA 1ZY2A 4LRUA 1KYQA 2MDTA 3EXFA 2GB4A 4G1UC 4QT4A 3GOQA 5JZ9A 2O8CA 1COWA 5MDHA 4E5NA 3AJ9A 2GVZC 4Y7CA 5ALXA 2IUUA 2GOYA 2VSNA 3CX6A 4AIRA 5I7UA 1VSVA 2C2YA 2XHEA 4EPYA 3S6JA 1OI7A 4WKPA 2ZS7A 5DULA 1YUBA 2C31A 3LZDA 3GLFE 1CG6A 3PWZA 2QN9A 4RD2A 3GLUA 3P9CA 3MJDA 4CPDA 3CC8A 1OWMA 2W2XA 4EW2A 4DR3B 3HYLA 2IHJA 1M73E 3IIKA 3LHSA 5G3ZA 1ZRHA 1EFRD 3HBAA 4IX9A 3HADA 3WGOA 1UK8A 5TEVA 1W1UA 2HHLA 3Q7EA 4Y0VA 1WP4A 1P45A 1JQAA 3IHWA 1TJ3A 1T5LA 3DVAB 1DC4A 3UB3A 2QVLA 1GZVA 4UUAA 4WBNA 5FTWA 7ABPA 1W1WA 2JLYA 1XMIA 2QNRA 4Z1OA 3HFSA 4HQNA 1YJCA 3DTYA 4XWKA 3W5AA 4B3MB 2QG9A 2XUZA 2PKRA 4CM8B 3WBJA 3FPEA 2ZWAA 3W3AA 1QGUB 3PCXA 5KX5B 3D4LA 5ILGA 1BHSA 3FROA 1H23A 4CW7A 4CCYA 3HBMA 3GJ6A 4BNLA 5E2AA 4FNAA 4C29A 1Z8HA 4GL4A 1KE1A 4B7ZA 1EXNA 2P3SA 2VF5X 1E20A 2BM0A 4YH1A 4D44A 4FUTA 1SBTA 1KSGA 4N12A 1QH8A 2A1TR 2QV7A 1GVNB 4X7PA 2GEBA 2WSSD 3L2OB 3GJRA 4JBNA 4JSTA 3ND9A 2WSMA 3ABSB 4MR7A 4KBFA 5EHQA 4ZI7F 3LWDA 2FPKA 3EGEA 5BW6B 3NV7A 4ABYA 4XVCA 2VPPA 5DYNA 3F7MA 3ZBPA 1ZJYA 3GRKA 2GXUA 4LYHA 1MORA 4M87A 4HTFA 4XCVA 1VE9A 1PW5A 5A0TA 1CX9B 1KSJA 4DJEC 4H6PA 4G0UA 3QEMA 1KBOA 4K81B 1XZPA 2GBGA 3MZ0A 5LCXA 4DG9A 4KI7A 5K2OA 3PQ3A 1Q1BA 3DF9A 4MA4A 5EKSA 2GHRA 2ATXA 4CTOA 3A6KA 3M4ZA 3I12A 4XJTA 3MLAA 3KJFA 5AVZA 1GNTA 3LFHA 3Q0TA 3NVDA 3R0XA 2F4VB 1SOVA 1SNYA 3DEIA 5K4AA 2C1XA 3OQMA 2QM8A 3ZWVA 2C5FA 3NDRA 1GLGA 3ENKA 4LXXA 5AK6A 4M36A 4MVJE 3U1TA 4IBOA 5KYVA 4DR1B 3NORA 1KDZA 1GL9B 2IOYA 2Q9CA 3Q2KA 4Y18A 1IN7A 4YQFA 4MKFA 2G1KA 2J30A 5C7OO 2Y2VA 4EEZA 4U7DA 1EWKA 5JQGF 4R1NA 3ZNNA 2GJ9A 1TFRA 4UCFA 4GX2A 4IGFA 3QM1A 3ZKAA 1EFTA 5DZSA 2IHYA 2ZB7A 1GNVA 3KZ1E 5GONA 3NBQA 2PXAA 1BU8A 3TBHA 3ZIAA 4U4AA 3DFIA 4CN9A 5BWCA 3U44B 5BN3B 1ECLA 1FE8A 1Y3BE 3C3BA 3OECA 3AJ8A 3BC1A 1CUHA 4BMZA 1FCJA 5DYWA 1H2EA 4JXXA 3HP4A 1T5SA 2N46A 3BHNA 2XVXA 4RS4A 2WTXA 5DEIA 2HBQA 1T5TA 3VYSB 1CFJA 3O1HB 1QYRA 5HW0A 4LJAA 3EAFA 1JHXA 3D3JA 1E9BA 2IBSA 1CDEA 4N76A 4YHHB 3WB9A 4K5QA 3ZD7A 2WSYB 1NPYA 3GNQA 4K9OA 4DUGA 3VPCA 1F4VA 4FMDB 4CM9A 2A88A 2CSUA 2QT1A 4QDTA 2J31A 4RPCA 4QOIA 4BNJA 5EC8A 3R5SA 2I80A 5KJCA 5IT0A 1JEYB 1AU9A 3H1BA 3N8IA 2NT3A 2VXYA 3P2KA 3R9WA 3AEKB 4Z7QB 4P83A 1CEXA 2DVMA 5B2FA 5IX8A 3CR8A 2JI9A 4W6ZA 3Q8KA 3SEQA 3KBOA 3EVBA 3MPUA 4BNDA 1W4LA 4YGXB 3EG5A 4L2IA 2BI8A 4A15A 4WJLA 1NMQA 1BGXT 2E21A 2GUGA 4QYSA 1YIAA 3KEQA 4W1SA 3U9LA 3JD1A 3PI7A 1G6OA 3BB4A 2R8XA 4FFLA 4N6NA 4ZOAA 3TZ6A 3ZKWB 3ZXYA 2D6FA 5CTAA 1WKVA 1YE3A 2C78A 3JQ7B 1Q7GA 1JQDA 1G9SA 3EXG1 1OAAA 3ZCSA 4PM4A 4X71A 1GRQA 4TMFA 2QQ0A 1FUKA 3CZMA 3MILA 1SZCA 1UBSB 2ZI3A 1UUFA 2IEYA 4HC4A 4U6QA 1P4AA 1VBFA 1RJEA 2QP3A 3TTXA 4DE5A 1WMSA 5LKAA 1K86A 2BMWA 2WAAA 1TD9A 1VGQA 3PRKE 4YLYA 1X7GA 2REQA 4CJXA 5LIRA 2D3WA 3VTAA 3OIGA 4BZWA 1J1UA 1XRPA 4OFXA 4D4IA 3CUUA 5H0IA 1D6JA 2O4UX 4R6XA 4H3SA 3EIXA 1UDWA 3OSZA 4B7AA 2AXEA 2WHYA 3VKVA 2PKXA 1Z38A 4NDAA 1LK7A 1YFZA 4KXQA 4KQ1A 2X14A 6Q21A 2GYWA 1NSFA 4D42A 4LXIA 1E4VA 4DQDA 1V3UA 4KITB 1BO6A 5I7OA 2HQOA 4RCZA 1HYBA 2VDWB 3TFWA 3V7YA 3TZEA 4OHWA 3OIUA 4TKVB 1T0UA 1NP3A 3ADDA 1LLUA 5IH7A 1RAGA 1E2BA 3HN6A 2C0CA 1AZLA 4LCBA 5KMGA 1F14A 1U1FA 2PRSA 2VWHA 1U7ZA 1AHNA 2VT2A 4N8DA 4PIVA 1EHCA 1T29A 3E4DA 1F17A 1IQPA 2VDKB 3K1AB 4Y2QA 2A0WA 4UXIA 3W7VA 3GHHA 4A1OA 1ZWKA 1V45E 2Q29A 2F3PA 2D74A 1CY2A 1FP4A 3K4PA 2XGMA 3LPDA 3OFVA 4MZXA 5JZMA 4RZUA 1SUFA 3RS3A 2Z6QA 1RWBA 3DHYA 5FBLB 2ZVQX 5FOUA 4B35A 1E1LA 2H2WA 5TIIA 4KAFA 1K6EA 3NM4A 4L02A 3K5WA 1C7EA 2O8NA 3GBPA 3FUCA 3I52A 2F1OA 1ZPDA 2XUHA 3ASVA 3GPIA 1R8JA 4N9QA 1YGPA 5T3UA 1OQAA 3WQHA 5AVYA 1DDGA 4QXRA 5EJFA 4CNQA 3IAFA 1KEPA 3FPFA 3LOQA 1RHJA 1RRPA 4LISA 4WE3A 4YJHB 4G0NA 2OV6A 1MAVA 5EN4A 5IYZB 1Q0UA 4K8RB 1JIKA 5IBQA 3W6PA 5JNRA 2G72A 4LRSB 1EIZA 2GYUA 3I64A 4BV9A 2IXGA 3IE2A 4EEXA 2KBFA 3B3JA 4X6UA 2AE1A 2RGNC 5EP3A 1BVHA 2JCGA 1GT6A 1XLUA 1IUKA 4E2ZA 1IG0A 3PKIA 1QMPA 1PFKA 3KWLA 3WJ1A 4IV5A 1SULA 2HSJA 4MVJD 4JP3A 5LOVB 1VYHA 2ZR0A 1ZMOA 3I1YA 1ZCJA 1WMEA 2WMNB 3ONNA 3NUGA 3FSGD 4QECA 2A1TS 3OP1A 4QNMA 4D3DA 2GBIA 4ESOA 1RBQA 3VO2A 3KFLA 4EPRA 4AWXA 3IPLA 5H70A 3L1HA 3CKMA 1ZRNA 1ZI6A 2EFGA 2GPYA 3AV0B 1PSWA 5GJCA 3V46A 1J97A 3TM5A 1V1MA 3LIIA 4QVKA 4QSHA 2A0KA 1PL6A 4DEVA 1I36A 1ZBDA 3TTTA 5J2UF 2UUOA 3BXXA 2OZPA 4H7EA 4EVQA 3HHEA 4FB5A 2B7BA 2EX4A 3VYWA 3HXKA 3I4FA 4YV1A 4NBSA 4MW9A 1D2GA 2BAGA 2YN0A 4LPKA 4UULA 1QG2A 3QVTA 1MC4A 1G6HA 1B2LA 3ANMA 1C1HA 3FGOA 4IXWA 4JA2A 1DQYA 1LW7A 3L06A 1UBKS 3MTQA 3R7SA 3WGVA 5C1BA 2X15A 1ADYA 2RMKA 5KYWA 3O03A 2V6FA 4IVRA 1RC0A 3PFFA 1RRGA 4EB6B 4TVSA 1QFXA 2Y92A 1Z45A 2CB9A 1W88B 2QMEA 5E4TA 3LUFA 4R1OA 2FW1A 2R25B 4PGMA 4EGSA 2ZRQA 1JEYA 1XPRA 1S0UA 4LYYA 1O0SA 2E7ZA 3FMIA 2WD8A 5DNEA 5SICE 3MEQA 2NUTA 3N8NA 1ZA1A 1JDBC 3NBUA 4R05A 4FYJA 4RJTA 6REQB 3K2BA 4HZGA 4MYRA 2QXYA 5LMUB 1DCMA 3GUZA 4LJYA 4QQKA 3MWLA 4Q7LA 4UEJA 3QGMA 4BNDB 3WYFA 2O5CA 3MXOA 1U90A 4M1QA 3EEYA 3V55A 5MN6A 1HKUA 1QONA 4O2RA 2HAEA 1AQIA 1X1TA 1QQ5A 1W4BA 3FCAA 4JAVC 5T67A 4NFSA 3TSOA 1PS9A 2BD0A 1TEZA 1VG9B 2J6CA 1LX7A 4LC0A 2D0PB 1SXHA 4PPYA 4ZRMA 3W5CA 1KYIA 4LXYA 2ZUBA 2C92A 2B6HA 3AF1A 2ZU0C 3LNCA 4AMUA 2DHEA 4JLPA 1DEKA 4Q4JB 1W25A 1AHIA 3OLVA 1E92A 4I1OA 4YWJA 1OFGA 1RT9A 1ISRA 1PEKE 3VZPA 5C81A 4LW8A 2HSEA 1N1EA 2A92A 4Y1GA 1CQJA 2FJUA 1SAYA 3DXXA 1V39A 4DLLA 2YHIB 1V26A 5FB3A 1SD5A 3LCCA 1F3OA 3P9RA 4K28A 5DM2A 3ZTYA 2O8DB 2FMUA 2CZQA 2NTYC 3VX4A 3WP0A 3WV4A 4LRYA 4I4TA 4RADA 4D6YA 4B40A 3MUEA 5I9BA 2HWWA 5B5SA 2RGDA 1BFDA 4OX9Y 2TMGA 3D5EA 1QYXA 3SWWA 3QFSA 3I1JA 2ZSJA 2BTQB 1QHXA 1AXGA 3FDZA 3UICA 5EUBA 5CLJA 1RRFA 3H9BA 1VL1A 1RVDA 4BB6A 4NU6A 3HJTA 1UK6A 4GZMA 4QOGA 2WAOA 1YS6A 5LP6B 3HGQA 3KDAA 1U1CA 2Z9CA 4PG4A 2AOUB 2ZAOA 5AD1A 5A2QA 1FS6A 1PR9A 1AQ6A 1QO7A 1J0AA 2WOOA 2HZBA 1X3LA 1W0KD 2WZQA 5EE0A 3CG0A 4RLHA 1YRQA 4FMPA 5JJKA 3MHTA 4Z4EA 4XM1A 1SXJD 2H8GA 2WABA 2XADA 2R6HA 5D3MA 4BE7B 5HIMA 4WI1A 1NL3A 1JLHA 2EJTA 4CL2A 4DL9A 4ZYVA 1JDPA 1WLSA 4P54A 3KB6A 2VJYA 1EEHA 3NP7A 3NGXA 4HDSA 4C4TA 5GIPE 1BX0A 1L7DA 1NQOA 1MG5A 4M9CA 3A4YA 4ZTBA 2YVUA 3DP9A 3RYIB 1RWPA 3TFQA 2A59A 1G5PA 4UMEA 2HRRA 2IXDA 1NKVA 1CZHA 4IJUA 4RELA 5DP1A 3OT1A 2K6GA 4P35A 1GYRA 1GPAA 1UPFA 4UAUA 3RC7A 1E62A 3K6SB 3EGDB 4R1LA 4QGSA 4YP0A 4YUYA 2JLBA 1LPMA 2P3LA 3QPWA 1OGIA 2FWRA 5DWVA 5IF9A 1EK2A 1G60A 3FVRA 4FLFA 2FMHA 1M0SA 1E2GA 5LBUA 1F4PA 2WSSA 5FUWA 3H3XA 2WF8A 3W5JA 1TJNA 1XZNA 3N28A 1V41E 1FDWA 4MS1A 5ABPA 1IZZA 1T9CA 2R7NA 1W46A 2XT6A 4FCCA 2P1ZA 2WYWA 1Z0JA 1XOIA 4NESA 2REXB 1KH3A 2UZ1B 4FHGA 4NYIQ 4DJFC 5BSTA 3FOCA 4DTIA 4A0FA 5TQ2B 2PD4A 3AY3A 4OXNA 3PNKA 4DQKA 4GMDA 5GM2A 3NYIA 2J5XA 1H65A 1NX6A 1QF6A 2ZYIA 4CUKA 1Q12A 3ECAA 1NAHA 3IURA 3RUDA 3RNLA 4EG4A 3O7MA 2GN8A 3P27A 2J9FA 4DF3A 1IE3A 2OOKA 4NJEA 5EGSA 1ZHHA 1LZKA 1MVNA 3SQDA 3FD8A 3U3ZA 2C2ZA 4PIPA 4KXXA 1US8A 3DMFA 3K0HA 5G2OA 2X4GA 1ZD3A 3QEKA 4TMWA 1RPZA 1CUAA 1PQ4A 1MFPA 2LDXA 3FLBA 3VOSA 1P5RA 3LO8A 4GRAA 4OQLA 1VYVA 1IQUA 1NT2A 1SA0A 1D4ZA 1UOQA 2I4NA 1KJQA 4GOKA 1LI7A 1B43A 5B3AA 3GGPA 2G70A 4G8DA 4BX8A 4D9BA 4NAHA 4YX9A 1QR6A 2G63A 1A5BB 1Q0PA 5DE3A 3AKEA 1QGYA 5E7MA 2OA0A 4DAOA 3AXSA 3DDCA 2A8YA 5JH7B 3FCEA 4ER6A 1KRXA 5A06A 3AOGA 1USWA 4GEGA 2VJBA 4FFWA 3VZCA 5ILOA 3D0KA 3TVTA 4IZHA 4A0HA 5JS1A 1D8AA 2EFJA 1NX9A 3GMTA 2QZZA 2BEVB 3PD0A 1G291 2GZRA 5CGZA 2HM7A 4MUNA 3TQSA 3ZIDA 1KO8A 3PHCA 4A2CA 1UR5A 1HV8A 1VG0B 4MAAA 4YALA 2FN9A 1USKA 1ZA2A 3BFVA 1M9NA 1RYHA 1ZG3A 1L7PA 4IO1A 5EQJB 5TX7A 4EIWA 2C1EA 2QX7A 1G21A 4DLWA 1E61A 2MYTA 4PLGA 4YV0A 1GTMA 3IPXA 1XVAA 4ARUA 4HBGA 3RU3A 1PG0A 3BD7A 1HTWA 1OFHA 2ZDQA 2ZTMA 3ZWPA 1N5LA 3CJTA 3R76A 3SKVA 5BNWA 3ZDZB 4RYLA 1O94D 2ASVA 4I6EA 4E08A 1RZRA 1XWWA 3L4JA 1OYYA 1RM3A 2IFTA 1CZUA 1I6WA 3MRTA 1E3LA 2W2LA 4WXPA 2YWEA 2B0CA 4HN9A 4JIGA 4IDHA 3W8EA 3KQMA 3LXMA 4GYJA 3BEOA 3DHWC 1WSAA 2FZWA 2HCBA 5D8DA 1X6VA 3Q6MA 3LI2A 2XVAA 4NBKA 1KQ3A 2IUFA 3P94A 4JA0A 1G16A 2ZB3A 5FUQA 5JPIA 1TM2A 3BRCA 3FOWA 3ZHRA 1M2KA 2P6PA 3MT9A 4FR5A 2IEAA 5LB2A 2H0QA 2ATIA 3CVOA 3VZSA 3P2YA 2C29D 4URVR 3QVVA 1SCJA 3CUEF 3DOCA 3G17A 1NYRA 2BEUB 4GXRA 2GZ3A 5L3ZA 3VGJA 4EG3A 3I0ZA 2WF6A 4GGMX 4GIBA 3QUBA 2PX6A 3FMOB 4RK4A 4BJ1A 3AHGA 2M6KA 4CHTA 4DXAA 2YNMA 2C20A 2D2VA 5L7YA 5HKBA 2H3HA 1S4QA 1K5PA 1TEHA 1JR4A 1UJ2A 2CDCA 1KZ4A 2FQYA 5DU2A 5C4GB 3C3YA 1RWMA 2CVFA 2NV6A 4S1VA 3CSDA 1OIXA 3PFGA 3OQHA 3R5JA 5JXHA 3S2GA 3PHHA 3PR3A 5EIFA 3ZWBA 5IKXA 1A9ZA 1X9IA 4MW0A 1U6IA 4PLTA 5E7IA 3ICWA 1EFRA 3K4HA 4F7DA 4JWTA 1PRYA 2FDXA 4RSMA 3VR2A 3AHCA 1L7EA 4BFSA 1Q7CA 1S3GA 1S8OA 5CFQA 1LC0A 2EV9A 1AMNA 1XCBA 1N5RA 1Z2OX 3S27A 1XNQB 4RO0A 1GYPA 1TW3A 2IQ5A 1YDHA 5G3YA 1GSIA 1Z5ZA 2OCGA 4LN1A 4BYGA 2OO5A 2QSUA 4IDCA 5CA1A 2O8FA 4Y2GA 1JEJA 1ZVMA 1M0TA 2I7CA 4XIJA 3N39C 3W1VA 4BU0A 4WXRA 4QKQA 3UC9A 1V8BA 4U2GA 5HXAA 5KYUA 4IKOA 1ONBA 4UE2A 5TXGA 3AM1A 1P6UA 4BIMA 5CBKA 1TA9A 3HXOA 3G88A 4HTFB 1EK0A 4H1HA 1T3SA 4Q1EA 5HZMA 4H35A 1MX5A 1NDQA 1DQZA 4E30A 2J4CA 4QQFA 4YMUA 1FTGA 3F4KA 1O95C 3FVQA 4NEHB 2EBWA 1NVWQ 3OT5A 4ZI7A 2VXBA 2F9FA 4TT3A 5AMXA 3ZQKA 1W1IA 1Z0ZA 2RH8A 4B6FA 5EYPA 3OJLA 4NYMR 3S1LA 3SEAA 3L84A 4TXJA 2CBZA 2RGWA 4KHZA 4WKNA 3B8HA 5JZOA 5EIAA 4OV6B 1TYAE 4YV2A 4XLZA 1IWPB 2BKXA 2VQ6A 3TQRA 1IFXA 1M2HA 1T43A 1XLVA 3I6BA 2QLBA 1D04A 1KZ7B 2QV0A 3SR4A 5JPCA 1JT2A 1T5HX 1AQYA 1O4VA 1LBQA 1U28A 2HMSA 4I5DA 1XMXA 5AHRA 4CCSA 2WAYA 4CMIB 1HI9A 1W94A 2E4VA 2YYYA 5DDIP 1CUYA 4EB8A 5HZHA 3BMNB 4DJAA 4UARA 2Q8PA 2FY8A 1FQWA 2QJWA 3FF1A 3G0GA 1T2DA 3GP5A 1D0SA 1EMDA 1QH8B 2KI5A 4C21A 3RVOA 1SXPA 2JFHA 1T6YA 4BNUA 1NA5A 2QMQA 4X1IB 1Q2UA 2W98A 4EHLA 3COJA 1TYZA 3HGMA 4W5TA 1E6WA 4QEDA 4IF6A 1ZAKA 3PEUA 4IFEA 1CCWA 5B1IA 4FZ3A 4FX5A 1NY5A 4NXMB 3KYIB 4FEAA 5HIJA 1FFBA 3ETGA 4ZODA 3ZCVA 5LIPA 4BBJA 3HSKA 2JIZD 4JU9A 1W5BA 2D59A 4AFNA 1X7YB 5L7TA 4IOLA 4KACA 3ZDEA 4P4NA 5WRFA 1L5NA 4H7KA 1ETHA 2EYUA 2QQ5A 4EI7A 3HZOA 2PLRA 3L82B 4EYGA 2A5YB 1FDTA 4GQAA 3RK0A 2PUWA 2A35A 2VK1A 4M3NA 5K3FA 5FULA 2D7JA 2OZVA 4L75A 4M0EA 4JUIA 4QLAA 2ODPA 4UCXA 2XMPA 1SG9A 3RJ9A 3LLUA 4H0CA 4YC7A 2HHAA 3C1UA 3TGWA 4CDGA 4MPJA 3ANYB 4P0PB 1I30A 4ZK6A 4J29A 5AJYA 3EARA 4BP3A 3QTTA 1MEOA 2Z1DA 1EVJA 1OV4A 3C85A 3D3QA 5C1IA 3WFZA 3M5DA 3S2UA 4FKBA