1E41A

Death domain from human fadd/mort1
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
104
structure length
104
Chain Sequence
GSHMGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Three-Dimensional Solution Structure and Dynamic Properties of the Human Fadd Death Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords FADD PROTEIN
total genus 29
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2000-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00531 Death Death domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 1e41A00
2MS7A 3YGSP 2DBDA 1CY5A 4IZ7B 2LS7A 4D8OA 1A1ZA 4E9MA 1YGOA 2GF5A 1UCPA 2D96A 2KM6A 2L9MA 1D2ZB 2KN6A 2MN4A 4M9XA 2L6AA 2BBZA 2O71A 3QF2A 2G7RA 4NQKA 1N3KA 4A2QA 4RHWA 2N83A 3J6JA 4EWIA 3CL3A 2YU0A 4QOBA 2YGSA 2HM2Q 2OF5A 1C15A 2YVIA 2A5YB 4O9FA 1DGNA 2DBGA 4F42A 2OF5H 1D2ZA 4LWDA 4RHWE 4UZ0A 2BBRA 2N7ZA 1WXPA 1A1WA 4P4HI 1Z6TA 2N00A 2DBFA 4ZBWA 4M9SA 4JQWA 4A2WA 4P4HA 3EZQA 1CWWA 3J63A 4N1JA 3EZQB 1E41A 4FH0A 4IZAB 3MOPA 2MS8A 1NGRA 2B1WA 2NZ7A 2MB9A 2P1HA 2LWEA 4O7QA 4O6XA 2N1FA 3YGSC 4O9LA 1ICHA 2IB1A 1DDFA 4JUPA 3MOPK 1FADA 2MPCA 2N97A 2N80A 2DBHA 4I16A 4N1LA 2LWDA 1WH4A 1E3YA 4F44A 4N1KA 2F1SA 2A9IA 1WMGA 2DO9A 2VGQA 3T6PA 3CRDA 4M9ZA 3LQQA 3KATA 3LQRA 1PN5A 2M5VA 2YQFA 2NSNA 4IZ5E 4DWNA 2NAQA 3MOPG
chains in the Genus database with same CATH superfamily
2MS7A 3YGSP 2DBDA 1CY5A 4IZ7B 2LS7A 4D8OA 1A1ZA 4E9MA 1YGOA 2GF5A 1UCPA 2D96A 2KM6A 2L9MA 1D2ZB 2KN6A 2MN4A 4M9XA 2L6AA 2BBZA 2O71A 3QF2A 2G7RA 4NQKA 1N3KA 2XV9A 4A2QA 4RHWA 2N83A 3J6JA 4EWIA 3CL3A 2YU0A 4QOBA 2YGSA 2HM2Q 2OF5A 1C15A 2YVIA 2A5YB 4O9FA 1DGNA 2DBGA 4F42A 2OF5H 1D2ZA 4LWDA 4RHWE 4UZ0A 2BBRA 2N7ZA 1WXPA 1A1WA 4P4HI 1Z6TA 2N00A 2DBFA 4ZBWA 4M9SA 4JQWA 4A2WA 4P4HA 3EZQA 1CWWA 3J63A 4N1JA 3EZQB 1E41A 4FH0A 4IZAB 3MOPA 2MS8A 1NGRA 2B1WA 2NZ7A 2MB9A 2P1HA 2LWEA 4O7QA 4O6XA 2N1FA 3YGSC 4O9LA 1ICHA 2IB1A 1DDFA 4JUPA 3MOPK 1FADA 2MPCA 2N97A 2N80A 2DBHA 4I16A 4N1LA 2LWDA 1WH4A 1E3YA 4F44A 4N1KA 2F1SA 2A9IA 1WMGA 2DO9A 2VGQA 3T6PA 3CRDA 4M9ZA 3LQQA 3KATA 3LQRA 1PN5A 2M5VA 2YQFA 4IZ5E 2NSNA 4DWNA 2MJMA 2NAQA 3MOPG
chains in the Genus database with same CATH topology
2MS7A 3YGSP 2DBDA 1CY5A 4IZ7B 2LS7A 4D8OA 1A1ZA 4E9MA 1YGOA 2GF5A 1UCPA 2D96A 2KM6A 2L9MA 1D2ZB 2KN6A 2MN4A 4M9XA 2L6AA 2BBZA 2O71A 3QF2A 2G7RA 4NQKA 1N3KA 2XV9A 4A2QA 4RHWA 2N83A 3J6JA 4EWIA 3CL3A 2YU0A 4QOBA 2YGSA 2HM2Q 2OF5A 1C15A 2YVIA 2A5YB 4O9FA 1DGNA 2DBGA 4F42A 2OF5H 1D2ZA 4LWDA 4RHWE 4UZ0A 2BBRA 2N7ZA 1WXPA 1A1WA 4P4HI 1Z6TA 2N00A 2DBFA 4ZBWA 4M9SA 4JQWA 4A2WA 4P4HA 3EZQA 1CWWA 3J63A 4N1JA 3EZQB 1E41A 4FH0A 4IZAB 3MOPA 2MS8A 1NGRA 2B1WA 2NZ7A 2MB9A 2P1HA 2LWEA 4O7QA 4O6XA 2N1FA 3YGSC 4O9LA 1ICHA 2IB1A 1DDFA 4JUPA 3MOPK 1FADA 2MPCA 2N97A 2N80A 2DBHA 4I16A 4N1LA 2LWDA 1WH4A 1E3YA 4F44A 4N1KA 2F1SA 2A9IA 1WMGA 2DO9A 2VGQA 3T6PA 3CRDA 4M9ZA 3LQQA 3KATA 3LQRA 1PN5A 2M5VA 2YQFA 4IZ5E 2NSNA 4DWNA 2MJMA 2NAQA 3MOPG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MS7 A;  3YGS P;  2DBD A;  1CY5 A;  4IZ7 B;  2LS7 A;  4D8O A;  1A1Z A;  4E9M A;  1YGO A;  2GF5 A;  1UCP A;  2D96 A;  2KM6 A;  2L9M A;  1D2Z B;  2KN6 A;  2MN4 A;  4M9X A;  2L6A A;  2BBZ A;  2O71 A;  3QF2 A;  2G7R A;  4NQK A;  1N3K A;  4A2Q A;  4RHW A;  2N83 A;  3J6J A;  4EWI A;  3CL3 A;  2YU0 A;  4QOB A;  2YGS A;  2HM2 Q;  2OF5 A;  1C15 A;  2YVI A;  2A5Y B;  4O9F A;  1DGN A;  2DBG A;  4F42 A;  2OF5 H;  1D2Z A;  4LWD A;  4RHW E;  4UZ0 A;  2BBR A;  2N7Z A;  1WXP A;  1A1W A;  4P4H I;  1Z6T A;  2N00 A;  2DBF A;  4ZBW A;  4M9S A;  4JQW A;  4A2W A;  4P4H A;  3EZQ A;  1CWW A;  3J63 A;  4N1J A;  3EZQ B;  1E41 A;  4FH0 A;  4IZA B;  3MOP A;  2MS8 A;  1NGR A;  2B1W A;  2NZ7 A;  2MB9 A;  2P1H A;  2LWE A;  4O7Q A;  4O6X A;  2N1F A;  3YGS C;  4O9L A;  1ICH A;  2IB1 A;  1DDF A;  4JUP A;  3MOP K;  1FAD A;  2MPC A;  2N97 A;  2N80 A;  2DBH A;  4I16 A;  4N1L A;  2LWD A;  1WH4 A;  1E3Y A;  4F44 A;  4N1K A;  2F1S A;  2A9I A;  1WMG A;  2DO9 A;  2VGQ A;  3T6P A;  3CRD A;  4M9Z A;  3LQQ A;  3KAT A;  3LQR A;  1PN5 A;  2M5V A;  2YQF A;  2NSN A;  4IZ5 E;  4DWN A;  2NAQ A;  3MOP G; 
#chains in the Genus database with same CATH topology
 2MS7 A;  3YGS P;  2DBD A;  1CY5 A;  4IZ7 B;  2LS7 A;  4D8O A;  1A1Z A;  4E9M A;  1YGO A;  2GF5 A;  1UCP A;  2D96 A;  2KM6 A;  2L9M A;  1D2Z B;  2KN6 A;  2MN4 A;  4M9X A;  2L6A A;  2BBZ A;  2O71 A;  3QF2 A;  2G7R A;  4NQK A;  1N3K A;  2XV9 A;  4A2Q A;  4RHW A;  2N83 A;  3J6J A;  4EWI A;  3CL3 A;  2YU0 A;  4QOB A;  2YGS A;  2HM2 Q;  2OF5 A;  1C15 A;  2YVI A;  2A5Y B;  4O9F A;  1DGN A;  2DBG A;  4F42 A;  2OF5 H;  1D2Z A;  4LWD A;  4RHW E;  4UZ0 A;  2BBR A;  2N7Z A;  1WXP A;  1A1W A;  4P4H I;  1Z6T A;  2N00 A;  2DBF A;  4ZBW A;  4M9S A;  4JQW A;  4A2W A;  4P4H A;  3EZQ A;  1CWW A;  3J63 A;  4N1J A;  3EZQ B;  1E41 A;  4FH0 A;  4IZA B;  3MOP A;  2MS8 A;  1NGR A;  2B1W A;  2NZ7 A;  2MB9 A;  2P1H A;  2LWE A;  4O7Q A;  4O6X A;  2N1F A;  3YGS C;  4O9L A;  1ICH A;  2IB1 A;  1DDF A;  4JUP A;  3MOP K;  1FAD A;  2MPC A;  2N97 A;  2N80 A;  2DBH A;  4I16 A;  4N1L A;  2LWD A;  1WH4 A;  1E3Y A;  4F44 A;  4N1K A;  2F1S A;  2A9I A;  1WMG A;  2DO9 A;  2VGQ A;  3T6P A;  3CRD A;  4M9Z A;  3LQQ A;  3KAT A;  3LQR A;  1PN5 A;  2M5V A;  2YQF A;  4IZ5 E;  2NSN A;  4DWN A;  2MJM A;  2NAQ A;  3MOP G; 
#chains in the Genus database with same CATH homology
 2MS7 A;  3YGS P;  2DBD A;  1CY5 A;  4IZ7 B;  2LS7 A;  4D8O A;  1A1Z A;  4E9M A;  1YGO A;  2GF5 A;  1UCP A;  2D96 A;  2KM6 A;  2L9M A;  1D2Z B;  2KN6 A;  2MN4 A;  4M9X A;  2L6A A;  2BBZ A;  2O71 A;  3QF2 A;  2G7R A;  4NQK A;  1N3K A;  2XV9 A;  4A2Q A;  4RHW A;  2N83 A;  3J6J A;  4EWI A;  3CL3 A;  2YU0 A;  4QOB A;  2YGS A;  2HM2 Q;  2OF5 A;  1C15 A;  2YVI A;  2A5Y B;  4O9F A;  1DGN A;  2DBG A;  4F42 A;  2OF5 H;  1D2Z A;  4LWD A;  4RHW E;  4UZ0 A;  2BBR A;  2N7Z A;  1WXP A;  1A1W A;  4P4H I;  1Z6T A;  2N00 A;  2DBF A;  4ZBW A;  4M9S A;  4JQW A;  4A2W A;  4P4H A;  3EZQ A;  1CWW A;  3J63 A;  4N1J A;  3EZQ B;  1E41 A;  4FH0 A;  4IZA B;  3MOP A;  2MS8 A;  1NGR A;  2B1W A;  2NZ7 A;  2MB9 A;  2P1H A;  2LWE A;  4O7Q A;  4O6X A;  2N1F A;  3YGS C;  4O9L A;  1ICH A;  2IB1 A;  1DDF A;  4JUP A;  3MOP K;  1FAD A;  2MPC A;  2N97 A;  2N80 A;  2DBH A;  4I16 A;  4N1L A;  2LWD A;  1WH4 A;  1E3Y A;  4F44 A;  4N1K A;  2F1S A;  2A9I A;  1WMG A;  2DO9 A;  2VGQ A;  3T6P A;  3CRD A;  4M9Z A;  3LQQ A;  3KAT A;  3LQR A;  1PN5 A;  2M5V A;  2YQF A;  4IZ5 E;  2NSN A;  4DWN A;  2MJM A;  2NAQ A;  3MOP G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...