1E4XH

Crossreactive binding of a circularized peptide to an anti-tgfalpha antibody fab-fragment
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
216
structure length
216
Chain Sequence
b'QVQLQQPGAELVKPGASVKLSCKASGFTFTNYWMHWVKQRPGQGLEWIGEILPSNGRTNYNEKFKTKATLTVDKSSNTAYMQLSSLTSEDSAVYYCARSPSDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TAB2
publication title Cross-Reactive Binding of Cyclic Peptides to an Anti-Tgf Alpha Antibody Fab Fragment: An X-Ray Structural and Thermodynamic Analysis
pubmed doi rcsb
molecule tags Immune system
total genus 42
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2000-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1e4xH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1e4xH02
3BGAA 4P2RB 5TH2A 1KCRH 3HI1A 1J18A 4ZPTA 4LSVL 2ATKB 1MHPL 3QBTB 1MVUA 4PGDA 3WFBH 3PWVB 5TDOB 3VFSA 3STBA 3ZTNL 4RA0C 3OR7B 4R96A 3ZKMC 3BP6A 1FVCB 4OGXL 4UV4H 5D93C 3RDTD 1YEIL 5JR1L 1LO2H 3PJSB 1U95A 3LQAL 4MWFA 2EDBA 3BIBX 1MJJA 4NQSA 3QCUL 1NCWH 3U0WH 3P77B 1IE5A 2CKBA 2J4WH 5JW4M 3WNOA 1CK0L 4AG4L 3MFFB 1PG7H 1VEMA 1YNLL 5C2BL 3C2AL 3K4ZA 3U36B 4XVSH 5FECB 4OTXL 4HEPG 3MACL 4HULB 3W11C 5C07E 4HMDA 4Z8FL 5E9DD 4XMKL 3KPOA 5I8OL 4XPAL 1MREL 2BVQA 2DYPD 2X4OA 3P2TA 5DVKA 3LPGA 3RHWK 1NMBH 3KPQA 2ZUSA 5I1LA 3U0TA 4I0KA 3B3IB 1X5KA 1Q72H 3N50A 1F90L 2HT3D 5T3ZD 3QQ4A 3MOBH 3OWEA 1XIWD 3WCYA 3IFLL 2NY6C 4JE4B 2N7AA 4LHQB 3FRPA 4X6DA 3ARXA 4O4YH 2A6KB 4LCCB 4TVPH 1LP9F 3SO3B 3V79C 3FQRB 3S34H 4Y4HD 5EG6C 2DIJA 3Q5OA 4M43L 3MMEA 4ONHB 4OZIA 1RZKC 4M5YH 4PJHE 1OARL 2G9HB 2NLJA 4LSVH 4NO0A 4NC1C 3O41A 1BD2B 3Q6GL 3ZHLA 3OKEB 5D1QB 3C8HA 1U93A 3OG4B 3B6SB 1NMAL 4PJDA 3MV9B 4ZNEE 2VLME 3BP5B 1T22B 5JMRA 1A2YA 3IJHA 5JR1H 5E2WL 1X9QA 2GSIB 3SKOA 3HC3L 4X0KA 3GJFH 3LKNA 2JJSC 1RJLB 1BQUA 3QCUH 1FH5L 5D5MB 1YEKH 4MX7B 2JB5L 1CYGA 4PUBH 3IF1B 4CMMA 4KC3B 4JJ5B 3ES6B 4PLKD 1CK0H 3GHBH 4KK6D 1OPGH 5DDHB 3V8OA 4AG4H 3VRJB 1LO5A 4V2CB 3C2AH 5F9JB 3ESVF 5IHLB 4WGWB 1PAMA 4HDIA 2UWEE 4OTXH 3DMMA 1TTFA 5EN2A 4B7LA 3OJDA 5DC9B 1MFCL 2DIAA 3GIZH 3MBEA 4KKLD 3FQXB 4XMKH 5CZVH 5F89B 3VD7A 4F3FB 4P3WA 5I8OH 4HWUA 4NQDB 1MREH 1UJ3A 4PY8J 4E9LA 5C0BE 1DBKH 3QIUC 1RFDL 3DVIA 1WITA 1CDIA 3OGCB 4ZUUA 3KS0H 3TP4A 3V95A 1DBBH 4BA8A 3KJ4C 1OGAE 1P1ZB 1J5OL 4YXLL 4W4OC 4XCNA 4KROB 2OSLB 3C9NA 3V6ZA 3KYAA 2FX9L 4UTAH 4ZUSA 1EGJL 4Z5RA 4HZLA 4PR5A 5FKAA 2B7DT 2DMCA 5IB3B 1MLCB 4MQXD 5HI4D 4ELME 4O02H 3SKUD 3QIWB 5BVJB 3OGOE 1FQ9C 5C0EA 3RUGE 1UWXH 5FYJH 2FZ3B 5IROA 3UYPA 4WENB 1ORSA 1IEAA 1B88A 2K1MA 3RBSA 1PFCA 2EDHA 4YH6A 4G6FB 1P2CB 3MLVL 4M48L 3P11L 4RNRA 4QYOB 2Z31D 5C07A 4BH7B 2AABL 4F37F 2EDJA 1NMAH 4OQTL 5JOFB 1FAKT 1Q9WB 2EDNA 3U46A 4E41B 3I3BA 5IK3B 3HE7C 3L95B 2PXYB 3KXFB 4AT6A 2NY1C 3BHBB 3KPMA 3KPRD 1T5WB 4DFHA 1CLYH 4EJ1C 3ZYIA 3EO0A 4DUWA 4GKZB 3RVUD 2ZOKB 4JZOB 5C70A 2G2RA 4QRRB 2X05A 1U6AL 1KCKA 1P7HL 1QFWL 1L7IH 3GMOB 3HG1E 3S88H 4PYHA 5I2IB 2EDXA 1FDLL 1INQB 5LGJA 1FZOA 3CDCA 1P7QD 2AJYL 4CUCA 5CZXD 4KXZH 4PJHA 3ALWA 1I85C 3PGDA 4RGND 4ZFZB 3IKCA 5KS9F 3HR6A 5C6TL 1I75A 1HHIB 1ZVSA 4RGOL 3JSSA 4G7VL 4Y2OA 4LIQE 1JPFA 1JMXA 1YNTB 1LK2B 4Z76B 4ZNEA 3VXMB 4B7IA 5DK3A 2EH8H 4KAQL 5DYOB 4YXLH 4LLVA 2EE3A 4OT1L 4HH8A 4D9QD 5T1LA 1QD0A 1DN0B 2IBZY 4P4RB 3ROLB 2ADGA 1ACZA 2XTJD 1FCCA 3D18A 4HMCA 3MLUL 4FZ8L 4ENED 1EPFA 1IC4L 1ZLSL 5ADPL 2PN5A 5KSUA 1NGWA 3FB5A 3RPKA 5FYKE 4N8VG 4HH9A 1TTUA 3BO8A 3G9VA 1U2HA 2UWEA 5HD8D 4M48H 5F93C 1SY6L 4HUUA 3KLSA 3HPJB 5DMYA 3BQUC 4LF3A 1NEUA 1I3GH 2AS5M 1JNNL 2HTKD 2VISB 5EOTB 5D1ZA 5IBLC 1HIMH 1R5WA 2AJZB 2DBJA 2GSGB 3A0OA 5GGVY 5C0BA 2N56A 3LEYL 2EO9A 1A6PA 3TN0D 2W9LA 3RJDA 3C6SB 1OGAA 1MVFA 5HPMB 5DJZB 2UZYB 2Y5TA 4BZ2H 2Y7QA 1NCUA 5F1IA 3O2DA 1I7TB 4JKPH 1KIUA 1SMOA 1YY9D 1QFWH 4UOJA 3QDME 1KNOA 4V1DD 4ELMA 3AS2A 4E42B 5IIEB 3ZYJA 1FDLH 4HHAB 3RUGA 2CGRL 4JFOA 2CK2A 1J8HE 2R0LH 3HI5L 3QXDA 1GC1C 3RGVC 1MCJA 2CPCA 1G6VK 4WY7H 3CFCH 1C1EL 1U8HB 1VACB 2EDWA 3HC4H 3SDDB 5J1AB 3WNNA 1I1AB 2FJHB 1FIEA 1J0ZA 1RUPL 1G6RL 3O3UN 4F7MA 1JUFB 2CRIA 2GIYA 4KAQH 1HOCB 1QSFB 1PVHA 2DQDL 3LZFH 1WVZA 4OT1H 4NHCL 5IHUL 3UX9B 3UTZA 2FB4H 4RRPG 3LPFA 3D5OF 1BQHA 2P8MA 4HEME 4FZ8H 5CEXA 5HHME 3BZFB 5JPMA 1F4YH 4TQEH 3UTOA 1ZLSH 4HIEB 4QHKJ 3BH9A 4L5FL 4ELKA 1NH6A 1ES0A 1KCUL 4ZQKA 4PJFE 3TBWA 4I18C 3H42L 1RZJC 4S1RH 3LSOA 4X6FB 4G9DA 2XXMB 5E4IA 1HEZB 3KWWB 1U91A 4G5ZL 2YC1B 1T83A 2BHZA 1WV7T 4QRPD 4PRBB 4DTGL 3MODL 4K3EH 3IT8D 3ZKXB 3QQ3B 4XT1C 4UDTA 1DLHA 1KOAA 3O2WL 1J1XL 5FO7A 1EDQA 3ECBA 3EGSB 1WTGT 3TFKD 4LVOC 2VXQH 1H3PL 4ODXB 3GSRA 1GZQA 2HA1A 1TLKA 1ZK9A 4Y19E 4NN5B 3WN5B 4AZ8A 3DGGB 2NY0B 3HUJB 1R3HB 2X1WL 3NFNA 4KVNL 4ZOAA 1NKRA 4L3AA 1JWUA 3BYTA 4X6CB 5GSRA 5E08L 2Y36H 1KACB 1UKSA 1FNGA 3GO1L 1YECL 3HZMB 3SDYH 1S3KH 2F54D 2CKBL 3F8UB 5D5ME 4YE4H 1G6RH 1ORQB 5TQ2L 1MH5B 3WHXA 3DO7A 4UB0H 1PZ5A 2XRAL 1OTTD 1B0GA 5JLZA 2BDNL 1KF9B 1HQ4A 3RPIA 4M1CD 2ZSWA 5GS1A 4U1NA 5I6XB 5IG7A 4P5KA 2GCYB 3NIDE 4L8CB 3KJ6L 3I6GA 3KYOA 3B8SA 2DQHL 4Y4FA 4XVTH 2OYPA 3FTGA 1IGCH 1C5DA 2MKLC 1WISA 2DDQL 2H3NA 2ICEA 3VFMA 4S1QH 4U6HB 3CD4A 1E4XL 1KCUH 4LLUA 1OVZA 3LRSA 1PBYA 2DQGL 4FA8A 4MNGB 3QDMA 2IG2L 4KVCH 1OD9A 1P7KB 4HCRA 1EHLL 43CAB 3FOLB 3ZE0E 1M6OB 4G5ZH 5HGHA 1J8HA 2D0GA 2F5BL 3QWOB 3RWJA 3CU1A 5KBNC 2MKWA 3PJSA 2JB6B 4JY6B 2SEBB 4JPVL 1RUAL 3H2WA 4ZUTA 5L2JA 3N1GC 1TENA 1J1XH 2W0LA 1FN4A 5BS0D 2JIXA 3R0MA 5J0BA 2IAMC 3UROR 1NANI 4X6BB 1KV3A 1VESA 4J4PA 1H3PH 4GRLD 1P53A 5IB1B 2EE9A 1MHHB 5I71B 1NC4B 5F7EH 4XPHL 1QLFA 1HZHH 1T89A 1WSST 4DGYL 4EUPG 3UTTD 3MLRL 3TZVC 4ZTOH 1QUNA 4KVNH 5I66A 4NZTL 2VDRH 1CN4A 4WI4A 5E8NB 5E08H 2FEEI 5GRUL 1TZHB 4I0PD 3J8F7 3QUZB 5ID1A 4E41E 2FBJL 3FZUD 3MROA 5CJOL 5IB4A 1JWMB 1UKQA 3WJJC 4JCMA 5IQ9B 4GSDL 4AIOA 2ZUXA 2RIKA 5TPWL 2R0KL 1S7RB 3MC0A 4L4JA 3VWJC 4JZJC 5C2UB 2X4TA 4JANA 1XFPA 1NCDH 1J8KA 3OAYK 5FK9B 2XRAH 4HWBA 1UZ8B 2NR6D 1HHKA 3ULVL 5TE6H 3FFCE 3GM8A 1KT2A 4ZYKA 4ZG1A 5I1EH 4KRPD 5GGQL 5J11C 5JPNA 5DI8B 2X6MA 2X5PA 2A0LD 4GW5B 3FQRA 5EZLA 1DQML 3VI4E 3A6OA 4LFHG 2R9HC 1E4XH 1QTYT 4WJ5B 4Y19A 2DQGH 3GSNA 5HHOB 5HYSB 3OKEA 4GG8A 5D1QA 4PLJC 5FKPA 4GRWE 3VWKD 4MB4A 1EHLH 4UAOC 3MV9A 2V9RA 3BP5A 3SDCC 5ITFA 5HHVL 1I8IA 5DUML 2FIKB 2F5BH 3BD4A 4PB0L 3U0PB 2NY5C 5FGRA 3F7YB 2WSKA 1AP2B 3MLPA 4EN3D 5D5MA 4QTHA 1L0YA 3MV8B 2VLKB 2HJFA 3TNNA 4EDXB 2GYSA 2XIDA 3DXAB 1MFBH 3ES6A 2YOCA 3E3QC 5DD5L 4Z0BL 3VRJA 4QHNB 5EC2A 3O0RL 1U8QA 3SGDI 3O3DB 1ZMYA 2MCPL 3MLRH 3K4AA 4O58L 2CIIB 2BOBA 5FUCC 3KYNA 4NZTH 4WWKC 1G1CA 3OF6A 5GRUH 4MCZB 1YPZB 3VXRD 1R5IA 4CNIA 1U41A 1T0NA 4LEOA 4LCWD 5CJOH 2A1WH 4GSDH 3D2UD 4YNYA 5CD5C 4KKCD 2R0KH 4L9DA 4P46B 3OGCA 1HHJA 3SGKA 5F9OL 1I3RB 5AZ2H 3BGFB 4LAJH 4UQ2B 1S8DA 4JDVA 3FQUA 4JDZA 3D0VA 3TBSA 1PW3A 1YMME 4L4VB 2YA1A 2CDGB 4HXBH 3ZYZA 2XN9D 2EKSB 4OIIL 4JFFB 3QHZH 2DIBA 1DQMH 1A6AA 5DEFA 1KTLA 1AGBB 3EYFA 4F8QA 1ZHLB 5ETUA 1YYMH 2PYEE 2VOTA 5ICZA 4N0FB 4M8VA 1JIBA 2PO6B 4APQC 5HYIA 4UZGA 3VJ6B 1GGIL 1E6OL 1JZ4A 3BT2L 4BFEA 3LKPA 1MCIA 4QXUL 3STZA 1HYSD 2CR3A 5H37H 5JOFA 1EHXA 4RAVB 1VFAA 2AEIT 4E41A 3O6FC 2WBJB 1HK6A 3P9WB 4CW1B 4PB0H 5GJSL 2VRAA 1E4KA 4P59L 3T4YA 1T1WB 4F37K 4JFHE 2AXFB 1JZ8A 1K8IB 4FQJL 5FDYA 1T5WA 3QAZB 1J9CT 1GYAA 4GKZA 3SBWC 4U1MA 2ZOKA 5F7MC 5I1DB 3FFCA 3IFPA 4Z0BH 4AENB 4QF1B 3RVVC 1VADA 4WO4B 4Z7NE 1NUDA 4GG6E 1LMKA 3B9VA 4O58H 1JPGB 5I2IA 4HV8A 1INQA 5T5NG 5GS2H 3W9EB 5T33L 2HLAB 5JMOC 1RHFA 5D9SB 1DL7H 5KTEH 4GUPB 3CPLA 3AS1A 2PW2B 2F9BT 2NXZD 3LQZA 3IAGC 1SYSA 3HC0B 3O45B 2NPLX 3H9SE 5ERWB 1YNTA 5F9OH 2H1PH 5HDOA 3C60C 1FZJA 4PLOB 6CGTA 1J86A 1JK8B 3O2DL 4P2OA 1J1PL 4KKLC 3OPZL 2B8OT 5DK0B 1ZHBB 4Z77A 5D6CA 3DURB 5EO0A 3NABL 3T1FB 1J87A 4E0RB 1CTOA 1WCBB 2CLVB 4OGAD 1D5IL 1BMGA 2FGZA 3ALXA 2HFFA 1FYTD 1C5BH 2ICWA 3F12B 1GGIH 3UC0L 5F3BB 3BT2H 5I75B 4LKXB 5KSAD 4HUXA 2K7PA 5E2VL 3MGAA 3LRGA 3U9PL 2NW2A 1H3GA 4QXUH 4CBPA 4HK0A 1ODAA 1WIUA 4FFVC 2Z35B 4U05A 1IGYB 5ICXB 4LU5L 1H3TA 4P2QD 4P59H 3GMQA 3SPVA 3DX8B 5A2FA 3T3ME 2EYTA 3LN5B 3W0WD 1H3UA 25C8L 4Y16B 1AGCB 1MQKL 4JFDD 3C6SA 5IEHB 2LV4A 3HPLB 5HPMA 4M62L 4RSVA 3K74B 2Q7YA 2XG4A 3L1OH 3T3PE 2YPLB 3D9AL 4ZUWA 3RVTC 1N4XH 4G42B 4PJEF 4DAGH 1OF2A 5KVGL 2M8XA 3SKJL 1EEUA 2EC9U 3UZVB 4N9OB 4I4WB 2G5BA 1DQQA 4MMXC 3SQOL 4NN6B 3ULUE 2PYEA 5F7YC 4JM2D 5H35A 3QUKB 5LWYL 1VACA 3FO2B 4LIQL 3L7EA 5J1AA 3WIHH 4U1JA 1I1AA 2FJHA 4YUEL 1Z5LA 3TCXA 3PHOA 4TULH 1MOEA 1FGVL 4L8SB 2NZIA 4NKOB 4YZFF 4OUUB 3IDYC 4AIXA 3B2VL 3GMRA 1J1PH 1N0LA 1G9NC 3PWJA 1XH3A 3H9HB 5E6IA 3OPZH 4M8QB 4AIZB 1OQXA 2BNQB 5DUPL 4KKNA 4GRMB 5CZXC 3SE8H 5FYLL 1JPTH 5ALBL 5FYKL 4HIEA 4FQPA 2I07B 4JFQB 1D5IH 2X4RA 4K8RH 4XCCL 1Y18A 4HG4K 4GG6A 3IDGA 5IF0A 1YQVH 3K1KC 5I74C 3UC0H 3UTPE 5C86A 3IDJB 4X6FA 5E2VH 3U9PH 3TVMC 5FUOH 1HEZA 3QHFH 5IVXE 3KWWA 5D96B 1WJ3A 5CHNB 3F65A 3I6LD 3FRUA 1W0VA 2XTJC 3NIFF 2ZG2A 3KAAA 4K7PY 4Y1AB 4JO4H 4MB5A 2VKXA 5DHYB 3H0TB 3GSWB 4LASL 5EU6B 5JOPE 4OFYA 5DMKA 2RFXB 5IB5B 5JW3H 3PF2A 3H9SA 5TGBB 4GMTH 4F15B 25C8H 1Q0XH 4PY7B 4Y2DD 5F88B 4WIQA 5C0GB 1WZKA 5IJKA 3LCYA 2IH3B 1CWVA 5CEYB 5JA8B 4GAYB 3D9AH 3WN5A 3W5NA 1BVLA 4HCRL 5ESVB 3MRGB 3SKJH 4S1SL 1QYGH 4WVRA 4Q2ZB 5CP7A 3ETBF 4I2XE 3OKLA 3CSPA 2HWZH 3EIFA 4MAYB 4O5LL 2E7HA 3MRLB 1ZT7A 3DMMD 3K8KA 5EBLB 5LWYH 2R0ZL 4XWGH 4PJ9B 1NLBL 5JA9A 2EYSA 3IU3B 5CSBA 3UDWC 5J12B 3ARFC 2AQ2A 4DVBB 3OXSB 2FSEB 3UPRB 1JFQH 3MRRB 1YY9C 3MOAH 5HYFA 1I1FB 4DJMA 1IM3B 2W60A 5DUPH 1I8MB 3RA7H 4WU5B 3P30L 3HZVB 5FFLA 1UCBH 4JREB 5FYLH 5GGVH 4MDIB 5FYKH 1IM9D 5CAYB 5ESQB 1F02I 1BM3H 2XKNA 5IWLC 4XCCH 3M8OH 1PSKH 1QFHA 3L5HA 3AUVA 4POUB 4H26B 4KK5C 4M6MH 4P23C 2P5EE 5CUSL 2OJEB 1T0MA 3BDYL 3DX7A 3PWLA 5EUOF 2ZKHL 1PQZB 4HWBL 4NKIH 4ODBD 2OR9L 2BVEA 4S0SD 4BFIA 1YDPA 3KDMB 1FFPB 3FAWA 4ISVA 5AZEL 1KPVB 2H2SD 4LASH 3CAFA 5B8CC 2JK5B 1KCVH 1KN2L 4JR9L 4EIGB 3S35L 2FX7H 3LQAC 4K7FA 5ICYA 3PV6A 2AK1H 3V0AC 3JV6A 2VL5B 5FCSH 4JFPA 1NC4A 5D93B 2VLJB 3GSNL 4A6YB 1K85A 3L3JA 4KRLB 1C8PA 1WAAF 5C0JB 1T4KB 2R56H 4HWEH 1FL6A 1A4KB 5FYKU 3NACL 4P4KA 3ARPA 4PTUA 2YA2A 4N5EC 5FA4B 3VFRB 3WS3A 2A77L 4F58H 1VEOA 3PXHA 4PGEB 3DUHA 4HG4J 2HMID 1S7RA 2VDQL 5IVXA 1MPAL 3MLWH 1GSMA 2BCKB 4MA3B 2VAAB 4UUJA 2R4SL 2G75A 3O9WA 3N1FC 2BERA 4LSUL 3IXAB 3VFWA 1BJMA 2BVUA 3CLFL 4ZO8A 4LGSB 5DI8A 4HK3J 5FCUH 2FR4B 3P30H 1EO7A 3V52H 1T5XB 4G6AD 3D0LA 1E27B 2CD0A 2JJWA 2JF1A 3FRPG 5F7UA 5I1KL 1Y6KR 2ITDA 3ARGB 1BWWA 1I3UA 2NY6B 4PREA 1OTTC 2YN3A 4QTIL 3MA7B 1R0AH 5EU3B 4K23H 4FMKA 1VSCA 2D7MA 5CUSH 4QY8B 2ARWA 4I2XA 3MRCA 4IRZL 3DSNA 5JIHA 3ORJA 3VXUB 4N0UE 5EWIL 3A6CL 3QUXC 2F58L 1IGTB 1KN2H 2FX8H 1S7VA 4NT6B 1BQLH 2HJLB 5D1ZD 3QDHA 43C9B 4F9LC 4NUGL 1TJHH 3C5SA 3DXAA 4X98B 2PETA 1N6QL 1MUJB 4Z7WF 2P24B 1XF3B 2D3VA 3BUYA 4PJXB 3RZWA 3QUYC 1F3JA 1FSKB 3NACH 1FL5A 2ADFL 4NQXB 2B4CL 3KLHD 1HWGB 3NCJH 3D69B 3FT4B 4NFDA 5KVEH 3FB8B 2P5EA 2VDQH 4P46A 3QP3A 4DEPC 1KLUB 4XRCB 4RMTA 3KYKH 1I3RA 1TNNA 3QIBC 1DEEA 4HPOL 2I9LB 5IMOA 5DJ6A 5A16A 1M71B 1NGPH 5E5MB 4BQBA 4KUCF 5IMKA 3K1DA 5H37G 5IMLA 1FFNB 4IRSD 4QRUB 1DN2A 5DVNA 4MA7H 1AO7E 1AQDB 5GQBA 1RIVL 1UEMA 2VUOA 4HPYH 5I1KH 1N59B 1H5BA 3BPCB 3FHQA 1MCWW 4J3OC 3JXAA 5KZCB 4XNZB 4QOKD 4KRPC 5HYQA 3VRIB 3HG1D 3K80A 3UTQA 1RUML 2P7TA 1LEIA 3D6GA 4RQQA 4G80A 1H8OA 4C83B 3DV4B 5SWZB 4UIMB 5DMIL 1F6FB 2BY3A 1QRNE 2NX5B 1EERB 3DARA 3NCMA 4M93C 4U1LB 2K9UA 1L0QA 4FQHA 4L8BA 3E1F1 1K5NB 3RZCD 1N6QH 4WEBH 4YFDB 4TUOB 2BX5A 2NY1B 5E94A 5HDQH 2DD8L 2W65B 5EIQA 4GW4B 3OBAA 1CGUA 5DJXB 4MNQD 4PJCF 3V4UH 2ADFH 3PHSA 2B4CH 2WANA 5D9SA 1KB9J 3BGMA 1NGXA 4KI5E 1BOYA 2MQ0A 1I7RB 2LQRA 2HJKB 3P0YL 4NFCA 3VMPA 3ARDC 1FGNH 4R7DA 5B21A 2RBLA 1A0QL 4HPOH 5BQ7A 4NM4H 4ETQA 2KUTA 4N0UA 4ZUVA 3DUUA 2ZUQC 3QFJE 5KOMC 3BWAB 2XZCH 2CIKB 1GL4B 1BJ1J 1NANH 2C3GA 2PCPB 4N68A 3T2PA 2NY2D 1NAMH 4E0RA 2AJ3B 2CLVA 4XXCA 2IALB 4KKCC 1B2WL 2D0FA 4P3CL 5GIRA 4DVRL 1RIVH 3BW9B 1JGLL 3ZTJH 4Y4FD 5DK2B 5L7XH 1EMTH 2PTVA 4LKXA 1T21A 1G7QB 3QNYB 4NQEB 3U9UB 3VRLE 2DBLH 4HJ0C 5JHDB 1A1NA 1NLDL 1K8DA 4L9LA 5CD3B 3T0DA 4LBEA 2IH1B 3BP4A 5D1XC 1NAKL 4A2MA 2OJZL 3L3IA 5AUMB 2QADC 2AGJL 3G9AB 3LN5A 3FFDB 4Y16A 4TSAL 4NOFA 1UGNA 4KDTA 4ZFGH 5DMIH 3BQUB 2C4XA 3DRTA 3HPLA 3LN9A 3GRWA 1IARB 3L3KB 4EDWL 1DUZB 3VI3F 1ZS8B 3MLXL 4W6WB 1IL1A 2JIXD 5EU7E 2H2PC 2VSDA 2I5YH 4U0RB 4J4PD 5I15H 1AO7A 4P3DB 1VGKB 1A4JA 3G04A 3QRGH 3B5HA 3ZE2F 4RMUA 3MRFA 4Q7DA 3Q3GA 5F9DC 2FHCA 3QI9C 1UJTA 4Y5XA 1MHEB 4MXQC 5F9AC 4OFIA 1T1ZA 3MV7D 1PD6A 4WGVB 4WV1C 3C6LD 1RUKL 1IAMA 3MRJB 4XC1H 5HVGB 3X3FL 4D0DB 5BRZE 3RGVB 2BNRE 4EBQL 3S96B 4YXHL 2VLJE 1FRGH 4U1KA 3NCBB 4LP5A 5DJAB 4NRZA 3FB7B 4AIZA 1CD1B 2OZ4L 2AEQL 4YHML 1QRNA 4ZXBB 2O5ZL 2EZ0C 4R97C 5J89A 3P4NA 2IGFL 1JNJA 4NNPH 2ICES 4KUCD 3VXTB 4YAQA 3MJ6A 1JV5B 4P3CH 5DHVB 2MHAB 4DVRH 1FNEB 2VDNL 5CMAA 1BQHG 4DKFL 3SGDH 3HB3C 4ZFOA 3PWUA 2QHRH 3VFGL 2D7TH 1SJVA 4OKDA 1MRFH 5A2IH 1SYVB 2EC8A 4MJIB 2J8UB 3JWOL 1N0XL 3PWPD 4OM1H 5C7XH 1NLDH 5I8CA 1GOGA 3GMNA 4XNXL 3SKNA 3TPKA 4XGZA 5C0AB 5IM7B 4MQ7A 2H9GB 1NAKH 4HIIA 2YS4A 3TO4A 2AGJH 2RFXA 1UB6B 4I18B 3QNZB 4PY7A 5E2JA 1XCTB 2XQYG 4I48B 5E2TH 2B1HL 3BN9D 1XMWA 3CFJA 4LARL 3EOAA 1GGUA 4EDWH 3MYJA 4KFZC 4LAQH 5CEYA 3WO3B 3MLXH 1F4XL 4O51B 3QFJA 3O3BA 2W0PA 32C2B 1ZWIB 2DWEB 5E6ZA 1NC2A 5C8JB 3DROA 1CICD 2CDFA 5EBMB 3ZMRA 1BVKA 5LQBL 3O81A 4LVOB 3ULUL 1FNSL 3JZ7A 1U42A 4NSKA 4EI6B 5EOCL 5MEPB 5M94B 2ZCHL 1A7RL 3VXUE 3BE1H 2J8OA 4L3EE 3MO1B 5EC1A 1QSED 4WFHE 3D3VE 3U6RB 3NTCL 1RI8A 1YUHA 3OXSA 4RMQA 3H3BC 2UVEA 3LAFA 3X3FH 2VZOA 2E5EA 2ZOLA 4ZD3L 1RIUL 4YXHH 4M7ZC 1YN6B 1W2KT 1DVFA 3GMLA 3U79A 2OZ4H 4YHMH 2V5YA 2YWYA 3L5XL 2DICA 5K9OA 1RHHA 4QO1A 4KQ4L 2IGFH 1U3JA 2C1OB 3GSOB 4YHLH 2G5RA 4ZO9A 1I7ZA 3R06B 1TVBA 1QOKA 2J12B 3PIQB 2VDNH 4JPKL 2ID5A 1D6EB 3OR6B 4H26A 5IW6B 3BZ4A 5T5NF 4HS8L 1N0XH 3X3GH 1BWMA 1UB5B 4NCC2 1DBAH 3OX8B 4XNXH 2HP4A 5DD6B 1MCOH 1BOGA 2QHLA 1AH1A 1MCKA 4BZ1H 5A2KH 4YO0B 5DC0A 4LLQB 5AYUH 2O61B 3MQIA 3GBML 4POZD 5EO9B 4NZRH 3ZL4L 1IFHL 4JFXB 2H32B 3MGTA 2X4QA 2B1HH 1ZGLB 2FGWL 4TVPD 5D7IF 4JRYE 5BRZA 1D5ZB 5FGCB 3ARSA 2BNRA 2ZUYA 2FYYA 2VLJA 4XPGL 1Q9KB 2XA8L 3IU4L 1HQRB 2HT2D 4JPWL 5K59E 3MJ9A 4EI5A 2IAMB 4M4PA 3X14B 2R0WH 2GAZB 5LQBH 1JNHA 3FFCD 5D7LB 2FO1A 4CAGA 5FA4A 3L3HB 1VB9A 4XNYH 4HGKC 5E5UB 4K3JH 4LFHD 3AXLA 3AB0C 1S9YA 5TJWK 1KEGL 2V7HB 5AWNL 2DI8A 1HINL 4ZSOB 1ITBB 1BHGA 2NNAA 2NX5E 3G5YB 2VAAA 3WIFA 3VXOA 2VH5L 3T77B 3VXSB 1EEZA 4WHTB 1RIUH 1K3ZA 2A83A 3D85D 1G7HA 3WLWC 1HKFA 3ULVC 3VWJB 2YWZA 4K71C 3GKWL 4JZJB 4PD4J 2PUQT 3V6FB 3DMMC 3L6FA 4U6YA 3IDUA 4GOSA 4S10A 4PV8A 1MCRA 3E6HB 3ZDXF 3K2UL 3DX9B 3MBEC 3PV7A 3WDJA 3I85A 1IRAY 3ARGA 4X7TA 5TDPA 4CVZA 1BREA 1UJ3C 5CSZB 4CKVX 5JORA 4IOFC 2GJZA 3M45A 2AK4E 3TBVA 3VH8B 4Z7OE 1JN6A 3VXUA 1JP5A 2YEZB 1FAIH 4L3EA 3HRZA 3TV3L 3D3VA 1A7OL 3GBMH 4U7MA 4L8DA 1CVRA 1IFHH 1KUMA 3WL9A 1WLHA 4UAOB 3SDCB 4M7JL 2NTFB 3UJIH 1RIHH 5L2KB 4MD5A 2GITA 5FYJD 5IVZB 1AKJB 5IROC 4B41A 2XA8H 3DUSB 2QQNL 5DO2D 5EBWB 4JPWH 1TZIB 4X4XB 1OSPL 3TNMB 1F3RB 3FAXA 4JN2A 3QEGL 4F7PB 1YMMD 3GBNH 4NQXA 3EFFB 2XZAL 2EICA 3U30C 2NCMA 3BKYH 1QKZL 2EECA 5JXEA 3RVXC 2CK0L 4Y88A 2VABA 4OZFB 3QXUA 4X4ZA 4OGYL 2KQMA 1F3DH 4UT7H 4XRCA 3BJ91 1HINH 2PYED 2O5XL 1WGOA 3BEWA 2OS7A 2I9LA 5ACMA 3RI5F 4XBEL 2VH5H 4PJ5D 1TCRB 2XYCA 5E5MA 1HSAA 5DQ9B 4YBQD 5IHZB 3O3AB 3FCTB 4X9FA 1WBYA 3CNKA 5KW9L 3SGEI 1F8TH 4JRYA 1BZ9B 2XTLA 4U3CA 4GH7B 2VZUA 3K2UH 5C71A 3OAUL 4KZDH 4XCEB 1UQSA 2XV6B 4QWWD 1KBGH 2D31B 5CGMA 1U36A 4MXVE 1M7XA 5T1MB 5IKCA 2X7LB 4TOYL 2JE8A 4YR6A 3WSQL 5HGBB 2DYPB 3TJHD 4PRIB 3VGHA 5KVDL 1N2RA 3WKML 1CE6B 2EXYD 1CFTA 2BP3A 2NYYD 4LVNC 4APQB 1OAYH 1IQWL 4G6AC 4PJBB 3VXPA 4LSSH 4JPIB 1A7OH 4ZAKD 4GBXA 4TTDC 4ERSH 4G3YL 3QFDB 4UIMA 1XIWB 2EYRB 2NX5A 3CFEB 1BFSA 3O6FB 1DQJB 4CU6A 4U1LA 5IEKB 4HK3N 4PRPD 5HGAA 3H9SD 1N3NB 3CFKA 4Y4HB 3NCCB 1T03L 4AMKL 2QQNH 2VLRE 1UZ6E 1DQLH 1INDL 5F8RC 3VFNA 4X9GA 4TNWF 1D9KD 3QEGH 1CLZL 1ZVYA 4LPCA 1H15B 2XZAH 5E1AB 1NJ9B 4XXDA 4RFOL 3QQNA 5EZJB 4EXKA 1QKZH 1I7RA 4XH2B 5D1ZC 3MOQA 2CK0H 4YGVA 4Y4KD 3QO0A 4HWZB 4OGYH 3DNKA 5DTFB 5AEAA 4PJ7E 1ETZA 3QDJD 2OTPA 3GRWL 1TQBC 4YQXL 5FDWA 2AK4A 5FV1L 3IJYA 4PRDB 3ZTJG 1MQ8A 5J1SC 4GXUN 5J3HC 4YDIL 3EO9L 1DR9A 4N8CL 1R3IH 1HYRC 1BZQK 3UZEA 3BH8A 3KLHC 5GSVB 1YJDH 5KW9H 4PJGB 1DSFL 4ODHH 1GIGH 2LAAA 4OD2A 1A7NH 5D72L 4RDQF 3HAEB 3OAUH 1CT8B 2I60H 4R2GD 3WMSA 3GSUB 4HW6A 5DK2A 4F57H 4XX1E 3OKDB 4ODWB 3LN4A 4DKDC 3UYRL 1LEGA 4TOYH 1DFBL 4NQUA 5L88L 5TFSH 4RFEB 3SDXB 1NBYA 4YHZL 2HG5B 1XR9B 2QQKL 4RZCB 1DE4B 5F3HB 1IQWH 5AYQA 4HKBB 4NZDA 1JVKA 1T2QL 2HVJB 4PRAB 3REWB 4PGBB 1K4DA 4G3YH 4UNTA 3BKCL 2XWBA 3U82B 4ALAL 1U8KA 3BIAX 3L3KA 4TTGA 2V2XB 1ZS8A 2DM3A 3JWDL 3RL1A 2Y1VA 4BSWA 4ZFOL 2M2DA 2WZPD 1LK3L 1F97A 4Q0XL 3ZE1F 5JDSA 5FA3A 1V7NH 4OLXL 5DS8B 1N5AA 1DLFL 2PW1A 3QUMB 2GTZB 2QR0A 4X6DF 3WE6A 1CLZH 4P3DA 1RPQA 1S78D 2Z31B 5M95B 4X9BA 1T83C 2X89D 5FOBB 4FQCL 4QHKI 3GJFK 1CS6A 3WFZA 4JLRA 3EDDA 1KULA 1BIIB 1L6XA 2OL3A 5J9PB 1I3VA 2F8OA 3BRDA 3MRJA 4HC1A 4RBPH 3N85L 4AEFA 4RCAA 3S96A 2HVKA 3MCLL 4XPFL 1C7TA 3Q5YA 3N9GH 3IDXH 5INDA 3THML 3WJLA 2RR3A 1LO3L 4IOIA 5DJ2B 4ZXBA 5EIIB 3O9WD 1DSFH 2ADJB 3RBGA 5IV2B 3ZLQC 4PJAB 3VXTA 4DZ8A 3IDYB 3X11A 1JV5A 5DHVA 3SE3A 5ADOL 2VSCA 3ARWA 4OD3L 4QRTA 5C9JB 4Y5YA 5E4EC 2VLRA 2VR5A 2J8UA 3ULVF 2ZPKL 4IMLB 1DFBH 2BSRA 3G6JE 4ZSOE 4DGVL 4R4ND 5L88H 3LEXB 3NCYP 1U8JA 2BFVL 4YHZH 1UM4H 2UV3A 2BSSA 4YXKL 1JZ7A 3GI8L 1UB6A 5GS1C 4JQVA 5I74B 2WUCH 1HDMB 2AAVA 4G9FE 4PJ7A 4XHJD 3RU8L 3TVMB 4Y4FC 4YDVA 2ZJSH 5L6YH 3BKCH 3O2VL 4ALAH 2XTJB 2IPKB 3VDAA 4N0YL 2VQ1A 1GZPA 1UWXK 3KR3L 4J3WA 3QRFM 2DWEA 2Y07L 2QV2A 4GAGH 4NQCE 3VA6A 2MSPA 5MERB 1PYWB 2GFBA 1HI6B 4OLXH 7FABL 3C09C 3FT3A 4JVWA 3T2QA 4M1DH 2IMNA 2YD7A 5SWSB 1S7SB 3HMWL 5DRWA 2BVYA 2I9TB 1QFPA 4KKAC 3AAZB 1K4CB 4TUJB 4KJQD 3T65A 1TETL 5I76A 1DDHB 3R1GL 2H26A 2QSQA 1SEBA 2WWMC 3QJHB 1U3HA 4JKMA 3N85H 4J4PC 2ESVB 1NFDF 4QNPE 3N0PB 4FTVD 2P5ED 4HF5H 3MCLH 3MJ9L 4PLNC 4XPFH 3OXRA 4RAUA 3T0XA 3WV0A 1KSRA 1T89C 2CR6A 4HMEA 3HZKA 1LO3H 1EFXB 2X4UB 1AQKL 2Z91A 3ARFB 4O2FA 4E5XB 4F33B 5C08D 3CVHA 4EUPB 3GSOA 4V1DB 4OZ4B 5AAMA 4OD3H 4QHMA 4QT5A 1MCBA 2B1AH 2YD1A 4KQ3H 3OR6A 2AV1B 5DGQA 3AGVA 2R1YB 5JUEH 2VE6B 4H1LB 3SDAD 1M7IB 1K2DB 3GMPB 4XNUL 1RJZB 3BIKB 1FVDB 5FEBA 4BSVA 2MCG1 2YRPA 1YMHB 4YXKH 5B3JE 3VXNB 2HTLD 3PDOB 5KJRL 3ZKQD 3H3PH 2H32A 3VFTB 4HX1B 4LLMA 2V2TB 4TSBH 2W9EL 1YEJL 3O2VH 1D5ZA 2W92A 3FB6A 4WI6A 3KR3H 1CXIA 5J13C 1X7QB 1G7LB 4N5UA 5B8CB 2Y07H 1EHAA 3WXWL 5E9DE 3VD5A 3DETD 1OGTB 4JHWL 5D1QC 5FF6A 4XHQA 5DZLA 4P5TA 1RZKL 2XFXB 4P9MH 3MBXH 1OD7A 5HPOA 3TH2T 1QEWB 1E6JH 2IQAB 4C58B 2BVTA 3BN9C 4PJBE 2K7QA 2BC4B 3BMVA 2WWKO 3R1GH 5T3ZE 2EEAA 4QRPB 3G6JA 4ZSOA 5IBTL 3SE9H 1D3CA 1NPUA 2GJ6B 3IGAA 3LEVL 5GPRA 3RJQB 1BLNA 1XGQA 1S7TB 3RTQD 3T77A 4A6YH 3OKOB 5F1SA 2XNAB 3IFOB 1NFIB 3MXWH 2ORBL 3U7YL 4G9FA 5LGKA 4JZJA 3UTSD 1HH9B 1AQKH 4P0DA 1YYLL 5LBSL 5DFTA 4X6EB 1QR4A 1NBVL 4LCUA 1UXWA 1M05A 1CZ8L 4OZGE 3ZSTA 4NQCA 2VC2L 5HHNB 4G43A 3EDJA 1BFVL 4MA8L 3NPSC 1KIPB 5KSBB 1S9XB 3RL2A 2IADB 3SGKC 4C56D 5HYSG 4K3DL 5IOPB 4RWHA 2W0FA 2R1XB 3SOBH 5ILTL 2MPAL 3MLYH 5E8PA 2A73B 1A22B 3NAAL 5T1DL 3W82A 4LKCB 4PJGE 1YEJH 3I6KB 5ID0B 5IVZA 1YNKL 2Y72A 2BRQA 3DUSA 1AI1L 4Y4KA 3QUXB 1JNLH 3TNMA 5HHPA 3DVNB 2E9IA 5DURB 3H7BA 1LO0L 5H94B 1XR8A 1E0OB 1MAJA 4JRXD 1UH3A 3V5DB 1RZKH 4B53A 3OKMB 5EH1A 12E8L 1LQSR 1CG9B 1D5XB 3Q48A 5BOZG 5FV2A 3MRKA 4DUXA 1E4KC 2NQCA 3LKQB 4FXGA 4WDIA 3RDTA 4CN6A 3QUYB 2NY4C 5IBTH 3LB6D 3IXTA 5GGTA 1JCKA 5E8EA 2Z0BA 1CFQA 4OCSL 1HXMB 4FQ2L 5IB2A 2R29H 2DMBA 4GRLB 5BJTB 3EYSH 4GKSB 2R2BA 4DEPB 3BKMH 3RI5K 1I1YA 1JE6A 3QIBB 1YYLH 3MLTA 4AK1A 2CDEA 5GZOD 2UZIL 3RWDA 4ZO6A 1NBVH 5CBEA 3UTTB 5HBBA 1TZGL 3ARED 3PL6D 3Q6FA 3HMXH 5F9WC 2X1XR 5E9DA 5FOJA 2YSSA 2DMKA 5DQJB 5MEOB 2DQJL 5T1MA 3BVNB 1R3KB 3MXVL 5KANG 1W72B 4ZPVA 2N4IA 1MNUH 1CE6A 4K3DH 3KPRE 4G8GB 4BELD 5ILTH 2MPAH 4PJBA 5F72S 4JPIA 4P2OC 2Q20A 3NAAH 5T3XD 4R26H 4LLAA 3QDGD 3G6DL 4X83A 1XIWA 3TT3H 3CFEA 1UWGH 4KRPB 4GKNB 3VXQA 1OW0A 1V7MH 4XP4H 5CLTA 4MJ6B 4Y4HA 1G7IB 1AI1H 5C3LD 3FOMA 4G8FB 2Q8BH 3KVQA 2ZSVB 5J06A 4ZS7H 3QPQD 3TBTB 4H5SB 3CSYB 3EHBD 2VL4A 4OV5A 4RGNE 2DQCL 1U9KA 1X44A 5LKNA 5E1AA 1NJ9A 4M93B 4PJ8D 2B20A 12E8H 4OZGA 4TNWK 4KH2A 4P5MA 4D0CB 1FL3A 4JKLA 5DTFA 1XGPB 3SE4A 4D9QE 4QHLA 4HKZB 2YZ8A 1V3KA 1NEZB 4PRDA 3WNMA 2V9TA 1JMZA 4X9IA 3F7RA 3OAZH 5ALCH 3ZKND 2DWDB 3VGGA 3H6JA 1EV2E 4TN9A 2A9NL 4BH8A 2B2XL 3ARDB 4JY4B 3I75B 4PJGA 3NGBC 4M3JA 4LNVA 3CUPA 2UZIH 3NCFB 1F2QA 3HAEA 4HBQA 1TZGH 4KJWD 1CIDA 5TE7L 4WCYH 2ZUQB 2J3SA 5E8OB 4LLYA 3C5JB 4YC2C 1CVSC 1MHCB 2DQJH 1I1AC 4LCWB 4Y5VA 4RMVA 2OL3L 1P4IH 4KHTL 1TTGA 1F13A 1GC1L 4ODSH 1XZ0B 3U83A 4HD9A 1DQDH 4KK9D 5F1NB 1XR9A 5HYJD 1LE9B 3L3GB 3FO9A 4XAKD 3PGCB 5MP6L 3AU1A 4HKBA 5DHXB 5ISZD 1XGYH 4FQQB 2W91A 5I9QC 5E6IC 5HY9B 1KENL 3CC5A 2ATPB 1ND0B 4QWWC 1ZA6B 3I2CL 1AXIB 2Z93A 3QYCA 5D1XB 5IQ7L 4BJLA 5L9DH 4YHOH 2QADB 5DJDA 4KV5F 1T7WA 4K8RD 4NNXA 2JCCB 5C6WH 1L9NA 1HHHA 2OCFD 3MREB 3I50L 4L4TB 2XWTB 1FE8L 4A2LA 5BRZD 1ZA3B 4X5WA 4ORGB 4P48A 2ARJB 3W5MA 3DVFA 2Z31A 5BO1L 3D25A 4PRHD 4HUVA 4EI5D 4QHUA 1HHGA 1MEXL 4QEGA 2XY1A 3VGDA 3KPSE 1EXUB 1UVQB 1QACA 1SQ2N 4FZEL 1H3XA 1HCFX 3KPRA 3NH7L 5IJKC 3O8XD 3CK0L 4OKVA 2VJXA 2YK1L 1D9KC 4HBCL 4YWGL 4QCIB 4EOWL 3BYYA 3QI9B 1T3FA 1K6QH 2A9NH 3WN5C 4MAUH 3DSFL 2B2XH 4NO5A 1RULL 4WV1B 1IAOA 4XMLL 3V0WL 4PJIB 2HFEA 2FATH 5D5MF 5DF0A 3C08L 2A6JB 2X4PB 5TE7H 3BOVA 1A9BB 1RJYB 2ADIA 3HE6A 3MRNB 2RCSL 1CGTA 1KYOK 1P7QA 5A2LH 1MCDA 5CEZH 2YD8A 4IMLA 3NIDF 1VKXB 1CBVL 4KHTH 3LEXA 2XXCB 1JPSL 4R97B 4U6XB 1OLZA 1YQ2A 1NGZB 1GC1H 2UYLA 3JWOC 2X70A 3VFPA 4QXTB 4KZEL 1JTOA 5MP6H 4NO2A 3TJEL 5JIKA 5KG9B 5SX5H 3MX0A 4WW1B 1DBML 1NBQA 3HCVB 2CLZB 35C8L 5IR1B 5K9KB 3CVHL 4HKJA 3I2CH 4NPYA 5DHVH 4KMTH 2O26U 2OTWB 1WF5A 4WFHD 5C0IB 4JAMB 5AD0B 1ZV5A 4LLWB 1FE8H 4TSCL 3SGEH 2BOCB 4MYWB 3CCHA 2WWKT 3VD9A 1BBJA 2YD5A 2MMXA 5KSBE 2R69H 1JGEB 2F54E 2P49B 5KSAB 4FQIH 2HLFD 1WEJH 5BO1H 2X9YA 1IT9H 3ULUC 5E70A 3RWEA 1KTRL 3HI1B 1OP3H 3AAZA 1RZJH 4TUJA 4HGMA 4O9HH 4NQTA 4HXAL 5KS9E 2VXSH 1MCWM 5GHWL 5C0CD 1MVUB 4PGDB 5EA0L 3V7AE 4P2QB 4FZEH 2C1PA 3VFSB 5I1IH 5DRZB 4IOSD 4R96B 4P2RD 1KLFA 2BVOA 3NH7H 4NWUH 3TN0A 3DPBA 1SEQL 2I27N 2YK1H 4IMKA 3Q0HA 4F7CA 4HBCH 1QHOA 4YWGH 2FH8A 3ARVA 4YFLI 1AR1D 1IJ9A 1U95B 4MWFB 2WUBL 1S78C 1MJJB 4NQSB 2X4UA 4D0BA 4E5XA 4M1GH 5F7DA 4P4KC 4RFNC 3C08H 4XAWL 4M7ZB 4JO1L 3G08A 3OKNA 2XICA 5E03A 3TO2A 3CMGA 4U2YA 4H1LA 1TJGH 4HJJH 5A40E 5HXMA 4F7EB 5KAQG 2J88H 1JPSH 4ZS6D 3GMPA 4GXVL 4UI2A 2YD4A 2W59A 4KU1A 5DLMH 5BS0E 2QL1A 4HKXB 3KPOB 3O9WC 3PABA 4OLYL 1F11B 3KPSA 3W2DH 3TJEH 2BVQB 2X4OB 4ONGL 1SJXA 2FJFA 1DBMH 35C8H 3KPQB 1KTDB 5I1LB 1CE1L 1II4E 4GRWF 2Y6SD 4NRXA 3T0AA 4MLIA 5JZ7C 3SGJA 5GRZA 3QQ4B 1S7XA 4FMFA 3WFEH 5GJTH 1IGML 4X4YA 1P6AB 1T7YA 4X6DB 3UPAA 1INEL 5IFAH 3VGFA 3EZJB 1T7ZA 4DWHA 2XFXA 2YD2A 1AHWA 1LGVA 4UNUA 1I9JH 1EJOL 4M00A 4R9HA 1N7MH 1UT9A 4XHJC 1ZGLM 2IQAA 3MMEB 4OZIB 3KPLA 2BC4A 2NLJB 2FRGP 4HXAH 1KYOJ 4NO0B 4Q9QL 5GHWH 3O41B 3IRPX 3G5XA 1U93B 2R2EA 4X8XA 4PJDB 4QRQA 3G5VA 4R3SB 4ORZC 1SEQH 1A2YB 3IFOA 3IJHB 4ESKA 5GGSY 3AB0B 3SKOB 1BD2D 3WS6A 2VXVH 5E7BA 4X0KB 1R24A 2VXUH 2F74A 1NL0H 1FG9C 3WLBB 2HT4D 3FN0L 4HFWA 3MNWA 3VDBA 4JGUA 3WKNA 4CMMB 5JW4N 4RISL 1LO5B 2FDBP 1GGYA 5HHNA 2CJUH 4JO1H 4LHUA 4K71B 5DXWA 2DTML 1YEEL 5GGTL 2X10A 4HDIB 5KSBA 1R6VA 3DMMB 4OZHB 4P46C 3LS4H 5EN2B 2IADA 2F54A 2XKSA 4XWOD 1NDGB 3MBEB 3ZYOA 3NPZB 4ZODA 4DGIH 3L5JA 1ZTXH 2LVCA 5KS9A 5EDXA 1KFAL 3CJJA 1UJ3B 2IEPA 4ONGH 2D0HA 2C3XA 4ZUUB 1CE1H 4X99A 1M4KA 3MRPA 4M7KL 3MUJA 2C9AA 4NQDD 3C9NB 2JELL 2C3WA 4ZUSB 5A2JH 2M1KA 2A6IA 2OK0H 2FD6L 4HZLB 4PR5B 1C5CL 3VXRE 1IGMH 1H5BC 1HN1A 4DK3A 3UXFA 2V5TA 4KROD 3OKMA 1EJOH 1RK0A 3NFSL 5TF1H 5HJ3A 1ORSB 5T3ZL 5GS0D 3LKQA 4R4FL 5BV7C 1IC5L 4Z7NF 4RNRB 3VG9B 3QIWD 2A6DA 5C07B 4GAJL 3CX5K 3P40A 2NY5H 3U30B 5BS0A 1FVEA 2X1PA 1T20A 3U46B 2XN9E 4R8WL 5ANME 2DLEA 1X5XA 5IJVB 5GISL 3O3EA 4GRLA 5BJTA 1EZVX 5K9JL 4UBDC 4AT6B 3OJVC 4TYUA 3MNVA 3KPMB 3KLDA 1NMCC 3U4BL 1NCBL 5ELIA 5GXBB 1A6VL 4QRSA 2XQYK 3UTTA 3HNTL 1JYVA 4ZNCD 4OZFH 2G2RB 3CDGA 3QWRA 4G8IA 2PXYD 3KXFD 2X2YA 4I0PA 3MRDB 1ZGLP 4WHYH 4WFEE 4HS3A 4LPXA 5KN5B 4JFZL 3HUJF 4OCXL 1FZOB 4NDMA 4X6CF 1U92A 4UOW0 4PJHB 4GMSH 4M03A 3PGDB 3IKCB 3OMZA 1KFAH 1ZVSB 2EDRA 1JPFB 1LVEA 1DUYA 3UCRA 5FIEA 4Q9CA 4PJIE 3IDMB 4PP1D 4XXCC 1OAZH 1WFNA 3MCG1 4LLVB 4LVNB 5J6HA 2P5WE 3P0VL 1N5YL 2JELH 6FABH 4LOUC 4P2CG 2FD6H 3TBTA 3V4VH 2ADGB 3CSYA 4H5SA 1R3JA 5DJ0A 3D18B 1LEKA 3T3MF 5I75C 3N1MC 3VXMD 2EXWD 1D6VL 1HKLH 1MFEL 1MRDH 4L9LC 1XGUA 1WT5A 3MUGA 1CGXA 3VWKA 5KSUB 1NGWB 3FB5B 4U7SA 4IEFB 3P9MA 2PKDA 1I1RA 2BJML 1XF4A 3BO8B 3V4PL 3ZHKA 2CRMA 3AM8A 4J12A 3UJJL 4NYLA 2UWEB 1IC5H 1XGPA 4AH2A 4Y16C 2R2CA 4KDTC 4WTZA 4K94L 1NEZA 4GAJH 4LF3B 4EN3A 5LGHH 5DRXA 1A7QL 4JG0L 5DEZA 3BDXA 1IZJA 5D1ZB 4JKKA 1RQ5A 3DHJA 3QG6A 3ULUF 2VAJA 1OOAA 1R5WB 4FP8H 1A1MA 3BJLA 5C0BB 3ZO0A 1AGEA 5JXAL 1X3DA 1H9VA 4FG6D 1TQBB 1FYTE 4R0LA 3NZHL 5D71H 1OGAB 3EYQC 2RGSA 4GAFB 1Q1JL 3HNTH 5EZIH 4M7LL 2Y5TB 5E8OA 4MVBD 4F80A 5IESL 1V3JA 2Y7QB 1BBDL 5F1IB 1X5HA 3VXRA 3C5JA 4RGMB 1MHCA 4BQ8A 1JYNA 4Y5XC 1KNOB 4P2QE 4ELMB 1FFOA 3D2UA 4HIJA 1XZ0A 4OCXH 1IGIL 3RUGB 1IAII 4LLDA 3W0WE 1NSNH 2YUWA 2D03H 3QXDB 1RJCA 4JFDE 3DVGA 4HFUL 3TA3D 3SKMB 3T8XA 4GFTB 1GPOH 3ISWA 1X5FA 2L4OA 4U49A 4AEHL 4F7MB 4XC3L 3CX5J 5C0DB 1OCWL 2QKIB 2XN9A 5ANMA 1NCCH 2WQRA 3VW3H 1N5YH 3SDDD 3UTZB 3JWDC 5SWQA 1PEZA 2IBBA 2XQBL 3OB0H 1BQHB 2E7CA 2P8MB 5J7CC 1QSFD 3MRHB 5JPMB 4MCYA 4M61A 2FJGA 5KVFH 1NGQH 1B0RA 2P1YA 3BH9B 4N0CD 4KI5C 4ELKB 1ES0B 1G7JA 4ZQKB 5E99L 3TO4C 2FEDD 3V4PH 4MB3A 1I8KA 1UVQA 4WUKL 3TBWB 4YEEA 3HG1B 3LV3A 3LSOB 5F7WC 3QQ9C 1U91B 1OAKH 4DN4L 5MI0C 3WFCL 5ABDE 1A14H 4QCIA 2FBOJ 1QFUL 5D2LE 1QR1A 3AVEA 5GRYA 3EAKA 1AE6H 3X12B 1VFBA 4UDTB 1DLHB 5JXAH 3QUMH 1TIUA 4PV9A 5FO7B 2KH2B 2OQJA 3W9DA 4PJIA 3ECBB 2X4SA 4UTBL 1H0DB 3D39E 1HH6A 3N1PC 1GZQB 4JCLA 5I8EA 4G9FD 4M7LH 3QSKB 4EXPX 4JHAL 1KJVA 3I6LE 2NY3D 4Z0XA 4LCYA 3S3SA 2GI7A 3NFNB 1JWUB 1FJ1A 1IGIH 5GSRB 2DLFH 1K9TA 1MCPL 1D5BA 4KUZL 5EULV 2D7OA 1FNGB 3EYUH 1YPZF 5KG9A 4HFUH 2NY0D 4WNQA 3LOWA 1DVFC 5T5FH 5IR1A 2HFTA 2CLRA 5DD0H 3DI2B 3WHXB 3DO7B 3RFZC 1OCWH 1QLEL 1B0GB 5JLZB 3MA9L 1QBLL 1SJEA 2QTEA 1HQ4B 3RKDD 2ZSWB 5DJYB 5EU7C 4U1NB 5GGUB 4P5KB 2R2HA 1IGFH 2BOCA 4JVPA 4KK9C 3UO1L 3KYOB 3MSPA 3PNWA 4Y4FB 1JHLL 1FYTA 2XQBH 1C5DB 3PP4L 4LHJB 2H3NB 5KSAA 5E7FA 2ICEB 3VFMB 3BAEL 3MZGB 1MJ7H 3BX7C 3FKUS 3G6AB 4LSTH 4LLUB 3LRSB 3LY6A 2F53E 3QDMB 4WUKH 4YPJA 4P2QA 3OZ9L 3C09B 5DRZA 4FFWC 3W0WA 1O5DT 5HGHB 4JN1L 1IC7L 1J8HB 4LGRB 4U1SB 4JFDA 3RWJB 1UACH 1QFUH 3GIVB 2R4RL 1UENA 1N26A 4ZUTB 1PY9A 5L2JB 3K8LA 3TYFB 1OM3L 1FN4B 4EI5C 2JIXB 4G8EB 3T2OA 3RX8A 4UTBH 4C57C 2O5YH 1AIFA 2L7JA 1QLFB 1SM3H 4K07A 5FXCH 4JM2A 4F7EA 5I66B 5HHMB 3BZEA 5DC4B 1LDPL 4U33A 1CLCA 5F44A 2EH7L 1MCPH 4KUZH 5ID1B 4HKXA 3MROB 5IB4B 1F11A 4PJFB 4F9PA 4OAWB 4DFIA 4JG1H 2QQLL 3LIZL 1KTDA 4EUPH 2FH6A 1PJ9A 2X4TB 4JANB 4S2SB 5E56A 3QUZD 5I8KL 1CXLA 1RZIB 5CJ8A 2HN7A 2D2OA 3MA9H 1NKOA 1HHKB 1QBLH 3GI9H 5D2LA 2L0DA 5DFVC 1KT2B 4ZYKB 3ARGC 4LPTA 5TQ0H 4LNRA 3ZT5A 5JPNB 4H1LH 4N8PA 5CWSA 3ZT6A 1N8ZA 1UXSA 2MOVA 1OAUH 3D39A 1KJ2A 5EZLB 2J6EH 5BCAA 2W38A 1I9RL 5J13B 4MD4B 5EO1A 3JV5A 4Y19B 3GSNB 3H3KA 3EZ8A 1MHPH 3EJYD 3FN9A 4GG8B 3M17A 1CR9L 3OZ9H 5FKPB 1MF2L 3M1BA 4XBGB 3ZTNH 3NIGE 1FLTX 4B0MM 4R3SA 5HGDA 5ITFB 4Y2DA 1I8IB 4JN1H 1IC7H 4XVUD 5F6HI 4YZFE 1A8JH 3FONA 4OV6F 1CFNB 4OGXH 5DMGC 1YEIH 3U7WL 5HHOD 3LQAH 4N1EA 2WP3T 1A1OB 4BK4A 1ZVHA 2JTDA 3MR9B 1OM3H 4QTHB 3WLBA 1ITCA 1X5LA 1FSKC 2HJFB 4CU8A 3TNNB 1OB1A 4N0RA 3GFUA 4UOW1 1GAFL 4LQFL 5JXEC 5EC2B 1YNLH 1AJ7L 5C2BH 4U2ZA 1U8QB 3MV8D 4OZHA 3MACH 5HDBF 1QQDA 2DS4A 3U4EA 2BOBB 1NDGA 3KYNB 4POYA 1F4WL 1LDPH 4Z8FH 4YPGA 2EH7H 1SVZA 3NIFE 1R5IB 1Z3GL 1XAUA 4CNIB 1T0NB 4LEOB 5E95B 4XPAH 3NN8A 2C3VB 2F53A 3NPSB 5JOEA 3EJZD 3HFML 4YNYB 2QQLH 3TGXA 1URLA 1MCQA 3VH8G 2DM2A 3B83A 1HHJB 1L7TL 4K3GA 3SCMD 3REVA 5I8KH 2YPKA 4NIKB 3ZHDA 1S8DB 4JDVB 3FQUB 1F90H 4MS8C 4JDZB 1IM9A 1QVOA 3D0VB 4KKBC 4ZS6C 3TBSB 2VMFA 1PEWA 3IFLH 5JQ6L 1YEHL 2MTPA 1W72L 2BVPB 1EA9C 3OQ3B 4XNZC 5DR5L 1J88A 5CP3A 1A6AB 5DEFB 1I9RH 1KTLB 2Y9RT 5I1JL 4M43H 3EYFB 4OUOA 4DN3L 4OLEA 2ENSA 5ETUB 4FXKB 5ICZB 3MRMB 3RIFF 4GW1A 3ARBA 1OARH 5ENWA 1P4LA 3RWIA 4YBLC 3Q6GH 2DL9A 1ED3B 3A67L 3VE0B 4JFFD 4IS6A 4GBXC 3LKPB 2ZWLT 3STZB 1CD9B 4OZFG 1VFAB 1AGDB 2IANE 5IJVA 3I9GL 2PO6D 4HLJA 3WUWB 1X5GA 1OSZA 5E2WH 4WHYG 3HC3H 1MLBA 4KI5F 5BZWA 4M6NL 3T4YB 3RNKA 2NY4B 1P4BL 3RIAF 1FH5H 5CBAA 4FRWA 2KKQA 2JB5H 5AG8A 5HI3D 4W70A 1G9EA 4U1HA 4U1MB 5JO5A 5A3IC 3ARZA 1X4ZA 3FFCB 3IFPB 1QA9B 3IDNA 3EOBA 4QOKE 4ODUA 4LQFH 1VADB 5FO8A 3MRDA 3QEQE 5I73C 4LSPL 5KN5A 3HTLX 3RNQA 1XGRA 4HV8B 5EUOE 1P6FA 2EDEA 1MFCH 1F4WH 1OTUC 1UADC 3HE6D 3BSZL 4WO4D 2HT4C 3CPLB 1A47A 5F9WB 2VIRA 1EHNA 1EVUA 3LQZB 1SYSB 4AL8L 3F62A 1RFDH 3DTXA 4GRWB 2A2QT 4IRJD 1T1XB 3D85B 3IDIA 3VRLF 3IDMA 1JGDA 1FZJB 3Q5TA 1J5OH 4JY5L 1SHMA 3QH3B 3FJTA 4UINL 2FX9H 4P2OB 4MNQE 1EGJH 2WLYA 1PKQE 4HGWB 1YEHH 1WAAE 3KPPB 4Z77B 4XZUA 5ITBL 1W72H 5D6CB 5EO0B 4YHPA 1BZ7A 5DR5H 1KB5A 1UFUA 4ZOEA 1KC5L 5K33A 2P8LA 1G1YA 1EBAA 1T1YB 1VPOL 1PLGL 2HFFB 1UCTA 2ICWB 5KAQF 2XZQL 1JGVL 3MLVH 3A67H 4LCIL 3P11H 4HUXB 5LCVL 2YD9A 4U7KA 4PPTA 2NW2B 3KNBA 1I4FA 1S5IL 2AABH 1LILA 1VERA 4OQTH 4HK0B 1Q94A 1TNMA 2RB8A 3I9GH 1S7UB 1IGJA 2C4FT 3GMQB 3SPVB 3WD5L 1GRWA 1VDGA 2EYTB 3UBXB 4U0RC 7CGTA 2B5IC 5GS0C 2MWCA 1QFWM 3WYRA 2Q7YB 1YMMB 2YKLL 4YK4C 4NOBA 1U6AH 4ZUWB 1FO0A 3MRQB 1OF2B 4NO3A 3HAEG 3NGBB 4MSWA 2G5BB 1DQQB 3B2UD 5F21B 4GT7A 2AJYH 2PYEB 3BSZH 2YPLD 5F7LB 5H35B 4L3CA 1A3RL 1GXEA 2CUIA 3SKMA 5C6TH 1MWAA 4YC2B 3L7EB 5CILL 4U1JB 2ZNWA 4RGOH 4G7VH 3WJLC 1Z5LB 3DO3A 3PHOB 2J2ZA 4ZXBC 5C0DA 2IC2A 2QKIA 3KPSD 4IRSA 2IANA 4TPRL 5F96L 3SY0A 4D9RE 1AFVL 3GM0A 3SE3C 4GXUM 5BW7A 1QLRA 3GMRB 4Y5YC 1DCLA 3PWJB 1XH3B 4Z7WE 5I9QB 5E6IB 1MI5D 5DA0B 2XG5A 5D7KD 3MLUH 3QNXA 2WBWB 3BXNA 5CJXA 3MRHA 1RVFL 2FLRT 1IC4H 5ADPH 4PRNB 2RJMA 3MV7E 5E0QA 1LHZA 2X4RB 4QOKA 1EVTC 3QEQA 1Y18B 3VA2C 4PB9L 4GG6B 3OHXA 3IDGB 5IF0B 2XZQH 1AGFA 1JGVH 3HG1A 4JQVC 1YA5A 4MA1B 1SY6H 5EUOA 5LCVH 5IW3A 3O4LD 1QBBA 3BP7A 4DUVA 3V8CA 1JNNH 3TC9A 3FRUB 1W0VB 1UH2A 3RWHA 2EDFA 1B0WA 1AXSB 3X12A 5DMKB 5FO9A 3LEYH 3H9SB 3OL2A 4J8RA 3RZCA 3E6FA 1JHTA 5BVPL 2LAGB 2AKRA 1H0DA 5IP4A 3TM6A 3Q1SL 4Y1AD 3PWPE 1FZMA 1D9KB 5EU6D 4MNQA 3JBG7 1EAJA 2YKLH 1PKQA 2Z92A 1WAAA 2GK0A 1BVLB 2X4NA 3DGCR 2KZ1B 4KHXL 4KTDL 5SX4H 4PJXF 4N8VA 3UAJD 5CP7B 1MIEL 2CGRH 1U8PA 2D7NA 3OKLB 1M7DA 4LHUD 1U3HC 3HI5H 2VYRE 1ZT7B 3MJ8A 3RVWC 1FP5A 3I84A 1C1EH 4HIXL 1A6ZB 2NXYD 2EYSB 1KTKE 1RUPH 1FG2B 1ERNA 4HUKB 4MAYD 3ESUF 2APTA 3FQNA 5F96H 5I30L 1AFVH 2DQDH 1DANT 5IHUH 4NHCH 4OF7A 5DJYA 3EDEA 5C0RL 5GGUA 1B4RA 5EUKA 4PJ9D 2W60B 2VO5A 3AS3A 4XPTL 4GJTB 1UM5L 1UEYA 1QSEE 4PJCE 1Q9OB 2CRZA 4PP2A 2XKNB 4X4ME 4L5FH 2Q8AL 1KIRB 1YC8A 3G6AA 1MIML 4MHHI 4FQXD 4S1DC 3DX6A 4K2UL 3H42H 5K59F 1Z2KA 1IAIL 1JRHL 2AJVL 1T0MB 3DX7B 3PWLB 4KJPD 1JI1A 4ODTL 4U1SA 4BFIB 1YDPB 1FC1A 3T0VA 4ZFFA 1VENA 4ISVB 3GIVA 5FGSA 4DTGH 3ARYA 3MODH 3O2WH 3TYFA 3EUUA 1DZBA 4G8EA 4NNYA 1FORL 4K7FB 3PV6B 4LRIA 5BVPH 5ICYB 3PDDA 4HWNA 5D70L 5BMFL 1FC2D 1X4XA 3Q1SH 3JV6B 4RRPA 4P5TC 1J1OL 4JFPB 4PS4L 3L3JB 4Z7WA 3QXAA 3ZDZE 1Q9LB 4I77L 3B9KA 1DJSA 2QSCL 1FL6B 4KHXH 4KTDH 2E7BA 3QWRD 3SJVD 4KY1L 4P4KB 4PTUB 3PG2A 3MV7A 4RFNB 4HS6B 3WS3B 5FB8B 3GO1H 1YECH 3P9LA 3C6LA 4TVPE 4PJFA 4H1LG 4OAWA 2AQ1A 5JQHC 1WZ1L 3ZDYF 3QCTL 4OF8A 2CKBH 4I3SL 5FHBL 5IVXB 5TQ2H 4S2SA 1YEFL 1RZIA 4KTYA 2NY3C 1U8IB 4UUJB 2BDNH 2G75B 3O9WB 5JIPA 3TIEB 3VFWB 4Z7OF 5C0RH 1EUTA 2ICWI 2DLTA 3W11D 3KJ6H 3V5HA 2DQHH 1KLGA 1IEBA 2LTQC 2DDQH 3D0LB 3PWPA 1X5JA 4K55A 1A5FL 1QNZL 4MD4A 1SJHA 5CIPA 3HN3A 4OM0L 2ITDB 3D48R 4R4BA 2EDYA 2ZUTA 4PREB 3UBXI 4K2UH 4H8WC 4JEGB 1R5VA 2IG2H 3C2SA 1F3DJ 1WCQA 1IAIH 4XBGA 3RKDC 2DF3A 2FWOB 4I2XB 3MRCB 1OAXL 4WW2A 1JZ2A 3MJGX 1BX2A 1CFNA 2UUDH 1ZT1A 4OCWL 3GDBA 2NY6D 1A6WL 4Q6IA 5FHAL 4B50A 2D9QB 4JPVH 4Y4KC 1A1OA 1RUAH 4UDUA 4OCRL 2APWA 3MR9A 1S7VB 1FORH 4JFED 4X8JA 5DZNA 5D70H 3TIDA 1OP9A 1CICA 5D4QA 3C5SB 4O00A 4PS4H 4XPHH 4ACPA 2V5RA 1ZEAL 3QULB 4DGYH 3BUYB 5HVWA 3RDTC 2LVEA 1F3JB 1QSEA 4PJCA 1FL5B 4KY1H 4Q74A 4RBPK 4PGJA 1BFOB 4X4MA 2FBJH 2C3VA 1WZ1H 4FTVB 5TPWH 2P5EB 3DWTA 5FYJE 1FCGA 1KXTB 4I3SH 5FHBH 4YDKL 4MXVF 1PY4A 1DEEB 1RZFL 1YEFH 1UM6L 4WTXA 5EPMB 5IMOB 3T09A 5DJ6B 5A16B 3V7AG 3ULVH 5GGQH 5IMKB 1F45A 2BVPA 3DIFA 2ZNXA 5IMLB 3RWGA 4P57A 5FM5M 3P4OA 5LXGL 4IIQA 3TT1L 4FXKA 3MRMA 1RMFL 3RKPA 1JYXA 3QIUD 1FFQA 4JO3L 1QO3A 1ED3A 3VE0A 4PJ5E 1H5BB 2HT3C 2HYMA 2PR4L 5E2UL 1XIWC 2J8UF 3RIFK 3MRBA 1OAXH 5HYQB 5HHVH 1AGDA 5DUMH 4WFED 2IBGA 4OFKA 3WUWA 1OW0C 4OCWH 5FHAH 1A6WH 1PX3A 3UTQB 4Y4HC 2P7TB 1LEIB 2YUXA 2EDQA 5BV7B 4RQQB 4DOHE 1KELL 4DZBA 5KZCD 4G80B 4DCQB 2WW8A 4X5LA 4NFBA 2W0KA 1FYHB 1W0YT 4H0IA 4MJ5A 3EJYC 1B4JL 3B4NA 3LKRA 5GRWA 5DD5H 1QA9A 3MNZA 4FQHB 4L8BB 3QB7C 1JGUL 5F7FA 3RIAK 2XOTA 4PTTA 3MPCA 4X7CC 1VFUA 2WIMA 3O0RH 5E94B 2IBZX 5SWZD 1NMCB 2MCPH 2ED9A 3C5ZD 2P5WD 3SE4C 1S7QB 3CH1A 5IMMA 1E28A 1S7WA 3B5TA 3ZKSD 2HKFL 3HE7D 3BGMB 5D6DA 1NGXB 4LEXL 2NY1D 5GGRA 3IYLW 4PLKC 5IVNA 5FGBA 4PRPE 4KK6C 1T1XA 3D85A 5DD3L 4R7DB 4YDKH 1OWWA 5D7IE 2Q6WB 2APXA 1AY1L 1KJMA 1UM6H 3TWCL 3UTSB 1ZLUH 3PP3K 3QH3A 5BQ7B 4IM8A 4ETQB 5ACZA 4N0UB 4ZUVB 3DUUB 2RAMA 3EFDL 1FO0L 2VDKL 2CO7B 4HGWA 1XCQA 3KPPA 3MCKB 1VA9A 2E3VA 3IVKA 2AJUL 2AJXL 3GB7A 4D94A 1FNAA 4Y5VC 3M07A 4OIIH 1CQKA 2D7PA 2VR4A 1T1YA 3QDJE 5GIRB 5DEGA 1MRCL 1BJ8A 4XMPL 4OCYL 1E6OH 1T21B 3BPLB 3ROOA 4NZJA 1MJUL 1A1NB 2PR4H 1T04A 1K8DB 4JO2L 4L9LB 3MRIA 4LBEB 3VMOA 1ZHNB 3BP4B 4MQXC 1NGYA 3L3IB 4K94C 1S7UA 5GJSH 5HI4C 5EFIA 1A02N 4WTZG 4LVEA 1EH9A 4NQED 3UBXA 1NEZG 5JHDD 4FQJH 1KELH 1OAQL 3L3DA 4LPYA 2V5MA 3DRTB 1PGRB 2ZCKL 4Z7UB 4I13B 2Z31C 1YMMA 1QPXA 2F19L 4FQLL 1IL1B 4JRXB 5EZOL 3MRQA 2YXFA 1P9MA 5DRNA 5D7JA 1AO7B 2E9BA 2NZ9D 5T33H 2HKFH 2PNDA 5IBLD 3QO1B 4UIKL 1A4JB 2Q86A 3G04B 3IJSA 3MRFB 5GRJL 2VQUA 4LEXH 3Q3GB 3RVUC 4PJ5A 4Y5XB 3PHQA 1KN4L 4K9EL 1T1ZB 3ILQD 5DD3H 4U4BA 2DJSA 2AI0L 5KOVC 4ODVL 3O2DH 1C16B 3STLA 1G9ML 2VDKH 3IAPA 2W9DL 3OKKA 4U1KB 3EKCA 3HE6C 4NRZB 3HS0A 2WK2A 3GGWA 2AJUH 2AJSL 5CEZD 1QBML 2AJXH 3S37L 5D8JL 3NABH 3OSKA 3VMNA 1QRNB 4RGNC 5LVEA 1EEQA 4Z6AT 4Y89A 3P4NB 4PRNA 1CGYA 4YAQB 5CMAB 4XMPH 4OCYH 4ZFOB 3PWUB 3CFDA 2E6QA 3D39D 2DJUA 1MJUH 5I8CB 3GMNB 3QDGB 4I3RL 4ZAKA 3SKNB 4XGZB 3RWFA 2IQ9L 4MQ7B 1AXSA 4HIIB 4ENEC 4TRPL 4ZO7A 4LU5H 3TO4B 4H88L 4NN7C 4PRPA 3HR5A 3X13A 1MQKH 1SBSL 3U7AA 5D7IA 5C0AD 1Q0YL 3GSXA 3J7HA 3CFJB 5MI0B 3GJEA 4M62H 2F15A 3QEHB 5HD8C 3EOAB 3LH2L 4WUUD 1T6WA 1D9KA 3BI9X 3MYJB 2F19H 2OTUA 3QFJB 3VDCA 3O3BB 1FZKB 1NC2B 2HTKC 1BAFL 2Q87A 2KQNA 3DROB 4G6ML 4OF5A 5KVGH 2CDFB 4OLZL 5LJYH 1MFAL 1BVKB 4NKMA 3WFHA 1MELA 4YIQA 4S0TD 2H45A 3SQOH 4F2MB 4NSKB 3QDJA 4UIKH 3O4OC 3TN0C 3PWNA 2EDLA 5GRJH 4IMKC 3FL7A 4LIQH 1GGCL 3F5WB 1A6ZA 5EC1B 4YUEH 1KN4H 3NCEB 4AYFA 5JIIA 4K9EH 2DLIA 2R23B 2E7LA 1FGVH 1YUHB 1FG2A 4CMHC 1G7MA 2F53D 2XACC 4ODVH 1ADQA 2W07A 2ZOLB 5KANI 4AM0B 3B2VH 1CDYA 1G9MH 4BQ9A 1J10A 3B2UC 4JFYA 1DVFB 3GMLB 3V0VA 1GOHA 2AJSH 5SV4A 3W39A 5K9OB 1Q9OA 1RHHB 5ALBH 3WO4C 5EORL 5CJBA 1KIRA 4Z95L 1I7ZB 1TVBB 2WINA 3QEUB 3BKJL 5HYJB 3BZ4B 4FTVE 3FO1A 4YX2L 3RP1A 4I3RH 4OFDA 3ARBD 1F42A 4NQVB 1BOGB 2AEWA 4KJYB 1R3LA 4TRPH 5C08E 3C8DA 3SGJC 1NUFA 4PJBF 5MENE 3MGTB 2X4QB 1Q0YH 3GZKA 3V5KA 4PIRF 5BRZB 3RY4A 5C0ND 1AHWC 2BNRB 2FYYB 4KWUA 3F7VA 1BAFH 1Q9LA 4HCRH 4EI5B 5T1KD 4OLZH 4XPBL 4S1SH 2X89A 1MFAH 1JNHB 5GZND 3GHEL 3FO0L 4HS6A 4O5LH 5FB8A 3X17A 3OAZK 1A9EA 3TFKC 3VD3A 3AXLB 2R0ZH 1S9YB 2Z4QA 2IAMD 3WS6C 3S5LA 4KPHL 5I18L 1NLBH 5L8KB 2D4FA 5IBUB 3WFBL 2NNAB 4Z7VB 1U8IA 1U0QA 3WIFB 3VXOB 4V2BA 3FN3A 3TIEA 4HAFA 1EEZB 2EO1A 5EIVA 4O2CA 2A83B 3PE9A 3TZVD 1G7HB 4UV4L 3T0EE 3ZE1E 4X80L 1S9VB 3K46A 2NW3A 3L6FB 4U6YB 1NCWL 3U0WL 4PV8B 3VXSD 4PJGF 4QKXB 5EORH 1J05A 4ZOCA 1G6RA 4N9GA 2H8PB 4X7TB 3VWJD 3K7UA 5TDPB 1CU4L 1PG7L 3V6OE 4CVZB 1ULVA 2VLLA 3EYVB 4M1CC 3BDYH 4XVSL 5LAXA 2ZKHH 4YX2H 2FWOA 4HWBH 5JORB 3KYMA 2GJZB 3KPNA 2OR9H 3UTSE 3TBVB 4NRYB 1ZANL 4MJ2A 1JN6B 4J6RL 5AZEH 1FIGL 3SDXF 3GSVA 4L3EB 4UU9A 3HRZB 3IKKA 2RHEA 3D3VB 4JR9H 2PTTA 5INCB 4L8DB 1ZLWH 3KHQA 3S35H 3WL9B 5F8QC 4JM4L 1RD6A 2KPNA 1AD0A 2R9HD 1NMBL 1ZKAA 2FHBA 4RAHA 4I3GA 4XB8A 5B39A 1FFRA 1WZLA 4FHBD 4MD0B 3UJTL 1HE7A 4MD5B 2GITB 5HHQA 3GSNH 3QULA 2YXMA 1WWAX 4C56E 4RMWA 4PLJD 3FT2A 5CKGA 3MOBL 3SDCD 4JN2B 4NKDA 2D9CA 2LU4A 4O4YL 3GHEH 1ACYL 1BFOA 4TVPL 5L2KD 3TBYA 3S34L 3V6BR 2A77H 1AKJD 3E8UL 4X9HA 4BFBD 2VABB 4UILL 5I16A 1BECA 4GRLC 4M5YL 4FTVA 2GT9A 4KPHH 5I18H 1TVHA 2N7BA 1MPAH 2UY7A 3DV6A 4K3HA 2N1KA 1ZT4B 2VDPL 3L9RA 3BEWB 4Z7UE 5EPMA 4LMQE 2EIZA 2R4SH 5C3TA 1JBJA 1SBBA 4LSUH 5C08A 1HSAB 3CLFH 4JRXE 2A74A 4I0PC 4WEMB 5MENA 1LNUA 3FZUC 4X80H 1WBYB 4WWKD 2IAND 4JRYB 2CO6B 4J7RA 3SQBA 1YEKL 4P49A 3SDAA 4PUBL 4PJAF 1UQSB 5CD5D 3GHBL 1OPGL 1EUUA 5SX5K 1CU4H 4QTIH 2NR6C 1KPUA 5IKCB 4YR6B 5I17A 1LD9B 3TPUA 3QEQD 4IRZH 1CFSA 1N2RB 4H25A 2YBRB 1ZANH 5BXFA 1NFDE 2A0LC 1CFTB 4J6RH 3GIZL 1FIGH 3MLZL 5EWIH 3A6CH 2OR7A 4XCYA 3VXPB 5CZVL 4WU7A 4YBLB 5B38B 2F58H 4DCQA 3K81A 3QA3A 3NFPA 4GBXB 4PRID 4U31A 4JM4H 3DI3B 1DBKL 5EOQL 4NUGH 1N64L 3GNML 1DBBL 1WT5C 3UJTH 4APQD 4LK4A 3VWKC 5HGAB 1OP3K 3CFBA 3CFKB 3TH4T 4N90D 1HXYA 3T0EA 4UTAL 1PX4A 3AM8C 3QG7L 5IVOA 1S7QA 3VFNB 3LKSA 3O6FD 5T3XE 1JF1A 3QDGE 1XF5A 1ACYH 4O02L 4XXDB 4EN3C 3EDFA 4I9WD 3E8UH 4U0QB 3O11A 1QRKA 3QZWB 2AV7B 3VFUA 1RZGA 3B43A 5FYJL 3RTQA 5JNYA 4YGVB 1EEYB 2XPGA 4UILH 3V6OA 5I73B 3E0GA 1KGCD 3HLAA 3QO0B 1G0DA 1AD9A 1ETZB 4LDLB 2Q6WA 1ROWA 2VDPH 5FDWB 4UNVA 4R0LC 3UTSA 2AK4B 2YUVA 3DBXA 2R1WA 3IJYB 4MDJA 3RVVD 5E8DL 3FMGL 4BM7A 3T04D 3TCLA 3MCKA 2DQUL 3BH8B 2DL2A 4RX4D 2YRZA 3CVIL 3E2HC 4BQ6A 2AERT 4OD2B 1CLYL 4MGXA 3GSQA 2ITCA 3WXVL 5ESAA 2CXKA 5E6YA 4C56A 2VXTL 1CIUA 4GRWH 1HILA 1MCCA 2Y25A 5FM5O 3AY4A 1I7UA 5DUBA 3LN4B 3C60D 1A64A 3BN3B 1LEGB 1L7IL 3S88L 1ZHNA 5DGRA 1NBYB 5J8OA 1RUMH 3MLZH 1MCEA 5BZDA 3AS0A 4Y7MA 2FCBA 1K4DB 3ULSA 1IMHC 4D8PA 2XWBB 4Z7UA 2Z8VC 2YHGA 3VGAB 1U8KB 1CXHA 5EOQH 1N64H 3GNMH 2EH8L 2EE6A 1NBZA 1KIQA 3RL1B 4JRXA 4BSWB 1HYSC 2YMXL 2WV3A 2YPVL 5TF0A 2DD8H 3VFOA 5HYJE 3QG7H 4XAKE 5FA3B 4D9RD 5JDSB 5DJCA 4OSUL 2B5IB 1N5AB 4UQ3A 3BUTA 2PW1B 4FFVD 5ISZE 1S9WB 3H9YA 2QR0B 3WE6B 3PUCA 3QO1A 4L29A 8FABA 3U4AA 4W68A 4YK4B 2BMKA 3B9KD 3PDGA 4YEFA 4HSQA 3EOTL 3P0YH 4HIHA 2KZWA 4JLRB 1BP3B 1A0QH 2OL3B 1ONQA 1U8LA 4FS0A 2BHYA 1NFDA 3C5ZC 1I3GL 5E8DH 3RVTD 4K7PX 1C16A 2HVKB 3FMGH 1F4HA 3AREA 3PL6A 4PRHE 2DQUH 5INDB 1HIML 4IOIB 2VDLL 3CVIH 2NXZC 5JHLL 1NDMA 1JHKL 1MCFA 1CFVL 4DZ8B 1T0PB 3X11B 4OIAA 1B2WH 4Z78A 3WXVH 4CGTA 3GMMA 1JGLH 3R4DA 4QRTB 1A3QA 4Y5YB 2VXTH 4BZ2L 3V9FA 2VLRB 5DJ8A 3S7GA 3FQWA 4JKPL 2WIIA 1KXVC 4MZ3A 2BSRB 4XNMA 3QDGA 4LRNL 3LDBC 5KSBF 4Z7VE 1ADQL 5H2BA 1U8JB 2GK2A 2OJZH 5FYJU 1NAMB 2DJ4A 5I1CL 4FNLL 2CRYA 4KTEL 2BSSB 2R0LL 1IBGL 4OGAC 4MZ2A 4TSAH 1XF2A 2ILLA 4PJ7B 4WY7L 3CFCL 3HC4L 3S4SA 2ZCLL 4YDVB 3IS1X 5C09E 3WEXA 4Z9KB 1U8MA 3QEHA 2Q76B 5KSAC 2P4AB 4HJGB 2VQ1B 3VCLA 4CJ0A 1GZPB 1UYWL 4HUWB 1YEDA 4F7TA 1JWSA 1FZKA 2YMXH 4PJ8A 5B3NA 1CI5A 3LZFL 4J3TA 1S5HA 3TVMD 2YPVH 2FB4L 2GFBB 4OSUH 3FT3B 1A6TA 4F2MA 3MUY1 5F7KC 1ZAGA 3JTSA 1F4YL 4TQEL 2FO4A 5DRWB 4RIRA 5FYLE 4W6YB 4H0GA 3F5WA 3T65B 1FPTL 4LSQL 3EOTH 5A43C 2WM0A 5I76B 2R23A 2H26B 4S1RL 1SEBB 1RUKH 2EIBA 5SWSD 1U3HB 1JTTA 5DFWH 4UV7L 4EKXA 4EBQH 2LFGA 4AM0A 2BY2A 4ZOBA 2NZ9C 4IHOB 1MCNA 1KPRA 3OXRB 4RAUB 4K3EL 4JM2C 2AEQH 3HZKB 4O2FB 2Z91B 2E27L 2O5ZH 2VDLH 3WIHA 4BKLA 5JHLH 4J1UA 2ESVD 5C0CE 3CVHB 1JHKH 1CFVH 2APBA 1IQDB 2CSPA 2VXQL 4QHMB 4QT5B 3ILQC 4C54A 4DKFH 4PG9A 4P2RE 2IFGA 3QEUA 3VFGH 4F9PC 5HYJA 3ARFD 1EFXD 4YFLF 3JWOH 1M1SA 5ISZA 1IAKA 3TA3B 4LRNH 4GLRI 2OR8A 4NQVA 1ADQH 4R7NB 3BD5A 3OG6B 4KJYA 4BSVB 3ARRA 2Y36L 2IFFL 1YN7A 5I1CH 4FNLH 4KTEH 1IBGH 2YUZA 1ZSDB 3K3QA 3SDYL 3CU7A 1S3KL 3G5ZB 2VITA 2ZCLH 4LLMB 2UY6A 4LARH 3FB6B 4YE4L 1UYWH 4UB0L 4WI5A 1IEHA 1F4XH 4KK5D 1EIBA 4OF0A 4P23D 2MQCA 4PRHA 3LKOA 5I1HL 5SV3A 4ONFL 5L0QB 5FF6B 4CVXA 3ULUH 4XVTL 1FNSH 4P5TB 3VFVA 1IGCL 4XP5L 5EOCH 3L3OA 4Y2DC 5DQDL 2ZCHH 4XBPA 1A7RH 1WBZB 4S1QL 2W1NA 3MV11 3O8XA 1FPTH 4LSQH 3P4MB 3G6JB 1WFOA 3NTCH 3IGAB 3HZYA 4KVCL 3UP1A 4Z7VA 1BLNB 2BXYA 1PKOA 1E4JA 1XGQB 4JZNA 1TMCB 4UV7H 3L5WB 1W0WB 4ZD3H 3BPOC 4KV5E 3B9EA 1CGVA 1U58B 5IFJA 3CIQA 4G9FB 3T4AA 2GJ6D 4OGZA 3ZSSA 1S9VA 5C09A 2E27H 2FECI 4N5ED 5IW1A 3L5XH 2NY3B 4KQ4H 2PYFB 4M9OA 4LCUB 1VHPA 1UXWB 1M05B 4CVWA 2H8PA 4JGMA 1EBPA 1QSZA 4JPKH 4NQCB 3T0WA 5F7EL 1RURL 4G43B 2GTWA 4HS8H 1IZKA 5J56B 3BZDA 3EYVA 1HZHL 3ILPB 1J0JA 1XF1A 2LTQB 3RL2B 3IETB 1BD2E 1TCMA 4ZTOL 2OM5A 4NRYA 3FQTB 2NTSP