1E4XH

Crossreactive binding of a circularized peptide to an anti-tgfalpha antibody fab-fragment
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
216
structure length
216
Chain Sequence
b'QVQLQQPGAELVKPGASVKLSCKASGFTFTNYWMHWVKQRPGQGLEWIGEILPSNGRTNYNEKFKTKATLTVDKSSNTAYMQLSSLTSEDSAVYYCARSPSDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TAB2
molecule tags Immune system
publication title Cross-Reactive Binding of Cyclic Peptides to an Anti-Tgf Alpha Antibody Fab Fragment: An X-Ray Structural and Thermodynamic Analysis
pubmed doi rcsb
total genus 42
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2000-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1e4xH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1e4xH02
1HHKB 5EOTA 2D7QA 4TUOB 3BKJH 2I5YL 2IF7A 4TVPL 3LD8B 2CUMA 3F7VB 4H1LG 4P49A 2P5EB 3WNKA 3MTRA 4BJLA 4OIIL 5EO0B 2MWCA 4ZSOB 1Z3GH 1U8HA 4IJ3C 1MVUA 1RUAL 2AK1L 4YHNA 4PY7A 1FSKB 1Z5LB 4G8IB 5GGTH 5DSCA 5IT2L 3F8UB 2C5DC 4HH9A 3PUCA 1H3VA 5TDOB 1IEHA 5HYJB 1IGFL 4DGIH 3BMVA 5FYJH 4CAGA 3IDMB 4F57H 2BNRA 4JRXA 4HWUA 2H2SC 1BD2A 1M7DB 3IJYB 4K07A 4YQXL 3IDIB 2ZCKL 3WIHH 5IFHL 2DIJA 4LVNC 5D70L 3HNTH 1NCDH 3VGAC 2L7UA 3MNZB 1J8HE 2DQTH 2FATH 4I3SH 4NZRL 5F9JB 4XAWL 4LARH 2R2EB 3ZMRA 2ZCLL 3ZDZF 3REVA 2LU7A 5ESAB 3VH8B 2BSTA 4E42B 3ESVF 5BQ7A 1FL3B 5CP3H 3C5ZD 4JY4A 3VXRB 4KRNA 2GW5A 4IMLB 3DMMC 4QRQA 4UV7L 4AENA 3NAAL 1QSFE 2P49B 3KR3L 4YZFF 5L7XL 1WWAX 5C0FB 4J8RB 1AC6A 4M48H 5E95B 4KK6D 1GIGL 4AEEA 4JFQA 3RWIA 4RISL 4OLZL 4Z7UE 4ALAH 5ILTH 1BX2A 1EERB 1IQDB 1YEKL 5HHNA 3FFCA 2ARWA 2WQ8A 3PNWB 4LCCB 1KJVB 4X8XA 4UQ3B 1KJ3H 2GI7A 1WQVT 8FABB 1ZT7B 1X5HA 3C6LB 5F1OB 5ADPL 4HBCL 15C8H 3RPIA 5DVOA 2DQCH 4QXTB 4Z7WE 3AXLB 3VXRA 3EFFB 2VABB 3O6LH 1MCJA 3E2HC 2ICEB 4PJFA 2FJGB 2H9GB 4U6XA 1CQKA 5HI5D 1RUPH 1ZXQA 4LSRH 3EOBB 2GIYA 4Z7NE 4MB5A 3DO7A 5JDSA 1J1OH 5GSVB 5C0CB 3BT2L 1HYSD 2WAHA 1E4XI 3VWJC 5L0QB 3PWNB 1X7QA 1K4CB 4N8VB 4M6AA 3U0PA 4D0DB 3BRDA 4IRJD 5CSZB 4QTIL 4RGOH 5D5MA 5E94A 1JPTL 2AJUH 4L29B 1PVHA 12E8L 2A0LD 3I2CH 1KIUA 3OKDB 1P4IH 2AXJA 4Z9KB 4QHMA 1VCAA 3O2WH 5KSAA 2GJ6B 4WUUA 5JNYB 5EUOF 4JANB 2KH2B 2ID5A 4Z5RB 3RGVC 4NQTA 1KG0B 1DQDL 2PN5A 5LGKA 5BCAA 5DJAA 2EE2A 5EPMB 5A16A 1JGDA 5MEOA 1WIOA 1DQLL 4NBZB 3P0GB 3ZYIA 2D0HA 1KGCE 1XR8A 2YPVH 1RK1B 4NQEE 4F7CA 5JW5B 2B4CL 3DUUA 4ZSOE 1PG7L 1SJVA 5K9QG 3UYRL 1PZ5A 5DFTA 3HHRB 1UJTA 5F9WC 5DFVC 1N6UA 3IFPB 3Q6FA 3VFTA 4F3FB 1FNHA 1S7XB 1LILA 3O6FD 5J1AB 3TZVA 3GB7B 4FNLL 4EI5D 1R0AH 3S97C 1UM5H 5CJOH 5L9DH 4QHUA 3CC5A 5F7UA 4YXKH 4P23A 3CFIC 3BKJL 4CVZA 4DVRH 1TPXC 5C86A 1E4KA 4R4FH 1GZQB 1V7NL 1KCRL 3FB7A 5ANMB 1GPOH 1OAYL 2NTFB 1S7QA 4XC1H 5EBGA 3VD4A 1A6VH 5T33H 4XPGL 3NTCH 1J1XH 3OV6A 5HYJE 3Q5YA 2X7LA 4I0CC 1HSAA 1K8DA 3ESUF 4HK0B 2LABA 4OCNC 5CEZE 2Z91A 4ZOBA 4ZQKB 3BPCB 1JTOA 1A7PL 3H42H 3ZT7A 1HQRA 3EYSH 4WFED 3UTPD 3QCTL 4LNRB 3I3EA 3BKYL 5D1QB 5CGMA 1OTUC 3UPRA 4O2FB 3V6OA 4ERSH 3MODL 5FGCE 2KUTA 2JB5H 3O2VH 2Z31D 1RZIA 1MF2H 2FJHA 5INDA 4RAHA 3FN0H 5GZND 3QUXC 4P5KA 5CGYD 1AGBA 4OFKA 3MUJA 3VFWA 3SDDB 3HI5H 3V0WH 5F7FA 3KHOA 3QFDB 4HKXB 1M7IA 1A6AB 4UDUA 4LSDA 3DIFB 3WDJA 3KYOA 4ZQKA 4XP1L 3BVNB 4WI6A 4IBLT 4QHUB 1GGCL 3OKMB 2R2CA 4GRWB 2RBLA 2R23A 4GBXC 1ZLVK 1S7QB 4UUJB 1P7HL 6FABL 1IAII 3G5YA 3PJSB 4GAJL 2X4OB 4HBCH 5E4IA 3ZDZE 2KDGA 2DQCL 1CT8A 2HFGH 2PCPB 1P69B 2QHRL 5HYJD 1H3PH 1T04A 1J8HB 1BF2A 4S2SA 1UCTA 4JFOB 4Y5YB 3L1OL 1EEUA 5HYSG 1RIUL 1IGIH 2IMNA 4OTXL 1BF8A 3O4LE 3SDCD 1A7RH 1NMCB 5EA0H 4ELMB 4RRPG 2YD9A 4G42B 4A6YB 1ZVSA 5E5MB 4F7PB 1ITCA 3RVWC 2NNAB 4PJ7E 4MA7H 5F88B 4GAFB 3TPUB 4Y89A 2YPLB 4LLUB 4PRDA 3U0TA 1O7VA 1JWUA 5LBSL 1NGQH 3GJEB 4NPYA 3OKDA 2JJTC 1F4HA 2VLKE 5ADOL 2GUOA 2ARJA 3WIFB 3X12B 5TQ0H 5E9DA 4Q2ZB 4JFXA 5A2KH 2LE9A 1BM3H 3VRLF 5FYKH 2QR0A 4UILL 5FYJL 4F57L 1X7QB 4MQTB 3EYUL 2WUCL 5FEBA 1ACYH 1JWSA 3MRKA 5KS9B 2R29L 1ZE3C 4F15B 3RU8H 2VZVA 3CFCH 3IDJA 2ENYA 5EC2A 4E5XB 1A7NL 3HNTL 2DQFA 4NNXB 3T4YB 3KPPA 4D8PB 4YNYA 3CH1B 1W0YT 2YOCA 2XXCB 4Y19A 3ULUC 4LGSB 1MHPH 4CGTA 1CFSB 4X98B 1IGFH 2PR4H 1SMOA 4JZJC 3W9DB 4DGIL 3N1MC 2YD3A 2HFFA 2JJWA 2NZ9D 2AQ3A 3QWRD 1RURL 5D7JD 1NC4D 4DVBB 1ZA3B 3LCYA 4U1GB 5EN2B 3N1QC 4MNQB 3HC4H 2Q6WB 1MHHB 1PEZA 4JLRB 5HJ3A 1LVEA 2AJ3B 2BOCB 3U48A 4YHZL 1XCQA 3PABB 5KSBA 3KYNB 2Y06H 4IRJC 1UB5B 3ZTNL 1L9MA 2J8OA 1ZSDA 3RY6A 5GS0H 4HIJB 1D6EB 2OTWA 5HDQL 5EOCL 4WU5B 3I85A 5GZOC 4NO0D 4UBDD 4JY4B 5A43C 3K81A 4PRHA 3P77A 3GNMH 4GMSH 5DJ8B 4MA3B 1EUTA 4U1NB 3MJ9A 2ZCHH 1FG2A 4PLOB 4PGEA 1VKXA 5SX4I 4LCUB 3E8UH 3WN5B 4BUGA 1YPZE 4NSKA 5B8CC 4NQVA 2JIXD 4YC2B 1WCQA 3QEHA 2CO6B 4OZFA 1RJLB 4MJID 2DWDB 4DQOH 3MRCB 3MNVA 5IGXH 5ADPH 1NC4B 2C3WA 3M45A 3BPCA 3QEGH 5K9KB 4IMKA 2AJUL 4GRLC 1IL1B 12E8H 1SYVA 3U79A 2QQQA 4YXLH 1XGPA 1MPAL 3O2WL 1EHLH 1TPXB 3ROLA 4HF5H 3K2UL 4TPRL 3DV6B 1GGYA 3K7UA 1VPOH 2CDGA 2BMKA 2L4OA 3B2VH 3RAJL 2PXYC 4HWZB 1L0QA 2RQ8A 1DEDA 2XFXB 3U4AA 1YY9D 1QUNA 3IDYC 3B6SB 3BAEH 4K9EC 4JLRA 4NGHL 3R06B 5J8OA 1F11A 1H5BC 2X6MA 4LRIA 1HH6B 2NY0C 3CDFA 4X7DC 4X6DA 2BNQD 5I1JH 1KNOB 1U92A 2HLFC 3R0NA 4L9LA 1P4IL 1I9IH 1S9KC 2CJUL 3BWAB 3O3UN 2X4UA 4OV5B 5D2LE 25C8H 4J3SA 4L4VA 1QSFD 1WJ3A 5H37H 4BFGA 1FP5A 2H2PD 3AMKA 3CLFH 1RZ7L 1GGIL 4MD5A 4Z77A 4OD3H 5F1KC 1QNZL 5MI0C 5D6DA 2FECI 1CDBA 2H8PB 2G2RA 3O9WD 2X4OA 1MHEB 2ZPKL 2IEPA 2AKRB 2ESVE 1I1YA 5L8KB 2G60H 3GKZA 2P44B 1W72B 5TF0A 1KPUB 4HD9A 3FB6A 4WWKB 4LSVH 5F9OL 1ACZA 5C8JA 5IV2A 1F11B 2N7AA 3KPSD 1MVUB 3EOTH 4RFNC 4N0FB 1MFAL 1L7IH 1SYVB 2VH5L 3WUWB 3IDNB 4U1IB 2P5ED 4ZFZA 3ARBA 2JLLA 1CICC 1IAIH 1PKQB 2XACC 4ZFOL 4H8WL 1I4FA 3LEVL 4M1CC 1XR9B 2GTZB 3GJEA 4NPYB 3SGDH 4RA3A 3UJIL 2OL3A 1YN7B 1N4XL 1KJ2B 4XH2A 2GITA 5AG9A 3QHZL 4DOHB 1BZQK 3ZT5A 1E6JL 1UKSA 4X6DB 3QEQA 2ATKA 2O5YL 5IMMA 3S37H 4MAYA 5F1NA 1TLKA 5FUOH 1OCWH 5E4EB 4U6HB 4MWFB 3I02A 4FQXB 1WUNT 3C2SA 4LEOA 2I9LB 4NWUL 4PJHF 4HS8H 3QJHA 1Q9LB 5CZXD 3UCRA 1T89A 4OFDA 5LQBH 8FABA 2EE6A 3BN9D 1MCBA 2GK0B 4M1GH 1MELA 3ZTJH 3QQ9C 2R0KL 2Y07H 1I7TB 4LDEB 1OF2B 1FE8L 5CEXA 3KJ4C 4NCC1 1IQDA 2DJSA 1EXUB 4PRHB 4HPYL 1B90A 3IGAA 2IADA 2C3HA 3DURA 4JZNA 4L3EA 2HFFB 1N59A 4V1DB 3FN0L 1EGJH 1KLGA 5DQJB 4OF5A 4JY5H 3B5GA 2UZIL 2AJ3A 2PYEB 1HXYA 3QUML 4XX1E 4KJYA 4DKEH 1RIUH 1QFOA 4MMZC 3ZKND 4MNHA 1WLHA 3CLEH 3TT1H 4LPVA 2R69L 2AK4D 5J9PB 4XXCA 4Y16A 3O6KL 2XICA 4P2OD 1GOHA 4QKXB 1OT2A 2P42B 4L3CB 4FQXD 3U0WH 3TBVA 1UA6L 1ZVYA 1BAFH 6FABH 4RMVA 2YUXA 3W0WE 5GGQH 1UWEL 1KFAL 5EIIB 1NAML 2P5WE 4PTTB 1N26A 5LGHL 1LO4H 3SGDI 4C56D 4LQ1A 4N8CH 1HK6A 5C9JB 2I25N 1BFVL 4CVXB 5J4MA 5DC4B 3EYOB 5DK2B 3UTTE 5T3XE 3M07A 4ZO8A 3MV11 3OZ9L 3QQ4A 4Q2ZA 3RWHA 4KVNH 1MOEA 4AY0A 4CVZB 3ES6B 1FH5H 1JGUL 3JZ7A 2IQAB 5CSGA 2ZZUT 1UM4L 1HQ4A 3NCEB 4I13B 3WIHA 4M9OA 3HC0B 1W0VA 1U9KA 2XOTA 3UZQA 3LQZB 4XP9L 3FHAA 3F12A 4FQ1L 4EBQL 1CU4H 4O02L 4Z8FH 3OL2A 4KJYB 3VWJB 1UJ3B 4OD2B 5C6WH 4QXUL 5L2KB 3JWOH 4JZJA 3EFFA 4K7PH 5KBNC 4L8SC 1SM3L 1RURH 4MA1C 5ELIA 1NL0L 3HUJB 5TE7H 4I0PB 4WNQA 5B39B 5ACLA 2LFGA 4LP4A 5GGVY 1FYTB 1WGOA 1HEZB 2AAVA 4OLVL 2AVGA 4QRTA 2FJFA 1SHMA 5CEYB 1UEMA 4FTVA 3PWPE 1RIVL 1J10A 4HS3A 1G1CA 5IQ9A 4WU7B 3QXDB 3H3BC 4XHJD 5FB8A 2C3XA 5DR5H 5GZNC 3QUZA 2OTUB 1NCBH 4Z7VF 1OAKL 2JELH 4PJBA 4J2XA 3O2DL 1FNEA 5HPMA 4QOKD 2QSCH 5INDB 1AXSA 3IXAB 1ETZB 2XNAA 5GGSA 3MLTB 5LGJB 1Z9OA 2ZCHL 4GG6E 2XY2A 3TVMC 5KVDH 4H5SA 3FONB 3I02B 2V5SA 1WBYB 2KQNA 4G7VH 3PWNA 2VZ3A 5DZLA 2EDDA 5IMMB 1D6VH 1AGBB 4H25B 5B8CA 5EOCH 5B22A 2Y72A 1MJUL 2BNRD 3MA9H 4BQCA 3JWDL 3MLZH 3G5ZB 1JYXA 2VXTL 3UTSA 2UUDK 2VE6A 2IQ9H 2HFGL 3RWFA 1YN7A 3SE8L 1ADQH 2EC8A 3V6FB 5DDHB 4PJDB 2ZSWA 2K7QA 4PJ9A 1CD0A 3L1OH 1YN6A 3I75B 4G43B 4QOKB 3QUZB 4ZS7H 2NY3B 5DEZA 4MS8D 1FCGA 1KLGB 1EHLL 2A83B 5CJQH 4AL8H 5F7LB 2VDQL 4N0CD 4ENED 1QFPA 3K1DA 1PFCA 3O9WA 4WDIA 4WW1A 2KL6A 1VFMA 3MJ8B 2DM3A 3DSNA 3DUHA 1NMAH 2IBZX 3DI2B 5I16A 2PXYA 3OR7B 4X0KB 4MZ2A 1I7TA 3CD4A 5JXEC 2RJMA 5DJXA 2FEEI 1F3JA 2M1KA 1VEMA 2XI9A 5D71L 1U3HD 3D3VD 1EO5A 2YUVA 1PZ5B 2KPNA 3OX8A 5I1AA 3NFNB 3T08A 3K0WA 1NMBL 3OAYH 3HZVA 3BEWA 3EDEA 4K3JH 4NJAL 3FOLB 5DK3A 3ARGB 4D2NA 1HYSC 3FQNA 2OYPA 1D5MB 4GAYA 2P1YA 5E70A 2VXVH 3DUSA 4ZTOL 1KT2B 1NCCL 3BZ4B 2FHFA 1IGYB 2HT2C 2DICA 1U92B 3RTQB 4F3FA 5I30H 4QNPF 5EZOH 4EN3B 2CUIA 5D6DC 1K8DB 4HK0A 4P4KB 1T03L 1I9RH 2CMRH 4WWKA 4I0KA 3I3DA 2VDOH 1X5FA 3QEUB 1JGEA 4M7JL 5EUKB 3THMH 3GSRB 2AEPH 3ZHKA 5LGHH 2QQLH 5MEQA 3DGCR 2G2RB 3P73B 1SBSH 2LTQC 3MOQA 2YRLA 4U7KA 3NCYP 3HE6D 2PW2B 1X6NA 1ZAGA 4LLDA 4XTRD 4M6OL 3VXTB 3IF1A 4LMQI 4V2BA 1P9MC 4JR9H 5D1XB 2NW3A 5CUSH 2JIXA 3CAFA 5HDBE 3LH2L 3MR9B 2BVQB 4UT9L 3DRTB 5I9QC 1DFBH 2OZ4A 3WXWH 1NC2B 1FNGA 2AK4B 4Y5VA 1KN2H 1QFWM 2VABA 4KK9C 3DX9A 4JKKA 4MX7B 3ZDXE 5I1HL 2ENSA 3NCCB 3BEWB 3KPTA 3FN3A 4U1LA 2WNGA 2WANA 4LSTH 3RWHB 3RX8A 3WN5A 3BUYB 1ZK9A 1QG3A 4JRXE 2PO6C 5L6YL 4U1NA 1ES0A 3HZYA 3SO3C 1LWRA 1XIWB 2DMKA 5D70H 3LEXB 3V52H 1EAPA 1OF2A 5JORA 1YEGL 5H37G 4KJPC 1HHJA 2OI9B 2H32B 1JTPA 1LO3H 3SCMD 1NKRA 3ZSTA 1T5XB 1BJMA 3BN9C 1HH9B 1RJLA 1OQXA 3NGBB 5JA8B 3UTTD 1G7IB 1XGPB 4XVJH 5DGRA 3NAAH 2BSTB 2E9BA 5FGCB 2OJEA 4LRNH 4X6BB 3G5ZA 4HF5L 4TPRH 2APXA 4M48L 1IMHC 4W6XB 5FYLH 4H0HB 1TTGA 5BS0B 3TO4A 4U2YA 1REIA 4G7VL 1JPFB 4NNPL 1ZHKB 3RI5K 5D2LA 4JDZB 3KNBA 4H5SB 3BAEL 1DBBL 1HOCA 1TXKA 4YGAB 5FCSH 5HGHB 1EGJL 5GGSY 3W0WB 4MCZB 1LK2A 1ZT7A 4LVHC 4XP5L 5HHXH 5E9DD 1IC7H 3C87A 3MMEB 1D9KB 4J3VA 2M26A 4LPYA 4XCFH 1YMMA 4PJ7B 3S4SG 1GGIH 1CFTB 5I71C 3FN9A 2EH8H 1QOKA 5D5ME 4FFYH 1XF2B 3NFPB 1INDL 4K7PX 5E9DB 2RAMA 3MSPA 4Z0BH 4GRLD 3WMSA 3HLAB 4MQ7A 1KCSH 2CR6A 4X6FA 3LSOA 5ALBL 4XPHL 2BOCA 4EUPB 1S7UB 3DGGA 2NZ9C 4K3EH 4JHWL 1T0MA 4Q6YA 5DS8B 5HI3D 3SJVA 1CF8L 1C1EH 5T1LB 4Q6IA 4M5YL 4GRMB 4N8CL 1Z9LA 1MIML 4PTUA 5D1ZC 2DBLH 2JK5B 2VTFA 2BNRE 1TIUA 5GGRA 1G7PB 4GW5B 1BQHA 3UDWC 2D7PA 3S3SA 3ARGA 3GSVB 4XAKD 5C08B 2DTSA 1MEXH 4WHYG 1RQ5A 3P0YL 5CFHA 1OAUH 3HLAA 4NKMA 4R2GD 2BK8A 1AXIB 4L1HA 1F58L 3CX5J 4O51A 3VXPB 1F90H 2PO6B 32C2A 4TSBH 3NA9L 1YNLL 2ZCLH 5AAMA 2X40A 4EDXB 4HKZB 2FLBT 5FHBH 2H26B 4ZUSA 5GRVK 4XB8A 3EFDH 3NIDE 1YA5A 5F3HA 1MHCB 3H7BA 2QSCL 1Q94A 2KBGA 4Y4HD 3AY4C 4PJFF 4ELMA 3OSKA 4HXAL 2V5TA 4K94H 4YQXH 3H0TA 4XCYA 4ESKA 2A74A 4DKFL 4QRSA 1JYVA 3DYOA 3D3VE 2RIKA 3GMOA 4PRDB 3WD5L 5EBWA 3MJ9H 1U3ZA 3L7FA 3ZE2F 5FGBC 3T0BA 2AEIT 1JF1B 1FNAA 3G6AB 5F1SA 1BFOA 1PLGH 4XWGL 3ARRA 1YJDL 3MNWB 1A6VL 4HUWB 3CGTA 4RZCA 3GMPB 4PB0H 1JF6A 2YMXL 3V8CA 4JY5L 4M8QA 1D5ZB 3IAPA 4NYLA 1WISA 1ND0A 3W5MA 1FN4A 4HBQA 3LPWA 5F7DA 4XBPA 5KS9F 1AR1D 1YYLH 3BKML 4X7TB 1KLUA 1I8IB 1UGNA 1UXWB 3D5OF 3JWOC 4DK6A 4ZPVA 1P6AB 1CD9B 1JRHI 3N1GC 4CMMA 1YY8A 3OAUH 4NOFA 2HLAB 1B88A 3P9WB 2B8OT 1UA6H 5GRWA 3UTSB 3DX6A 3GHBH 4X8JB 4XPAH 5ICYB 2J4WL 5D7LD 5JTWA 5DMGD 4X83A 1KFAH 1S9XA 2J8UF 2F74A 3GDBA 1B0RB 3OKLB 3BQUA 1EBPA 4EOWH 4NN6B 2HJLB 1NLDL 3WFBL 4UI2A 4MS8C 2XG5A 5ISZB 2CRIA 2BVPB 3TA3D 3TWCL 2IANA 3ARFA 5E8EB 1BOYA 5IVXE 2XRAL 2NXYC 3PDOA 4KROB 3F12B 4B7IA 1DBKL 3WIIL 1R3JB 2CRZA 5A2JH 2X9YA 2W9DL 5BZDB 2E27L 1DBBH 1AR1C 2G9HB 3PWPD 4Q58C 3GSWB 1A6ZA 4OZHF 5MHSD 2Y5TB 2NX5D 4BQBA 3PV6A 3QUZD 2EO9A 3LKQB 4XP5H 5GGVH 5IM7A 2EDNA 3X13A 2BY1A 5MEQB 4PY8I 1S9YB 1NUFA 1XGRA 4IRJA 3LIZH 4HZLA 5C8JB 4HWEH 2BNUB 4NZJA 1VERA 1UM5L 3DMMB 4OD2A 3BZDA 2X41A 3MV7D 1JPSH 2ZG2A 3AB0B 1U93A 1CBVH 1ZVHA 4PJHA 2EDRA 4LQFH 3I9GL 1DBJL 4W6YB 1T3FA 1XEDA 2QBWA 3I6KB 5LBSH 3V9FA 1HEZA 2FGWL 4TRPL 3MCG1 1OW0A 3FAWA 4RGND 1DTUA 1NBZB 2LV4A 3I50L 3LMJL 3E6HA 5D6CB 4JREC 4KRPD 3BH8A 3QULB 4FP8L 1SBSL 1BBJB 4XNXH 4YBLB 1RHFA 1TTUA 3SDAA 3TVMD 3C8HA 3NPSB 4LSTL 1C16B 4C59B 4FG6D 4F7CB 4YEFA 5JW5A 1CICB 4JO1L 4OZFH 2ERJB 5C08E 1T22A 4WVRA 4YHLH 5GSRB 1T5WB 3BD3A 1NFDF 2E9JA 2A9ML 1KN4L 3QDJB 3ZE0E 4M7KH 4WV1C 4NN5B 3RWEA 4ZAKA 3P4LA 5BOZG 3TBSA 4WCYH 1MJUH 1N59B 5CD3B 3WNMA 1S3KH 4HUVA 2NX5E 4ZUVB 3WJJC 5T1KA 2GSIB 3O0RL 5DJCA 4O58L 4RBPK 2YXMA 4PJ9B 1EMTH 5FKPB 4ZDHB 5J11B 1IL1A 3U7WL 3G6JA 3NABL 3PWUB 3TCXA 4HXAH 4NQXB 3VMNA 3IFNL 5A2IH 5C6PB 4LRNL 2A1WH 1NEZG 3L5XL 4U6XB 1SVCP 4X9FA 1MY5A 2XG4A 4GG8A 1YEGH 2VERN 4P2QD 1CVSC 1Z0MA 1EIBA 1K4CA 1U8JA 1DN2A 4KROC 1A7QH 1OLZA 3T8XB 1WBYA 3SKJH 2AV1B 3GMPA 5BRZA 43CAA 5EZJA 1Q0XL 2CGRH 4RQQA 4XBEH 4PJGF 1LEGA 1IAOA 4DZBB 5EULV 1S9WB 2CKBB 3FO0H 3BZEA 4GMSL 3Q6GL 2CLVA 1H3PL 1XZ0B 3V0AC 3WUWG 1IEAA 4JHBA 4N1EA 1AR2A 4Z7QE 2EDTA 3CNKA 3T0EE 5HVHB 1BOGA 1VEPA 3WLWC 4K71C 2EDBA 4OF6A 1N7ML 5IVXF 2O93L 5ACZB 1RU9L 1D5BB 3ETBF 5IK3A 4EZMA 2EDFA 4YHIB 3OB8A 4HV8B 4PJHE 5CIPA 1BZ7B 1I8KB 3RDTC 1KPUA 4JZJB 2C7UB 2UWEA 4XCCH 3RJDA 3U2SB 4FQXC 2BVYA 5ADOH 2IAND 5DRNB 3Q6FB 3ZL4L 1WZLA 1MCFA 5D72H 3O6FB 4WW2F 4Y4HB 1AFVH 3MXVL 4MWFA 4DAGL 4K23L 4OCRH 4U4BA 1RMFL 5A16B 4QRUB 4Z0BL 5JQHC 2WWKO 4PD4J 3LZFH 4MXWH 3ZHLA 3MYZA 3TM6A 3ARBD 5ITFB 4XPHH 4U6YB 2GITB 2FEEL 3CU7A 3OHXB 4BQ9A 2AEWA 1SY6L 2QR0B 3IDIA 3V7AE 3B4NA 3KPSA 5EU7E 3H9SE 1QEWA 5IBTL 2W9LA 4LHUG 4P99A 3EZ8A 3EJZD 4RMRA 3HE7A 4KZDH 1S5IH 2R1XA 3HUJE 4IJ3B 3LV3A 5DO2C 1GZQA 4EDWL 3FB8B 3V4UH 1CDIA 1T0NA 3QR2A 4ODXB 1T6WA 2OP4H 5JPNB 4ZUUB 4L3CA 1I75A 4KI5E 4DEPC 4ACPA 2DLGA 2MHAA 3MOAH 1QSFA 2UY7A 2C9AA 3IYLW 2Q7YB 1I7ZB 3M17A 5HHOE 3LS5L 4GRWE 1FDLL 2C7UA 3W39B 1BPVA 1U58B 2E7LC 4QCIB 3MACL 3SBWC 5CCKH 1CGSH 5HHPB 4JO4L 1HXYB 4UNVA 3KNBB 1T1XB 3VGHA 1F4XL 4MQXC 3TBYA 4Y4HA 4WEBL 2HFTA 5TE6H 5T3ZE 2VITA 5DVKA 4GKZA 1YMHB 3CVIL 3GBNL 4YR6A 1IM3B 5EIQA 1HCVA 1KNOA 3C6LD 4S1QL 1XF4B 4N9GB 3OKMA 4YEEA 1YMMB 1U36A 1KN4H 4UQ2B 4NFBA 3ULVE 1TZGH 4XWOD 4BKLA 2AJYL 1MFNA 4C56E 4PV8A 3D25B 4U2ZA 3H3KA 1GZPB 3CXHK 4MCZA 5ESVB 4DCQA 3QNZA 4R0LB 5E94B 4AMKH 3MROA 1A6UH 4O58H 3U46A 4WFFE 3B3IA 2ADGA 4NRZB 4CUCA 4N8VA 1VEOA 3TNMA 3NZ8A 4MNQA 3QWQB 2HP4A 3P3YA 3KJ6L 2CXKA 4F9PA 2FEDC 2EDEA 1KYOK 5AUMA 4OCMC 1CFNB 1UG9A 2DKUA 4DZBA 3L5XH 4OBSA 1P53A 3PWUA 1OAXL 4W4OA 4RQQB 4JM2A 4MA3A 1LMKA 1DLHA 2EEDA 1KJ2A 4YHKH 5FYKD 1DBAH 4JN2B 2E7MA 5SWZB 4JFZH 1F2QA 1M7DA 4XPAL 4QTHA 1U95B 4OFYA 4BSWB 3P9MB 3V0VB 5DUML 2NLJB 4X7EC 3IDMA 1MCQA 5IHUH 3QNZB 1J87A 4FRWA 4DN3L 4YXLL 1ITBB 1SY6A 3IDGA 2XA8L 1IGCH 1A1NA 2PYED 3MA7B 4HIXL 3FJTA 3OKKB 4OCSL 1BX2B 5BW7A 3C09C 2EXWC 4HWEL 3CSYB 3QUZC 2YPLE 5GRUL 1SJHA 2R69H 1XGUB 4LLVB 4PLJD 3SDDC 4D9LL 3CUPA 4EI6B 5IEKA 4N0UB 3H7LA 5HGDA 4NQDE 3CC5B 1CDYA 2XN9B 3VFVB 4JM2D 4MX7A 3BZFB 3U0TB 5I73B 4XCCL 5ESAA 1NGZB 3I50H 2IAMA 3FO1A 3QUKA 5DEGB 1RZFH 2WWMD 4ODUA 1OW0C 1AD0B 5L2KD 3U7AA 4PGDB 2IALB 3NIGE 3HZMB 4NO0B 4LPUA 4R0LC 4ZS6C 1IAIL 3VXSA 4DKAA 4PLKD 2ESVD 2X1WL 4WW2A 4NBXB 3SPVA 3SOBH 3R8QA 4ODVL 2G60L 1KB5B 1N64L 4KMTH 1Z3GL 2VJXA 3SO3B 1AGDA 2WSKA 1SBBA 2ZUYA 1H8SA 4HW6A 1LP9E 4FG6C 4WCYL 1HHHA 5IW6B 5D7IA 2D0GA 2KZWA 1N0LA 5EU7C 2DQIL 3OR7A 4X0KA 3WL9A 4QHMB 4YHNB 5HHVH 3EOYG 4FQ1H 5IKCB 5DD0H 1IC4L 1NJ9B 1OAQH 4H8WH 3CDGA 4BZYA 1A14L 1M7IB 5DURB 4MA8L 3HPJA 5IMOB 3KLHD 1TJHL 5DRWA 1ZGLA 4NO2A 5EU5B 4G8GB 5I1IH 3LKSB 3FQRB 4HLJA 3IVKB 1QSEB 2UUDH 3GJFK 4CW1A 2CDEB 1W72L 3NFNA 4CKVX 4HPYH 1L0YA 4UIKH 1MFBL 1F97A 4L4VE 2ITDA 3LRSB 3GUTA 3EYFA 1OOAA 2R0WH 5DEFA 4Z7UA 5DJXB 4JFFD 1VADB 4G7YL 4LLYB 4ELKA 4RFEA 4IIQB 4TULH 1T89C 3NH7L 3KR3H 5GRXG 1ZHNA 5ESVA 2F74B 3HE7D 5EC1A 5C0EA 2XA3A 3VD5A 4RDQF 4OLWL 1FN4B 4L3EB 3F7YB 5T5NG 4BM7A 1D5XA 2X4TA 2X4QA 4PJ5A 1EZVX 5CJXA 3RWDB 4PG2A 4RWHA 4XBEL 2CLVB 4I77L 4JCLA 3L3OA 3PHOA 5I1EL 3GIZL 2NY1B 1E6OH 2DQJL 5J56B 3QG7H 4OCWH 5DUPL 5F97E 1J8KA 5GGVL 1X5AA 4KI5D 3FQRA 4CVWA 4P23B 3VMOA 1PDKA 2Z4QB 3CFJB 1H8OA 4JHAH 2FX7L 3NACL 3LDBB 5DD5H 3VFGH 5I8EB 5DI8A 3IT8D 4Z76A 1VADA 4WHCA 1N8ZB 4P2RA 4QEGA 2QADB 5KG9B 4OCRL 4HJ0C 4X6DE 4CRPA 3G04B 5SWSA 4Z0XA 2B39A 1MCHA 4JCMA 1AXSB 5AAWA 2YUWA 4CW1B 5E8PB 2XPGB 4WO4C 4KTYA 3L95B 2A0LC 4NO2B 1FGNL 5ID1A 1QBMH 1WICA 3PP4H 4HH8A 3ULVH 4S0SD 2XN9E 1MAMH 4DN3H 2YS4A 4PP1D 3HAEA 2CPCA 3OWEA 2B1HL 2AQ1A 4JQVA 1M05B 2VXSH 2VC2L 5FUZH 5EORH 4P23D 3SGEI 3D0LB 3JV6A 1FFNB 2WBJB 1B3JA 2VDLH 2VLJE 2OP4L 1P84J 4RX4A 1MHEA 1FZMB 4BK4A 2WQRA 2P48B 3MBEA 4O2EA 2RCSH 1GSMA 4JJHA 3U0PB 1A6WL 2CSPA 5IVXB 4ETYA 1NCWL 4LPCA 4JFOA 2EIBA 2AABL 3VFOA 2Z93A 2DMCA 3DX7A 5EU6B 4TOYH 2VDRL 4YDVB 1YNTA 4GAGH 5I1DA 1VACA 2DQEH 5C7XH 4U7MA 4FQCH 3HN3A 3U4BH 3LSOB 2R8SL 3QAZB 1DQML 3SQOL 2GY7B 2J8UA 3OKNB 4PUBH 2AP2A 5DLMH 5GISL 1TZGL 2AJYH 1BVLB 5D5MB 4PV9A 4XC1L 1HOCB 1FLTX 5CILL 2K7PA 2DL2A 4ZAKD 3JWDH 4K94C 4PJ7A 2D4FA 1MCIA 4RFOL 2GSGA 2X2YA 1R3KA 3TVMA 4XWOC 1IAOB 1CK0H 2HJFB 1FPTL 1A14H 2VR9A 5L6YH 1FFOB 3C08L 3CFBA 3GHEH 2UWEF 5E00B 5F3BB 4PRPA 2VIRB 5DFVD 4P5TB 4U0QB 4UOW1 5I1IL 4YBLC 2VLRD 4WJ5B 5DWUL 2ADGB 1GAFL 1U8LA 3GI9L 4HC1H 2A6IA 1W72H 2HFEB 2WBJC 5GXBB 2HH0L 4NOBA 4PRIE 2NY6C 2E6PA 2OXGA 1A6TA 3CVHB 1FV1A 1S7SB 1FL5A 4M03A 1I9EA 2P7TA 3RUGF 2XTLA 5I6XB 3E3QE 3ZE2E 2R4RH 1ORSB 5B4MD 1AXTL 1MJ7H 1YEIH 1LDSA 3RPIB 1AHWA 4ELMF 5HTSA 1GCFA 1UWGH 3QISA 5I17B 4E41A 3QCVH 5JXEA 1U2HA 2FIRT 3RGHA 3ALWA 5JORB 4WJ5A 3DTXA 3HMXL 2FX9H 3FQXB 3QPQC 4OCXL 3FMGL 2YEZB 3DJ9A 1LO2H 4YUEH 5HGBA 2CIKB 1K85A 1XCTB 3RIFF 3RZCB 3THML 3VXUE 3H3PH 3CIQA 43C9A 1FL6A 2ADIB 2NXZD 2QL1A 3UPCA 2WUBL 4JG0L 1G9ML 4HGMA 1H0DA 3T0XA 1KUMA 3KPQB 1RVFL 1C5BH 1RJCA 4KTEH 5GHWL 3LKRA 3RBGA 3AS2A 2CLRB 3IJSB 1YNKL 4M6OH 4KJPD 3IU4H 5D7LA 4MA7L 1L7TL 1OP9A 1X5ZA 1Y6MR 3MOAL 4U1IA 1U8QB 2VDKL 5KN5B 3L5WA 4PJDE 1T7YA 2EEAA 3KPLA 1NGQL 3MRNA 4PJXA 1GGUA 5IHZA 2F15A 5D1QD 4LLDB 5BJTA 5SWSE 4K7FB 2D7OA 2R0LH 3BZ4A 4GSDH 1PQZB 3C5JA 1C12A 4KV5E 4ONFH 1PX3A 1A3LL 2CUHA 4ZUTA 5IF0A 4ORGA 1RUQL 3OF6D 4XRCA 4S1QH 3JUYA 3N85L 1QFWH 4D9RE 1U8HB 3BQUC 4MJ5B 2YD1A 4PBVC 2QSVA 4OI7A 2ZOKB 4IRSC 3FT3B 2BVEA 4IHOB 4WEMB 2D0FA 3BO8A 1UZ6F 1T0MB 2DL9A 1S9VB 5D2LF 4XPFL 4GMTL 3QIWA 3A6OA 1LO5B 3IJHB 4S2SB 1FVCA 5J3HC 3TLRA 2A83A 3KPRB 4QOKE 1TCRA 3MRJB 4RAVB 5FFLA 1ZEAH 4F8QA 1DBML 3DSFL 3L3GA 5C09E 5F7YC 1CR9H 5IUSA 4WV1B 2XZQL 5DLML 1MLBA 4RFNB 1WWCA 2IBGA 3FQTA 4JRYE 4J8RA 4MJ6B 4HIJA 4MD0A 4HT1L 4JDTH 1LE9B 4IIQA 1N6VA 1CGTA 2XTJB 3STLB 2FWOB 4LSPH 5DDHA 2J8HA 3HPLA 4OB5L 3N1PC 4YHPA 3HMWL 3WCYA 1T1YA 3CK0L 4DVBA 3G6AA 4H1LH 3FFDA 5HHQA 5L88L 5ESQA 2X5PA 3MRDA 2BHZA 2B20A 3EOAA 2VXQL 3VU2A 4NWTH 1NKOA 3GI9H 2GSGB 1DN0A 4L8DA 3BXNA 2W9EH 4XNQA 1OPGL 3H0TB 1ZLUK 2GKIA 1XGYH 4JHWH 4L3AA 3AMLA 5MHSE 1A02N 1KEMH 4WUUE 1FZKB 3GO1L 5ICXA 1QHPA 3MRPB 5DD5L 5C1MB 3WJLA 5GSRA 5HPMB 1WAAA 4G8IA 3QFJA 4XP6L 5EORL 1C8PA 3QDGB 2J5LC 1WIUA 1JNJA 4ZG1A 1KB5A 2F8VA 3QDAA 1OTSD 3L3KB 5T1MA 4MJ2A 5EO9B 4KMTL 2E27H 1N6QH 1Z9MA 2FX9L 1KPRB 1A9EB 1EGJA 3HPJB 4QF1A 5GGRB 3SKUD 1WBZA 4KXZH 2VL5A 5FM5O 3DVFA 4F58H 1ZOXA 3QRGL 3VFTB 2IAMD 1MFDH 1TQCB 4ODUB 2WUBH 4JG0H 2Z8RA 2DIBA 1G7JB 3RQ3A 4APQC 2FD6L 1WCBB 1YECH 3VRJA 5C92A 2OXHA 3AM8A 5EU6E 1MEXL 4ZMAT 5IQ7L 1XGRB 1RUAH 4IRJB 2QQNH 1FZKA 1CBVL 3MLRH 2BHUA 3SCMA 1CGXA 1QRNB 4HHAA 5EU4B 3WD5H 4OZGB 5AZEH 2GJJA 2RCSL 1U8IA 1ZA6B 3RWJB 5FYKE 5GS1B 1I3RB 4JFYA 1QPPA 2XWJA 1A6ZB 2BY3A 4O2CA 2EICA 3HI1A 3KPLB 5T5FL 5BZDA 3O81A 5K9OA 2ZCKH 3O3EB 5FF6A 4AM0A 1XGQA 4N0UE 4F7EB 5K59F 5JW3L 4DFIA 1V7MH 4PJAE 1CLOL 1MWAL 3Q3GA 5IG7B 5TDNB 4EN3C 2COQA 1ZHKA 1NFDE 4WY7H 2A9MH 3EO0B 3MRQB 3RGVD 1JTTA 3FOLA 2BZDA 3W2DL 1FO0A 4U1KB 1MCEA 4N0YH 2X4PB 4GO6B 5L8LB 3KDMA 3JV5A 3S36H 2VQTA 4JZOB 1YUHB 3QIUA 5FUOL 2PW1A 1AKJD 1G7IA 5FECA 1AIFA 5ERWA 2DTMH 2N7BA 3C08H 1V3LA 4MD0B 1AXTH 1MJ7L 4ZFOB 3MJ7B 4YDJB 4YPGA 1AHWB 3JVGC 3FT2A 1OM3L 5J7CC 2BDNL 3NOIA 3FQTB 5BMFH 1JNLL 4JFFB 5FGRA 1DQQA 3UTSE 1FZOB 5HYQA 3GHBL 2BVTA 2ZP0T 2NY1D 3U9UB 1QBML 2FEDD 4ZPVB 4UAOC 4GLRI 4J7RA 4G8FB 1TCRB 3ULUF 4XBPB 1UZ6E 4QRRE 4QHLB 4G8GE 3ARFC 2O61B 2O5XL 4PJEF 4G6KH 2IGFL 3L6FB 2D31A 5BQ7B 2EC9U 4G6ML 1EX0A 1FNGB 3HFML 2QV2A 3WO4B 1RVFH 2VLKA 3B9DA 3TT1L 5C6TH 3RZCD 4Y4KA 5JHLL 5J1AA 4JRWA 2W9DH 2YA1A 4PV8B 1YYML 2NW3B 3MLTA 5LGJA 3DVGB 1LHZA 4HMDA 4Y4HC 3U0WL 1LNUB 1HKFA 3OF6A 1RK1A 1LO2L 4FFVD 4PJAA 4R8WL 2PXYD 4HWBL 3O3BA 3TH3T 1J0KA 1EHAA 1NAKL 1LO4L 2EDQA 3ET9F 1ZHLA 5GS1C 1AE6L 2H26A 3RUGB 1GH7A 3SGEH 2XQBH 2Z31A 3KG5A 3MLVL 3AVEA 3QDGE 3UBXB 3SE3C 1J0JA 4RGNE 2R2BA 3ZO0A 4C57C 5LAXA 3DECA 2FRGP 2V2WA 2OMBA 3P30H 2V7HB 3EDKA 1G7QB 3D6GA 2PF6A 1W8NA 5M7QA 3TYFA 3RRQA 3PIQB 2XFXA 3V7AG 2DYPD 4W6WB 1IM9B 4YPJA 1F3JB 3QIWC 4GKNA 1DQJB 4LLVA 1HYRC 1R3IH 1KJ2H 3C8DA 4EVNA 1T7WA 3U7YL 5DQ9A 4LSSL 1VDGA 1JZ4A 2P7TB 1IEBB 4OLVH 4H8WC 2J88L 1G7LB 4WUUD 4NQCD 5F9AC 5C9JA 4TUJB 3A6CL 1KIPB 1YPZF 2E7HA 5BRZE 1XIWC 3M1BB 4PJ5E 4PRBA 4R97B 4NNYB 2ZOLA 1OAKH 1TDQA 2J6EA 3AU1B 3LHPL 5JLZA 5CLWA 3BYTA 2LAAA 2HTLC 2VIRA 4PY8J 4PJGE 4JPKH 4NSKB 1P4BL 2V7NB 4JAMB 3VWKA 1FL5B 4OB5H 3BDYH 4Z78B 2I9TB 4X7FC 1LK2B 4K7PY 4U0RC 3ZE0F 2N1KA 4XVTH 4U1HB 2HJKB 3FOMA 4PRID 5EBMB 4YK4B 4JPWL 4KRPB 5L2KE 5FDYA 2GTWB 2PETA 4E41B 3TPKA 3E2HB 3RKPA 2IQ9L 4LNVA 4TTDC 4M1DH 3IFLL 4XP1H 2IADB 5HYSA 1JP5A 2VISA 4TTGA 1T1WA 3WS6C 1INEL 5HHNB 4FQ2H 4NC1C 1BQHG 3HZYB 3PWVB 2OL3L 1GGCH 4QRRB 4DW2L 4U31A 2WBJD 3VG0L 4AK1A 3MX0A 4WHDA 4JKPL 4QRTB 2JB6A 3VXSE 4OGAC 3EO1B 4Z18A 1KIPA 4FQXA 3SN6N 5FECB 2BVOB 1QO3B 4ZPTB 2XZAL 5GRJH 5DUMH 2BP3A 4XMPL 3TN0D 3HRZA 4B5EA 2AK4A 4QGYA 4M3JA 2V9TA 3B9EA 3AC0A 4BZ1L 2CKBL 4Y16D 3DX7B 4Y4FB 4KZEH 3QRGH 5EDXA 4NQDA 4ZUWB 3ZE1F 3S96A 1T6VN 4OZHE 4YDIH 2NYYD 2JE8A 3S4SA 3TA3A 1A3LH 4FZ8L 5E8NA 2Q8BH 4ONHA 1T3FB 2X4SA 1N5AA 3L3KA 2DB8A 1PQZA 3TBSB 1QFWL 3MV7A 3AM8C 1U93B 4M7LL 4X6DF 1LDPL 3O3BB 4ZODA 3EYOA 1T5WA 3B8SA 3FFCD 3O3DA 5AZEL 2X4RA 4ZFFA 3IDNA 3G5XB 4JDVA 5SWZD 1RZJH 5F96H 1R3LB 1R3HB 1FZJB 1NGXB 3CVHH 3FQUA 1C16A 4ZD3L 1FJ1B 1CXHA 2QQLL 3D0VA 3NCFB 3RUGA 4U6YA 5DMIH 3OB0K 1DUYA 3ISWA 4XCNA 3RU8L 5EIIA 2AKRA 4OUUA 4P2RB 5C70A 5DHXB 3IKCA 4MLIA 3QUYC 4Z76B 4KVCH 1J5OH 4NQCA 3ARTA 1ZT4A 4KH2A 2QQNL 2ED9A 2Z4QA 3CFJA 4GG6B 3QPXH 4L4TE 1MCRA 4JR9L 1VGEH 2EKSB 1UENA 3KGRA 4EN3A 1CE1H 3ECBB 4MNQE 4Q7DA 4NN6C 4G42A 3GMNB 4D9QD 3PHOB 3ARFB 5DUBA 2NMSA 5I1HH 3BZFA 3GK8L 4PRNB 4WEBH 4LCWB 2NY1C 4JRXD 5DD1H 1OP5K 5I75C 4J6RH 1QHOA 1M05A 2NTSP 4GQ9H 4U6VL 3TCLA 2X1XR 5IEKB 3HZKB 1JHKH 2F8XC 5IB1A 5I8OH 3HAEB 2J12B 1BOGB 3U6RB 1UB6B 2HT4D 3NMEA 3G5YB 3PJSA 5EFIA 1SJXA 5HDQH 1CL7L 4V2CB 4J4PD 1DR9A 1YC7A 1AY1L 5SX5K 3NN8A 2HKHL 5E8PA 2NY2B 3BZEB 2C26A 2ZKHL 1CXLA 3KDMB 4WFFD 5EWIH 1RIHL 3IU3B 3B2UD 4CN1A 1OSZB 2FB4L 3VJ6B 1TNMA 1JHTB 5DQDL 3LB6D 4KUCD 4XHJC 5C71A 5AD0A 4H25A 4NDMB 4PJGB 5JW4M 1QFUL 2BFVH 5JIPA 5ERWB 1DLHB 7CGTA 3TIEB 2IPTH 2XA8H 2WIMA 5HHOA 3MGAA 2EIEA 5DMJB 5MI0B 5BVJB 3L7EA 4P59L 3VFRB 4Y4KD 2CK0L 5MEPA 4HFWB 2X7LB 4S1SL 5E6IB 4BH7A 5HY9B 3GKWL 2PTVA 3SDYL 5IOPB 3BPOC 5E9DE 3U46B 4X6CB 4X4XA 4GRWH 1DLFL 5IHUL 4NO3A 2VKWA 3P11L 3F6IA 3CDYA 1I9JH 3HNVH 5CD3A 1CE6A 4PJIE 5KVEL 3C6SB 3MPCA 3VXMB 4DGYL 2HVKB 3G5VA 4KY1L 4GRLB 1KPVA 4N0CC 2Y1VA 4M93B 4X9BA 2Y36H 4LDLB 3K4ZA 4LVHB 5HYEA 2RFXB 4WFEE 4QRPD 1CFVL 2DQDH 4KPHL 1UB6A 2FIKB 2HWZL 4MJIA 1Q9KA 3IRZA 1J18A 3V6ZB 1K2DB 2F5AL 2IAMC 3T65B 1QRNA 4YHOL 5BS0E 5F7EL 3F58L 5HXMA 1QVOB 1S9VA 1A9EA 3WNPA 3MQIA 5DJ6B 2CKBH 2H45A 5L2KA 4U1SA 1GRWA 4JJ5B 2Q3AA 4LLWA 2ED7A 2MCPL 2W0KA 4F7EA 3HC3L 3B8YA 4OJFL 4LFHG 3SKMA 4YDIL 3BIAX 5BXFA 4BUHA 5DK2A 3MBXH 5E24E 2XTJD 3D9AH 2RFXA 4ZPTA 1AI1H 3VGEA 3D0LA 4LSSH 3IS1X 3T0EA 3KPNB 4XNYH 1NFIB 2I07B 3UJTH 4GRLA 1TVBA 5FO9B 4Q9CA 3IKCB 2W92A 4M6MH 1ED3B 2V9QA 4G8EB 2F53D 1E28B 1YMMD 2DRUA 2WW8A 5CWSB 4GW5A 4ONGL 4X6CA 2AABH 5D7JA 4LHUB 4LU5H 1YEDB 2QQKL 2C4XA 3DMMD 4OIIH 1I85C 1F4AA 4YC2C 3SY0B 1UEYA 4GRWF 5E8EA 5EU3B 4U1SB 4W68A 4L4JA 1D9KD 4XAWH 2NXZB 3B9KA 3OXRB 5JW4Q 4I3RL 4QO1A 5JPMB 2YKLL 1ZANL 4UIKL 1DE4A 4PJAF 4XWGH 1GZPA 4O4YL 5FM8A 3LKPB 4Z7WA 4UV7H 4FFWC 4L4TA 5IB5B 1CTOA 2DQJH 4D0BA 5F21B 3N9GH 3VFUA 3IFLH 2QLVB 1CICD 4YGVA 1UXSB 5CEZH 2Q1EA 1QRND 2FATL 4NZRH 3VFGL 1SMAA 4OF8A 1KOAA 3MRMB 3ULSB 1CL7H 1FVDB 3QFDA 4R7DB 1X5IA 3O41B 4OZ4B 1NPUA 4K9EL 1JGVL 5D9SB 5D7LE 4HC1L 2UZIH 4P5KB 5FUCE 3ROOB 2AJZA 3OPZH 3LKPA 2GJ6E 3W9DA 2Z8VC 5FHAL 1NAKH 3SE4C 1TQBC 4YBQD 2FX7H 3NACH 2OL3H 1T1XA 1OTTC 3U30C 1QSEE 1WBXB 1LO5A 3S36X 3BI9X 4R90L 5EU3A 1BAFL 1T5XA 1O0VA 4R96A 4P3DB 1KTDB 1DBKH 1P6FA 3QCVL 5HYJA 3VJ6A 5CHNA 1TJGL 4KMQA 1A7OL 4MJ5A 1U3HA 5FKPA 4EUPG 1RZKL 4ZAKC 3I2CL 2PO6D 5T3ZD 3HE6A 4NT6B 1XMWA 5BZWB 1MLCA 3KWWA 2IPKA 4HUVB 2PTTB 4FA8A 1UWXH 5KSAC 5C09D 3DNKA 1JHLH 3HB3C 3H9SD 3ARYA 2J2ZA 4UB0L 4TVPH 2FX8H 1QRNE 5B3NA 3ZZ1A 1KJ2L 4R3SB 1IEBA 5IB2A 3MBEC 4UU9B 1T66D 3TPUA 2AK1H 1EFXA 3LRHA 3FZUD 3VMPA 3E1F1 2UWEB 3U2SA 4KKBD 3UTSD 2OTPA 1EEYB 2MCG1 4N68A 3QIWD 5F7MC 3ULUE 1OD7A 2H6PB 4JQXC 3MRHB 4NC1E 3VXQB 4QXWA 1D5BA 1S7UA 4Z77B 4PS4H 5KTEL 1YZZA 4Z95H 3TZVC 3WIHL 5IFHH 5C08D 2NR6C 43C9B 1ZHBB 3BW9B 1CXEA 1T4KB 5GJSL 2EYSB 2CIKA 5DVLA 4ZNEA 1RJZB 3MOBH 4UBDC 4XMLL 5BJTB 2R8SH 3UTZA 1KJMB 3GHEL 3V8OA 3VXME 4Z7NF 2AGJH 2EDYA 5DF0A 2NY5C 2DD8H 2VO5A 4OGZA 1U3HB 5ACZA 4JFED 1IBGL 3C2AL 4KQ3L 1J7VR 3MJ7A 1S3KL 1EH9A 4K8RC 3PV6B 2X89D 5F93C 4BELD 3RDTA 4FTVD 2GTWA 4ONGH 1EA9C 2EYTB 3EDDA 1UJ3C 2EYRA 1NCAL 1IFHH 4NBYB 5DGQA 5IB4B 3KWWB 2VLME 5SWZA 3OR6A 2FO4B 3INUH 3O6FA 4KQ4H 3N06B 2QTEA 4X6EB 5IB5A 2AI0L 1ZEAL 3NCJL 3PWLA 1NCTA 1FRGH 3IKKA 2BOBB 3TVMB 1JFQL 3O45A 4KHTH 2JJUA 2YHGA 5E2UH 3EYVB 4P2QA 5DK0B 1YC8A 2ICES 2JJVA 4AEHH 4N1HB 4RAUA 4HX1A 3MGTA 3B9KB 2VR4A 1UYWH 5TPWH 5J06A 3QEHB 1KC5L 4U7SA 1BMGA 5I1GH 1OSZA 3EO1A 1D6EA 2OTWB 2VDPH 4Z7VE 3N9GL 1U3JA 5C0NC 3HR5B 5K93A 3RY5A 3WL9B 4MD4A 5C0RL 1XF1A 3PV7A 2NY7H 4LASH 3D69B 2F53E 4AIOA 5DJCB 1NMAL 4WGWB 4FQHB 3TT3L 1FV1B 1S7SA 1NANI 3RWJA 2OQJA 4C56A 5DMYA 2VLJB 1T4KA 4WWID 1FO0B 1MIEH 4ZTPH 3SKNA 3WKNA 2CLZB 3SDXE 3WHE0 2AV1A 2W9EL 4WNQB 2VDKH 1GHFL 5M94B 3FONA 5C0JA 2E7LA 2NX5B 4FZEL 4YE4L 5KVFL 1CGYA 3RUGE 3BEVB 2DQGL 3O6ML 3RKDD 2P46B 4KK8D 4FQPA 4LLWB 4MAUH 2WIIB 3O3EA 2Y36L 4LFHD 1DL7H 4FMFA 3KYAA 3NZHL 1JMXA 1FQ9C 1K8IB 4HMCA 1CLZH 5FCUL 3PHSA 1JYWA 2R0ZL 1CDUA 2DQDL 3K2MC 1JGDB 1PY9A 3P4NB 5DMGC 4N5EC 5J57B 2GQHA 1N2RA 3F7PC 2FH8A 3CDGB 3LKQA 4UT6H 4ZUSB 1YDPA 5EC2B 3T0EC 2JJTA 5DJYB 4WI3A 2J8UB 3OKNA 5T3XD 2E5EA 2R1YA 5IBTH 4FHBD 4F7MA 5CP3A 3MYJB 4QLRA 3KLAA 4PRAA 4HIIA 4HK3N 3RWGA 3SKMB 3FQWA 5CHNB 3KXFD 3X14A 1OSPH 4PLNC 1YECL 4Y4KB 4NQSB 3V4UL 4ZS6D 5E2VH 2P45B 3FO9A 4QRUA 1NFIA 1JK8A 3R8BB 3T0EB 2D31B 1I7UB 1B0GA 4TNVF 3LOWA 1NFKA 5GSVA 2X42A 1VFAB 2X70B 1F13A 2HKHH 3GSNB 4ISVA 4PGZA 4PJHB 1U42A 5DEGA 2YWZA 3U9UA 4JO4H 1WWWX 3PG2A 2WUCH 5BVPH 4PS4L 5KTEH 3MUGA 2CQVA 3EUUA 2XN9A 1QFUH 3DETD 5C0BB 1KPRA 2ZG1A 1BD2D 2SEBA 5CEZL 3QP3A 3S88H 1KYOJ 2Y06L 1MWAH 5D2NB 3ZTNH 1HWHB 4X8JA 4I3RH 1YEHH 5GS3A 1CR9L 3MFFB 1ORQA 1P4LB 2YD5A 1VGKA 2BSSB 1S8DB 1RJYA 1A4KA 2VXQH 5JO5B 1AJ7H 4K9EH 4C83A 1G6RH 1LNUA 1T7ZA 4OLUL 2DDQH 4BFIA 4IIQC 1NGYA 1C7TA 5DYOB 3HCVA 4XVSL 5SWSB 3QI9A 1A6UL 4FS0A 3VW3H 2R15A 3HNVL 3PL6C 4LEOB 1Q1JH 43CAB 2HTKC 5F9WB 1NCUA 4YX2H 1BFSA 2AJVL 3REVB 5GJTH 2V17H 1R5WB 4JREB 1BJ1H 5T1LD 3CDCA 5ID0A 4DQOL 1AGCA 2OZ4H 5FOBB 4P2RD 1QSFB 1I3GL 4X6EA 2GHWB 5DVNA 2O5ZH 3T0DA 5BV7C 3GSUB 1DBAL 1BEYL 2QHRH 3MLWH 5IVOA 3E6FB 3BRFA 3VXUB 1LEIA 4HLZH 5HYQB 5LWYL 5IMOA 3F58H 4Z7WF 3NIDF 1DQQB 3S3PA 1ZT4B 1CXIA 2BNRB 1ORQB 4Z7VB 4P48A 4PJEE 5KVGH 3F5WA 2GT9A 3T1FA 4LVOC 2IH3A 4AQ1B 3QQ3A 1EFXD 2SEBB 5IKCA 3BIKB 4HZAA 1FFRA 1OAZL 1HSAB 3R1GH 1NDMB 5F6IC 1LGVA 1R3HA 4PJ5D 1K4DA 4HDIB 4EVNB 5J6GA 1MREH 1OT1A 4WI8A 4P9ML 1OGAB 4PJ7F 5DEFB 1N6QL 2PTUA 5J3HD 4NM4L 1RUMH 2HRLA 5F6HJ 5L8JB 3QHTC 2VLMD 4LBEA 5DRZA 1IVLA 4KI1A 1A3QA 4OCYL 3BP7A 1QBBA 1EDQA 1RUKL 2LVEA 3QIWB 2H6PA 4FQJH 4LCWA 4APQA 1QLFA 3JV4B 2VLLB 2XTJE 5IMKB 3P4OB 2ICWJ 3NZHH 5I19H 4ZO6A 1Q8MA 4JM2F 3GBML 3AAZA 5E6ID 4UU9A 4EXPX 3SGKA 5DMKB 5JW3H 5C0JB 4ORGB 2DLIA 1XT5A 5CJXC 2MJWA 3STZB 4GBXA 1XGUA 2XZCL 3PXHA 5KVMC 3SCMB 4KDWA 1EVUA 4KKNA 1JPFA 4JPVH 1FLRL 4CU8A 5JUEH 4G8GD 3V5KB 1DQTA 1IILE 1T66C 3DI3B 2WP3T 4HGWB 1LP9F 1KTKE 2DI9A 3MRDB 1NC4A 5E2VL 3VD7A 1T21B 1YJDC 1ZTXH 3CJJA 3OKEB 2HKFH 1WITA 1CLYH 3MRGB 1HI6A 3OJDA 4K3DL 4RWYH 3D48R 5KZCB 2VN4A 3BD4A 1NEZA 2F54A 1FFPA 2FYYB 2HVJB 1X4YA 1S7TB 1IZJA 3HAEG 4RDQG 1HNFA 1XF2A 3DURB 4JZNB 4FMKA 5BVPL 4XBGB 4F37K 4JRYD 1BVZA 3ZKXC 4LF3A 4M1GL 3QFJB 1XF4A 1ODAA 2O5XH 2OI9C 4N9GA 4OD1H 3C5SA 3S88L 4P0DA 4G9FD 2WINA 5C0FA 4NQED 3MNVB 3TC9A 4CN6A 4Y2DC 2FO1A 2FSEA 3QFJD 1A7OH 2P5WB 4LVOB 4LCCA 3QXUA 4Y5VB 4NWUH 4OLUH 2A6JA 3KXFE 4JPIA 4CJ0A 5B4MC 5GGUB 5LQBL 5F89A 1Q72H 2E6QA 4TVSa 4IDLA 4RISH 1H3TA 4OFVA 2NY7L 1KIQA 1NFDB 2VZOA 4U1MB 1H15B 1LQSR 2WBKA 4FQ2L 4MAUL 5EBWB 3CZJA 4BSVA 4R6UA 1CG9B 5JLZB 3KYMB 2YUZA 4TUKH 4Y7MA 3MLVH 4B0MM 2Y4SA 1MIEL 3WNLA 1BVLA 4QYOB 1PSKL 4NZTH 2W0FB 1UWEH 3TJEH 2Z92A 3TBWB 5EUOE 1R3KB 4LCWD 4O2CB 4M7ZC 5CWSA 2FBOJ 2DQGH 3O6MH 5T1KB 4NJ9H 5GS1A 3MV8B 3CLEL 3FB8A 1MQ8A 3W11D 3O4LA 4OKVA 1GC1L 1JPSL 2VLJD 1IE5A 3DUSB 2H8PA 2VXSL 3R1GL 4GQPH 4OV6F 1IT9H 5IROA 1U8KA 1OSPL 2VDLL 3U7YH 4OSUL 1GOGA 1N3NA 5DHVA 4AG4L 1EO8L 2VOTA 1LDPH 5EO0A 1F4WL 5I75B 4J3UA 3RTQA 1F8TL 5HGBB 3MLUL 1W0VB 5D1XA 2IH1B 1HHKA 2YN3A 5EOTB 1CU4L 4O02H 2K9UA 5AG8A 5JPNA 3RZCC 4RIRA 2ZUQC 3DTXB 4IMKC 3BP7B 4HUNB 2I60H 3QDMA 1DQDH 1K6QL 4PYHA 4LP5A 2Z35A 4KK9D 1FZMA 5E8DH 3ZSSA 3LY6A 4NQCE 3NFPA 3WLWD 3DV6A 2PKDA 2VXUH 5CKGA 3ROLB 1FRGL 5JQ6H 1QTYT 2VWEC 2FBJL 4IOIB 5IK3B 4YO0B 3IAGC 4AEHL 5IFAH 1QR1B 3GEWB 4S1RH 4QHNA 3ZE1E 4JN1L 2E3VA 1X4XA 3ULVD 4OZHA 3K8KA 4AH2B 2VSCA 2Y5TA 3U1SH 1AQKL 4XNQB 3JTSB 2BY0A 4BK5A 2X9WA 4EQ2A 1DN0B 4PJCF 3QXAB 3BDYL 4PPTA 3QI9C 1DUZB 1RFDL 4KROD 4JFFE 3I84A 5GS2H 2GAZA 3IXTB 2CGRL 1EEZB 4ZXBC 1JI1A 5D4QA 4ZYKB 5JO5A 3ORJA 2D2OA 4JKPH 2ADJA 4K2UH 3L5IA 1FZOA 3ARSA 5FO8B 2IWGA 3MJ8A 1BEYH 1NH6A 5J0BA 5J11C 5EG6C 3JBG7 4FZEH 4LSUH 3H7BB 3WBDA 5C0EB 4WGVB 4PJ9C 5I76A 4X9GA 2XT1B 4YO0A 1QR1A 2V6HA 4QOKA 3MCKA 5KSBB 1DDHA 1AGEB 3VFWB 3W9EB 2CR3A 2HLAA 1CYGA 3GSXA 3DX8B 1XGTB 1BIHA 3EYFB 3BKCH 5GGQL 3WEXA 3WSQL 2XWTB 4JFHE 1DVFD 2HA1A 4P9MH 5D7JC 3MLSL 4NRXA 1G7MA 3VA2C 3SGJA 3IJHA 3CXDL 3GMQB 5DT1H 1FG9C 3EO0A 3PL6D 1HINH 2EH7L 1JK8B 4LAQH 1BVKA 1JZ3A 1I85A 4JQIL 3MLYH 4H88L 5BV7L 3ES6A 5HSFA 5I8KL 1I9JL 3HG1B 1T20B 3VWJA 2NXYD 1L6XA 1YEEH 3UTOA 2VXVL 1BWMA 1XGQB 4HIIB 4U1KA 3PL6B 4KTDL 3MYJA 2BJMH 5DURD 5EZOL 3GJFB 3ZKSD 1MCOH 4PJBB 4MXVE 2P8PB 4PRPD 3CPLB 2PW2A 4R4ND 3ARBB 5DJAB 3QDGD 4R26L 1SQ2N 4XCNB 4RRPA 2FIKA 2AEPL 3FKUS 4Z7QF 3N1FC 3X3GH 2P47B 1CDCA 2GCYA 1QZ1A 4H0IA 3MRNB 3C9NA 2ZSVB 2W0LA 4R2GC 3OJVC 2IALA 3SDCB 3DARA 1S7XA 1S9YA 1G7HA 3HC3H 3UXFA 3KVQA 5JUEL 5JHDE 5IEHB 1X6LA 3FB5A 2P4AB 3DUUB 2F9BT 4OFPA 2CMRL 3SPVB 3VFOB 1AI1L 4K55A 2E7CA 4EIZC 1BQHB 3SDXF 5EIVA 4HUXB 4I8DA 3TBTB 4Y16C 4AG4H 1G7MB 4Y1AA 3BSZH 1PKOA 5B38B 4Y16B 3WE6B 1I1AC 1Q9KB 3ZTJG 3EDJA 4HS6A 5FYLD 2OJEB 5FYKL 3CVIH 4AIZB 3LQMA 3BH9A 4GMTH 2FJGA 3VW3L 3REWA 3CFEA 1QSZA 3ARQA 4WTXA 5I16B 2H1PL 1INQB 4N90D 2QQKH 3WKMH 2UYLA 5C9KA 4UT9H 3ME0A 1D5XB 3V52L 5KSVB 1ZTXL 4E0RB 2WK2A 4OD1L 3U82B 3DYPA 4Q9QH 4QXGH 5J6HB 3A6BH 3IU3A 3DIFA 4G80A 3VWJD 3VWKD 3WLBB 1VHPA 3O2VL 3IB4A 5KW9H 3VXUA 2DKMA 4WTWA 4HUWA 4J3TA 3ZKNC 4LMQE 3DBXB 5J9PA 1HHGB 5TDPA 1W0WA 2F53B 3P11H 3V6OC 4M5ZL 1G9EA 1J1OL 3PWPA 1T80A 4X9IA 4JDZA 1D5ZA 1DZBA 1JBJA 1LO3L 3QO1B 4NQVB 1OTUD 3MNWA 3O11B 4LCUA 1NGWA 4X7SL 1HDMB 5ESQB 2DYPA 4KPHH 3DX6B 1C08A 3HI5L 4KK6C 1MNUL 1A1OB 5DJ8A 2HYMA 1KJMA 4C4KT 3BD5A 1DUZA 5FV2A 4UAOB 3RVUC 2EYRB 1S5HA 4GW4B 5C09B 4KHXH 2W38A 2Z8WC 2OTUA 4YR6B 1UXWA 1YMME 1FYTD 1MJ8H 3L9RA 1TCMA 4X5WA 5C0ND 3LQAL 3D87B 4OF7A 5EB9A 5KOVC 5DSCB 4XP6H 2N4IA 1T03H 5DQ9B 1I9RL 3BN3B 3GB7A 5ISZD 4QY8B 1UJ3A 2Y9RT 4Q6IB 4XNYL 5DRXA 1CIDA 2ORBH 4MXVF 5TQ0L 4XCFL 5IFJB 1OVZA 2Y7QA 2X10A 3L3JA 4NUGL 1I7RB 1VFBA 3GSVA 1GXEA 4PR5B 2WWKT 3KPQA 3RNQA 3QIUC 4P9HC 1LP9B 5ETUA 2J8UE 5C0AD 4I9WD 1ACYL 4CADA 4QHKI 1KBGH 1V7NH 3RZCA 1KTRL 4XHQA 2JIXB 1MHCA 3QDMD 4R4BB 2NXZC 3ARDA 4S0TD 3WFEL 2HAZA 4BSJA 1G0XA 3SQBA 1MLCB 1JNNL 3SDDD 3UJTL 3BESR 2FDBP 1F00I 4HLZG 4OZGE 5KJRL 4XPGH 2VB5A 1Z2KA 4OCLC 1S7RB 3C60B 1WVZA 4HKJA 5FYJD 1MWAA 3AGVA 1IGTA 3GGWA 4R96B 1I1FA 4JFEE 2FZ3B 5T5FH 2IPKB 1UWXK 4Y2OA 5T5NF 3RWFB 1D7FA 3TEUA 4LU5L 3SJVE 5CBEB 5E08H 1MRFL 3S34H 3GSUA 1HZHH 4N1CA 4L4VB 1A7NH 2IBZY 2MQ3A 3TO4B 4FFZL 2B0SH 2BC4A 2NY0D 5C0AB 2VUYA 5ID0B 1FG2B 3DO7B 3W0WA 5HHMD 2HFEA 2ILLA 1P7QA 3ARGD 1FAIH 5SWQA 4IOFC 1MCPL 5E5RB 2AGJL 2H9GA 3KPMB 1LD9A 1UM6L 5DD6B 2AQ2A 2P5WA 5FGBA 4XP4L 1R5VA 1AKJA 1JUFA 4ZXBA 3K74B 3L3DB 3TIDA 2YMXH 1CT8B 5C07E 4LSQH 3Q1SH 3OJMB 4XZUB 2UY6A 3HNSL 1K3ZA 4XTRC 4P2OB 1J1PL 4JPIB 4RMQA 3H8NA 3ILQD 4KQ4L 2FR4A 5D9SA 3GZKA 3LS4H 1MH5B 3BJLA 2MFNA 5IQ9B 3NCJH 4F15C 3A6BL 7FABH 3OXSA 3ULUH 1E4XH 5A2LH 3BHBB 3O8XA 3GIZH 3KPSE 4ZFOA 3MV9B 2O5YH 4E0RA 4O9HL 4GAJH 1CCZA 5CBAB 2A6IB 2Y6SC 3U9PH 1EFQA 3OKOA 4YBQC 5JOPE 2K3TA 2EE9A 3QO1A 1AKJB 1EEQA 4JM4H 4JO3H 4EOWL 3WO4C 4OLEA 4PJCE 2HT2D 4LAQL 3WS3A 2CDFA 1WFOA 5BV7H 1DVFB 4NCDA 5TQ2H 1DQJA 3A67H 3IDJB 2I9TA 4OFYD 1RK0A 1NBVL 5EU5A 1D5IL 5KSUA 1B0GB 2FO4A 5CBEA 4F2MB 5ABDE 5H2BB 1WC7A 2A6KB 2D9QB 4JRYA 4YJZL 2DIAA 3MROB 4K3EL 1R5IB 5C3LD 3JV0A 1ED3A 4OGYL 3BGAA 3A0OA 2BVQA 1MNUH 2LTQB 2EH7H 5J1SC 1A5FH 2XV6B 4JQIH 3BP5B 3MLUH 3QA3B 2BNUA 4PJ8D 4DKEL 4MYWB 3JXAA 2ADFL 4XI5D 1F6LL 3RAJH 4HUMB 1KIRB 2CIIA 2Q8AH 2FX8L 2R29H 4YDLB 1S7WA 4NP4L 2YRPA 3QULA 2FH6A 2NY3D 4GXUM 3RVVD 5GS0D 3VWKC 1D9KC 1M6OB 1XFPA 3LPFA 3CPLA 1NBZA 3HI6L 1JJUA 4L9LC 1K8IA 4YHYC 4G9FE 1QBAA 4Q97A 5KZCD 5C0DB 2Q76A 3SDAB 1F6FB 1A64A 2R1WA 3R0MA 3I6GB 4WI7A 2PR4L 4DZ8B 2R2BB 5CAYB 4PGCB 5KG9A 3WHXB 1QBLH 4MZ3A 3CLFL 4JN1H 1G6VK 5IW1B 4R9HA 5D1ZB 2ZSVA 3JWNC 3QH3B 2CRMA 5FO7A 1MUJA 1RZ8A 2DQEL 5C7XL 1YPZB 2G75B 3O9WB 1T04B 4WDIB 1CE6B 4I4WA 1PX4A 3F5WB 2Q87A 4UDUB 1MAKA 3OX8B 3U4EA 3SDXA 1OGAA 2K1MA 1JGEB 4HPOL 4KKAD 3G08B 3MGOA 1L7IL 1OB1A 3QNXA 4PB0L 2C1PB 4MXQD 4Y5XA 2BNQB 3CVHA 1CQYA 4FXKB 3F62A 3RL2A 1BZ9B 4FQIL 1YYLL 3BKMH 4JKLA 3T2PA 3OMZA 4Z7VA 5TE7L 1WFTA 3T77A 4J4PA 3TESA 1P4BH 3BQUB 5C0RH 1NCDL 5DWUH 4QXGL 3QHZH 3EJYD 3SKJL 4LKCA 1JFQH 2GAZB 1W0WB 5DR5L 1IM9D 2NY4B 3K8LA 1XGTA 3OR6B 2JCCB 1MRCL 3ROOA 1MQKH 4OI9A 5TPWL 2FWOA 4OM1L 4HFUH 2BSSA 5JW4N 1XH3A 2UZXB 1CXKA 4LNRA 4PB9L 4P57A 3LN5B 3MV9A 5F1IB 3D3VA 2XXMB 3FB7B 5ANMA 4WRLA 1FORL 4A6YH 4HXBH 4DGVL 2IG2L 5AWNL 1DCLA 5ILTL 4ALAL 2B1AH 1QKZH 1INEH 2MKLC 3FFCB 1MUJB 3AY4A 3QXWA 4MDJB 3WFCL 1KJ3L 1BQLL 3UTQB 3S98A 1EPFA 1I1YB 2YA0A 1YNTB 4GS7B 4WUKH 1I9IL 3DO3A 3E6HB 1IRAY 5D6CA 5DD3L 4Y4FC 5KANG 4YIQA 4XCYB 4RFEB 2IQAA 4Y19B 3VRJB 3TYGH 5TQ2L 1IC5H 1VSCA 4NUJA 3QQ4B 3W5NA 3TO2B 3LKNB 4DJMA 5EOQH 4XMKL 1NGZA 5HDLA 4CVXA 2DWEB 4P4KD 5D7JB 2WWMC 5DJ2A 1KB9J 1JGUH 3MZGB 5LVEA 3RA7L 4NM4H 4RBPH 1ERNA 2FL5A 4NM8H 2R1XB 5GGTL 5SWZE 5IT2H 2Z35B 4L8CB 2GFBB 1CFTA 1K5NB 4UT7L 1HKLL 3P0VL 1OTSC 1IKFH 2XKUA 1AQDB 2EO1A 3LEVH 3ZT6A 5AYUL 4ZFGL 1I8LA 1R24B 5INCA 4IDJL 2I5YH 4K8RL 2VQ1B 2ZUWA 4PGCA 4KUZL 1FBIL 3ABZA 3GM0A 3KXFA 2EDHA 3MV7B 4Z0XB 2B0SL 3LQZA 4POYA 3FRPA 2H32H 4OT1H 5LCVL 4J3OC 4UIMB 4BFEA 1P84K 5D1ZD 3LPGA 3S37L 2EDLA 2XZZA 3SHSA 3VXSB 1N5YL 1S5IL 1P5VA 1IGML 3AREA 4PGJA 2E9IA 4U33A 4LLQB 5I18L 5J12B 4F33B 1TJIL 5D1QC 4UNUA 4HEME 3QUYD 4M3KB 4YZFE 4Z5RA 3T0WA 4P46A 4J23A 1FNSH 2VDMH 2YEZA 3G6DH 1FYHB 3S3JA 4M5ZH 2VLRA 4I48A 4ODHH 3CSBA 3DVNA 3LH2H 3MRPA 2IC2A 1LE9A 1J86A 3HS0A 4P46D 2W0FA 3CCHA 5FK9B 1GPOL 2Y5EA 2BMKB 3WXWL 2CH8A 4LOUC 2CDGB 2HKFL 3MA9L 4FXGB 4ZXBB 1ZLUH 4RSVA 1X5KA 3EYVA 3D39A 4P2QB 5DK0A 4AMKL 5TE6L 3VH8A 1ZA3A 3MLWL 3IDGB 4LSPL 4LLYA 2DYPB 4PLKC 4XZUA 2FB4H 1R3JA 3KJ6H 3WHE1 1KENL 4KAQH 1T0PB 2X4NA 2YC1B 1DVFA 3EYSL 4MNHB 3VI4F 2F54B 1YEKH 4AT6B 5CJQL 4AL8L 3LQAH 4KJQC 5FV1L 4PIRF 4DOHE 1A0QL 4P2RE 3RIAF 1I8MA 4KKBC 3CXHJ 4YHKL 1I3GH 1T21A 2DI8A 3ZKQD 4S1SH 3JUZA 1YEDA 2VKXA 3V5KA 3G9AB 4OGYH 3L5HA 1B6DA 3UTTB 1XAUA 5IV2B 1A5FL 3GBLA 2VUOA 1T0NB 3MJ6A 4PJEB 3O9WC 1Q72L 2VDQH 3WJJA 5JDJA 2Q7NA 1PEWA 1RMFH 4CU6A 4AJ0A 2ADFH 4EJ1C 4PGBA 3X11A 4TUOA 3C60A 3QSKB 4HKJB 3RWEB 4ZTOH 1NEZB 4OFIA 3TNNA 4NP4H 3UMTA 5IJKC 4JGMA 4TUKL 1UM4H 3OHXA 2MPAL 4OIBA 4NN5C 3HI6H 4KJWC 4AIZA 5HGGS 2F8OA 3B9KC 3QAZC 4PGDA 4QY8A 3BW9A 4OCYH 1B0WA 2MHAB 4YHOH 1TNNA 4HIXH 3UZVB 3RBSA 4JEGB 2FD6H 4KRMB 3DGGB 4MAYD 3TBYB 3WDHA 1I1CA 3MUZ1 1ZHLB 2KZ1B 5DRZB 4R2GB 4YXKL 2NY0B 5I66A 1YQVL 4GKSB 3GSRA 3QJFB 1EO7A 3LS5H 3O4LB 4OKVB 1I7ZA 3M17B 4IOFD 5ALBH 4MJIE 3MRIA 3D0VB 4J12A 1R24A 5CSBA 2E6JA 5INCB 3PGFH 3TV3L 4BH8B 1RY7B 4PJXB 5CCKL 1KPVB 3UYRH 1KN2L 1WZ1L 4XP4H 3PGDA 1PBYA 1P1ZA 2MSPA 35C8H 1KELH 3RJQB 4YFLI 5LJYH 4N8PA 4HWZA 3UAJD 1NGPH 2VLLA 1R0AL 5DD0L 4BQ6A 5L7XH 1WEJH 2VAAB 4UILH 3MRCA 3UX9B 1A7PH 3HNSH 1YEJL 3GSNH 5C0CD 3T2NL 3P4MB 5IHBA 3IFOA 2YN5A 2VE6B 1C08B 2J1KA 3QIBC 4F7PA 4OV5A 1NDGA 4ERSL 4J1UA 5DHYA 4WHTA 3MODH 4TQEH 2DLFL 5E2WH 4YDKH 1H3UA 2ZWLT 3S36L 2FBJH 4MNGA 3WN5C 3P2TA 5DJ0B 1BGXH 2JCCE 4JFFA 3B3IB 3DRQA 1U3HC 4PRPB 4UNTA 3H42L 1FC1A 3BGFB 3HE6C 2YPKA 3C8KA 1RUPL 4PB9H 3HCVB 4LSRL 5DRNA 4YH6A 3K46A 1EJOL 1I8KA 4Z7OE 5HJ3B 4O5LH 1UVQB 4U3XA 5CP7B 5JOFA 2QEJA 4PJCA 1FNLA 2EC9T 3T04D 4JG1H 4RGNC 4HKXA 4LDOB 2XKSA 1UB5A 4MB3A 4U1GC 1U8LB 2ADJB 4K3JL 4P9HL 4PG9B 3TO4C 2P5EE 2Z8SA 3OJ2C 5HGAB 3F7QA 4HXBL 1U58A 2DBJA 2VZUA 5IR1A 5T3XL 1QSED 3MR9A 5I1KH 2VMFA 3TH2T 1BFTA 3OAUL 5TF1L 5KAQF 5EZJB 4RGNB 4BFBD 4HUXA 1U8JB 4ODXA 5FB8B 1ZLSH 1KCKA 4HAFA 1Z9SA 3TJEL 1WV7T 1MFEH 1KCLA 2FJFB 5CJ5A 2FL5B 4L8CA 3ULVL 5DT1L 1FJ1A 1U8MA 1NLDH 4I0PA 2W60A 3G6JB 3WFBH 4PRIB 4I2XA 5I8KH 1PG7X 3QA3A 2VRAA 4G5ZL 3VDAA 1ZKAA 3BH9B 3EGSB 4DK3A 4P2QE 4PP2B 3BX7C 5E56A 1T20A 5TFSL 4F9PC 3X12A 4ONHB 4TSCL 3P40A 3FCTA 3MV7E 1Y18A 2QJDA 5BV7B 4TNWF 3WFHA 3PP4L 3QH3A 3H9YA 3WFZA 1F8TH 4O2EB 4D8PA 3T4YA 3CFDA 1BREA 2B1HH 3MRBA 3O8XD 4NQUA 3KXFB 1ZWIB 2V5YA 1TQBB 1UT9A 1CD1B 2VL5B 4P5MB 5F6HI 3VFPB 4K8RH 3BPLC 5CIPB 5HVGB 4X5LA 1J9CT 1F6AB 3BP4B 4FQCL 4PLJC 4XVUC 2V5MA 1CZ8H 3I9GH 1JZ6A 4G6JL 3KAAA 5I1LA 1YN6B 3L3OB 1QYGH 3SO5A 2DD8L 5CILH 1MJJA 3QNYA 3GMMB 4MDJA 4G9DA 5HVHC 4FP8H 1ZV5A 1UQSA 1TJIH 2W60B 4NO5B 3BVNA 3BGMA 3J7HA 2HT3C 3L7EB 1FPTH 3VDCA 4QRPA 3U4BL 4M00A 1KT2A 4HCRA 3B5HA 3SE3A 2NZIA 1TQCC 3RFZC 1RFDH 2Z0BA 1PKQE 4LGRB 9CGTA 1DVFC 1KIQB 5C0CA 3ZYZA 5HY9A 5MERB 1PLGL 1Z6JT 4ZYKA 5I8CB 1DANT 1HILB 3BKCL 1UACL 3QEQE 2ZJSH 4XPBH 2YWYA 4NHCH 2BVPA 4M1DL 4ZDHA 3L3GB 5HI4C 3U7WH 1B4JL 2UWEE 3W9EA 1W8OA 2FZ3A 4LK4A 4Q9RL 2NY3C 3WLBA 4JHAL 3RDTB 4PJGA 2BSED 2YBRA 4D0CA 3QJHB 5B38G 4HS3B 3LAFA 4LCIH 4MJ6A 1EHNA 2V2TA 1IC5L 2R0KH 2R4SL 1YEEL 4BKLB 3NGBC 5F70A 5HHOD 1JMZA 4MHHG 2V5RA 5EZLA 3C60C 1Q0XH 5JHDD 1EAJA 2OBGA 5IW1A 4WTZG 4G6FB 3QIUB 5E03A 3SDXB 4GUPA 4MA1B 3FAXA 1HCFX 1H5BA 4LRIC 2I9LA 3IVKA 5MERA 5CZXC 2LU3A 1HNGA 4PJ9D 3LKOA 3DX9B 4UT7H 25C8L 3TWCH 1HKLH 2A74B 4YE4H 5F44A 1X44A 4UMGA 1RZ8B 4HCRH 3WUZA 4JFDB 5HHME 4A2LA 4PJFE 1RZ7H 2XKNA 3G6JE 3WIIH 3GMNA 5ECJE 3T09A 3O6KH 3JTTB 2ZPKH 1WTGT 2EKSA 2XN9D 1ZLSL 1LO0H 2H3NA 1IQWL 1MI5D 1N0XH 3B6SA 4NZDA 4OT1L 5LCVH 3RNKB 3L5WB 4PJ8C 1PG7W 1FO0L 2QADD 1E4WL 3EOTL 4PJXE 4LCYA 4PTTA 2OR9H 1IGMH 5F6IB 4MDIB 2H41A 3EBAA 3ZLQC 4K7FA 4OD3L 1BIIB 3CSYA 3MLXL 4LEXL 4N0FA 5FA3B 2LVCA 4G6FD 5FXCH 4LHUD 3BIBX 3PXJA 5F7KC 1WK0A 2B2XL 2WMPA 3BWAA 4E41D 5CS7A 2WIIA 4YK4C 4CADB 2FGWH 3GRWA 4TRPH 1OWRM 4LSVL 1LP9A 4M7KL 5F9OH 3EOBA 3BEVA 5GS0L 3QUKB 3CFDB 1R5IA 1I1AA 3HC0A 1E6JH 3FQNB 3QIBA 4KK5C 5H2BA 5T1DH 4N8VG 1HIMH 5MEOB 1Y18B 4YHML 4WO4A 4X7CC 1B0RA 1WEJL 1JHKL 3UJJH 2H2PC 4URTB 4JY6B 4LIQL 1VKXB 1T1ZA 4TVPE 3TFKC 5GGUA 3UJIH 1E27B 3DPBA 3WS3B 1TETH 1TVHA 1K4DB 5D2NC 5JNYA 1P7KA 2E8YA 4R97C 1DBMH 2WLZA 1RZGA 1EJOH 3CMOL 2BVOA 4CMMB 4QT5A 3RL1B 2CXGA 1TZHB 2ARJQ 2XZQH 4G6JH 1LE5B 5IGXL 3CCHB 5FK9A 4YXHH 3DROA 3D25A 1OCWL 5E8OA 3ARED 1F4XH 3V5DA 4BSVB 3REWB 2YXFA 4OAWA 5DD6A 4JDTL 4MAYB 5F1NB 1YUHA 4HS8L 1IGJB 4JGUA 2R2EA 3GBNH 2NYYC 4AQOA 1NC2D 2X4PA 3DSFH 3QYCA 4LIQE 1VPOL 4X6CE 5IR1B 5H35A 5B3JE 4WO4B 2VITB 2DWDA 4IMLA 4AENB 5ITBH 2BRRL 3T4AB 1D6VL 1G9MC 3NZ8B 5TF1H 4UINH 2IJ0C 2FNBA 3QPQD 4E42A 5C2BH 1E4XL 4X7SH 4PJBE 3STZA 1CD8A 4QHKJ 4DCQB 1MCNA 2O5ZL 4Y19E 1HHGA 5TDPB 2ZJSL 4KJQD 1MFEL 4P23C 2BC4B 3RL1A 1ADQL 5JOEA 4P9HH 2OMNA 4L8BA 1RJYB 4JO3L 1KEML 3PP3K 2BRQA 2NW2A 1P4LA 1TVHB 4S1DD 1DANU 3MXVH 4DAGH 1U8OA 4PBWD 3O3AA 1JPGB 5I66B 1CFVH 2W1NA 1D5IH 4U1LB 3KYNA 1TZHA 4CJ1A 3N0PB 2HWZH 1KBGL 4WO4D 1IARB 5TFSH 4QRPE 4QNPE 3GJFA 3BYYA 4GJTB 5E7FA 3VFMB 2EDXA 4QTIH 5ENWA 3KPPB 2IPUG 4NNXA 1I1AD 4XB7A 1RUML 5EU6A 3RDTD 3LDBC 1GL4B 1WZ1H 3F65A 4KRPC 2AXGA 1MCSA 1U8NA 1FNFA 2XKNB 3UBXA 4ODTH 4KZDL 4Y1AB 1CFSA 4X98A 4K23H 1XF5A 4JFEA 4XH2B 5FUCC 4ZUUA 5IB2B 1FIEA 3IFOB 3MBXL 3IRPX 1HHIA 4ZUTB 3D85D 3QQ3B 3WDIA 4YHLL 4JRXB 2MOVA 2IH3B 2HTLD 4HULB 4D9LH 5IFJA 1MRFH 5I19L 4RMSA 1CGUA 1GOFA 3L3HB 4RGMB 1S7RA 4WHYH 5HD8D 1A47A 2DQTL 4I3SL 1FDLH 1HE7A 3HB3D 5J6GB 1RIVH 4KGLA 3WUWA 4HDIA 2PXYB 5E99L 1MCPH 4M7JH 5JZ7D 4BH8A 3MCKB 4YFDB 4QWWC 1BGXL 1Q9OB 3KPOB 5DXWA 5E5MA 5C2UB 1XF3A 3P4OA 3WYRA 5IBLC 4EDWH 1OGAE 4AEIH 3IFNH 4M02A 5HGHA 4HWNA 5E08L 2HT3D 1CG9A 2Y07L 4HJJH 5IOPA 1J8HA