1E4XH

Crossreactive binding of a circularized peptide to an anti-tgfalpha antibody fab-fragment
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
216
structure length
216
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGFTFTNYWMHWVKQRPGQGLEWIGEILPSNGRTNYNEKFKTKATLTVDKSSNTAYMQLSSLTSEDSAVYYCARSPSDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TAB2
publication title Cross-Reactive Binding of Cyclic Peptides to an Anti-Tgf Alpha Antibody Fab Fragment: An X-Ray Structural and Thermodynamic Analysis
pubmed doi rcsb
molecule tags Immune system
total genus 42
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2000-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1e4xH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1e4xH02
4XCEB 3P9MB 1BQSA 4JFFD 4MJIA 2YRLA 1OM3L 1K4CA 5C07D 2Y4SA 4GH7B 3QDJE 5BMFL 1ACYL 1G7MA 2NY0B 4PREA 2HLFD 3MXWL 4ZS7H 1AC6A 1BMGA 4XBGA 3CFDA 2WP3T 1D6EB 3UPRA 4PJIE 3GSOB 3P4OB 4LLDA 2G75A 2IANA 3V6FA 1CDUA 3X11B 1XF4B 1XIWA 4Y4HA 1QFUH 5E99L 3MOAL 4NFDA 3N85H 4PV9B 3D25A 3BPNB 4WWID 1FSKB 4JQVA 4ONGH 2ZUXA 5E5MA 2DQGL 1FVCA 1FV1A 2H9GB 2C4FT 3UJTL 4ODVH 3MA7A 3CUPA 1QHPA 4XAWL 1I1AB 4LLVB 1P4BH 5KVEL 3GK8L 4WEBL 4HPYH 4U6VL 4M43H 4EQ2A 1T3FA 2CH8A 4U6YB 3K0WA 1G7LB 1Y0LA 5E2VL 3RWEA 5IV2A 4X99A 2HFTA 3MGOB 3EJZC 1NFDE 1D5IH 2GTWA 5CJQL 1W2KT 1Q0XL 1WFNA 1HCFX 2L4OA 2VABB 1IAKB 4GXUM 1FH5L 2JJWA 2X4RA 4OUUB 3HS0B 1H15B 1D5ZB 2XWJA 4TPRL 3UTQB 4G5ZH 5D7LD 2HLAA 4K2UH 4YXLL 3WFBH 4KI5F 4DTGL 5F6HI 2DQEL 3VXUA 3VFNA 1GPOH 4J1UA 4RWYH 2XZAH 1JWUB 5C0EA 5MENE 3JV4B 1A7NL 1IKNC 3KYMA 2CKBA 3IETB 1TETH 4U1NB 3IDGB 4HIEB 3TO2B 2BHYA 1HQRB 5HPOA 2HJLB 3ZTJG 3W5MA 3NZ8A 2PTVA 2P5ED 4JFYB 4PTUB 3W39B 2X4OB 5E8OA 1U2CA 2E27H 2HFFA 1ZT1B 1NDMB 2B4CH 4CW1A 3MRCB 4JPKH 4A2LA 1B0RB 1S7VA 2YZ8A 3N9GL 5D7JA 5F1KC 3VJ6A 2FSEA 4PJAF 2FH8A 1RZ8B 2YA0A 5ILTL 5EU5A 3AROA 3O9WD 1TFHA 4YWGH 1EUTA 3VCLB 4KI5C 5BV7B 3HG1D 5K9JL 1NUGA 4K7FA 4PJAE 4LIQH 2Q6WB 1QYGL 3VDBA 1QRKA 2QSCL 2BY1A 5KOMC 1FCGA 4JO1L 3HMWL 3W9DB 1BBJB 5DVKA 4NKMA 4JAMA 3D0LA 4XP4H 3IFLH 3M17B 4PRAB 2FB4H 1TZHA 3AS3A 1CGTA 3IJHA 5AAWA 5TPWH 1T2QH 4HK3N 5KSUA 4Y5XA 3SDYL 1ZVYA 3TYFA 5IMMB 4PJHE 3LEVH 2L7UA 2CDFB 3QWQB 3LEXB 5E0QA 2VE6B 3NTCH 4N0FB 5I1JH 2X1WL 4QRRD 2VOTA 1FLRH 5H94A 4QKXB 5E5RB 3MLWL 5MI0B 2VLRE 5IQ7H 3H9HA 1MJ7L 4A6YL 1CBVL 5D7LA 1V7MH 3P4NA 3D18B 4I0CC 4QLRA 3HE6D 1N5YL 5DK3A 3QWOB 3PWPB 2V5RA 4QRUA 5T3ZH 2UVFA 4UNVA 3SE3A 1IT9L 4Y16D 1Z9SA 3FB7B 3MLZH 2GK2A 1I3GL 3GMOA 5IHZA 2MKLC 5LWYH 1UM5H 3OGCB 1ZV5A 3MRKA 2W9EL 5HI3C 5CD3A 4HUVA 5E2UH 1CG9B 4HKJA 5FO7A 2PW1B 5I1IH 2P5EA 5DEFB 1I3VA 4K3DH 1ZK9A 4KZEL 2EYRA 4KKNA 3K4ZA 2NY5H 4GAGL 1YMMD 2CXGA 3GSQA 1MCOH 3ARDC 1UM4H 3ZYOA 1JPST 1T5WA 5D5ME 3UBXG 3EYQC 2OJEA 3QA3B 3O9WA 5J1AB 4PJAB 3QCUH 4O58L 1UVQB 1EEYB 3SE9L 3HG1A 3K74B 3LN5B 1FVDA 3EYSH 4OIAA 2ZUWA 1HOCB 2Z8WC 5C0BD 5J3HD 1LO0L 1LEKA 4R96B 4W4OA 3MRIB 2K9UA 3ZHLA 3IFNH 4OQTH 3C8KA 3KG5A 4MXQD 4S1RL 2YRZA 4AEIH 5C7XH 2F8OA 4O2EB 4UTBL 1O0VA 4ALAH 3QHZL 4G8IB 5BZWA 5LCVH 3ZDZF 1OLZA 3Q5TA 4I0PD 4D9QD 4OLYH 3C6SA 4NDMA 1EGJH 4D9LH 2R15A 3ZKMC 2AXGB 5DD3L 5E08L 4XCFL 1QLEH 3KLDA 4HKZA 4WRLA 2OJZL 4DKFL 2X1PA 3ZDZE 5FFLA 4QCIB 3ILQC 4QRRA 3BZEB 1G84A 1R24B 1JV5A 2DICA 1EXUB 1GOGA 5HY9A 4BZ2H 5LXGL 4JRWA 2DYPB 3L3OA 5HDQL 3CDGA 3HE6A 2FEDD 2EH8L 3ARDB 2DM2A 1WEJH 3ARVA 4AIZA 4KTDL 3UTOA 5CJXC 4Y16A 5CZVL 4GMSH 1A7RH 1U95B 3V5DA 2KQNA 1NQBA 1RUKL 2A73A 5EZJA 3T4AB 2J8UF 4KDWA 2R2CA 5GHWH 4FTVE 2BFVH 3DUUA 2C3XA 3GSXA 1FL3B 1YMMA 4U6TA 2J8OA 1CT8A 1RY7B 2BCKA 4ZFOB 1FRGL 3PXJA 1FP5A 1RU9H 3RJDA 4I13B 3JWOH 1P7QB 1UXWA 2AJSH 1MCPL 2FIKA 2EDOA 2EDRA 5HDBF 1WZMA 1JUFA 1OLLA 3T8XA 1E4WL 2W07A 2GJ6E 5I18L 2YZ1A 4WI2A 3AXLA 1NCAH 2HFGL 4OM0L 2ARJA 5F9JB 5C0BA 3QDME 1X5GA 1MHEA 5FGSA 2GT9A 4QRSB 4P2RE 4HWEL 1NCWH 3X13A 4XGZB 5IT2L 3MLYL 3P30L 3CCHA 1E4JA 5MP6H 5I76A 3PHQB 4MAYC 5HD8C 4I0PA 4OV6F 3OZ9L 1WCBB 3MLVL 5CIPB 2HT2D 3WBDA 3BUYB 2MOVA 3B9VA 3GJFK 4ZSOA 1QKZL 5F1NB 3CSGA 3GI9L 4KC3B 4EBQL 3PWJB 2O5XL 1U8OB 4HH8A 4HHAA 1G9MC 3T08A 3HZKA 3I2CL 4JRYD 2NZ9D 2WWKT 3KR3L 4OGZA 3ULUH 2AABH 1JHKL 2ZJSL 1BQHA 5DJAB 5KVMC 3OR6A 1NGWB 2NXYD 3V5KB 4K8RL 4BSVB 4JFPB 4FQQA 3SJVB 1BHGA 4I48B 4JY5H 5DMGD 4I3SL 4I9WE 4LBEB 3Q1SH 2Y5TB 4OKVB 4XCNB 1GGUA 2A83A 2ZCHL 3LN4A 4UU9A 3CFJB 3I75B 3VFWA 4D0CA 1EHXA 1K6QH 1KENH 2YSSB 3ZE0F 3LDBC 1MFEH 1JIBA 2ZG3A 1KJMA 4GW5A 4L8DA 4WTWA 5DTFA 2NTFB 3T0BA 1CQYA 2B4CC 1WITA 3BP4B 3RVVC 4F33A 3KYOB 3BT2L 3H6JA 4M9OA 3C5ZC 5AZ2H 2J8UB 4F8TA 1NC2D 5EN2A 4YK4C 3X3GL 3ZE0E 3WUWA 3KDMB 4QXUL 5BVJB 4TUJA 2PCPB 5I16B 2F5BH 3RI5F 4MAYB 3BW9A 4MNHA 4Q6IC 1NDGB 4LEOA 3VRLE 3QRGH 2GJ6B 1ULVA 4XNQA 4Y5YA 5DRXB 1VADB 1GOHA 1LHZA 2ENSA 4F3FB 4KK5D 5F9WB 1NMBH 3QDMB 2G5BA 4HZLB 2FBJH 1NGXB 5GGQL 3QUXC 3CMOL 3QI9C 1ZSDB 1X5ZA 2F9BT 5DS8B 1FBIL 2I60H 4WJ5B 3TJEL 1IEBA 1S78D 3R4DA 4V2CB 3DRQA 4TUKL 3Q6FA 1IM3B 4LKCB 2C3VA 3A6BH 5AWNL 1HIMH 3GMMA 5H35B 5DYOB 3O0RH 4RISL 3DYPA 1YEHL 1UKQA 3P4MB 3Q2CA 1FIGH 5DQDH 1XF3A 4LSSH 4NQVB 1WZLA 5IEHB 4HMEA 3QJFA 3MUHL 3UX9B 3V6ZA 2BSTB 1NCDL 3MBXH 1KG0B 4LQ1A 1OARH 2HT3D 2X4PB 5E4EC 3LDBB 4JRYA 5F7HA 1MHHB 1P4IL 3EYUL 1PKOA 4BQ8A 1IAOA 5GISL 3WHE0 4YHNB 1T4KB 1FDLL 1G7PB 5DMJB 2X6MA 1JP5A 1KF9B 5HHNA 1BIIB 1GIGL 1F8TH 5GRUL 5I1LB 5HYJE 2IFFL 2W91A 3C5ZB 5DJZA 4YK4B 1M7DA 3CLEL 4S1SL 1LP9E 1FYTD 4I2XE 1EAJA 1INDL 1GGIL 3ARSA 5E2WH 4XAKE 4AEHL 1RK1B 4BFIB 1CFVH 1AXTL 2EDTA 4HG4J 3HFML 3EBAA 3TZVC 2F19L 3TYGL 1NKRA 3OAZK 3IVKB 4UT9L 4RMVA 4U1LB 5IG7A 4U3HA 5JW4Q 5I74C 1IBGH 3QUXB 3QI9B 5IB2B 1G7IB 4MA1C 2NY5C 3O8XD 2P49B 3WEXA 3BAEL 1UZ6E 1NC2A 2H2SC 4P2YA 1I8MA 1DFBH 5A2FA 2VDPH 2WM0A 4JLRA 1YPZF 5FKAA 4P5TC 3WIHH 2ZG1A 5DA0B 2Q8AL 3RIFK 4HWBH 3VD7A 4GKSB 2Y6SC 2Z93A 1SJEB 1E6OL 1T22A 4LLMB 5FK9A 4KUZH 4OCWH 4F80A 2B8OT 2VR5A 1G9EA 2WSKA 4LHJB 5F88B 5IW6A 4B7LA 1N0XH 1S7SB 3SE8H 3T3PE 5JTWA 1CFNB 3Q5YA 5CEYA 3L3HA 3WV0A 3WFDH 5E4EB 4Y8DC 4XVSL 4JPVL 1V3KA 3GM0A 4MJIE 4RGMC 1MSPA 4ODTL 4X9HA 5GJTL 2NNAB 5J4MA 3U79A 4E42A 2HH0L 4AIXA 4JQIL 2Q8BH 3TT1H 2DM7A 3WD5L 1A6ZB 2IBGA 3U0WL 2IANE 4UIMB 4DAGH 1LEIB 4YAQA 4LQFL 3CVHB 3UEZA 3JWDH 5L9DL 3FRUA 3GSVB 3MLTA 4FXKB 1G0DA 1WF5A 4NO2A 1QNZL 3ARGA 1B0GB 5F93C 5KZCD 3NH7H 4G8FB 1NGYA 3TPUB 5I74B 4Q97A 2VLLB 3B9KC 5DD5H 4KPHH 1ITBB 2ZUYA 2BNQD 4ODWA 2ZOLB 3RHWF 1XF5B 4FFWD 5AZEH 5SWSB 3VE0A 1VPOH 4HJJH 4ORGB 3GSNH 3G04A 5CGYC 1FYTA 5HSFA 1NUNB 3O6KH 5DZNA 2I26N 4KU1A 1A3QA 3HNVH 5C92A 3MXVH 3MYJB 3H0TA 4K3EL 3VXUE 2QQNH 3NFPA 4HFUL 4HWZB 1NSNL 1YNKH 4XMKL 3O8XA 4I3RH 2OMNA 4XNZC 1JBJA 4PRHB 1L7TL 2ICCA 2GSIB 5J56B 4OLXH 3VGDA 4YBLC 3CU1A 4HXBL 4OD1L 4UUJB 1YUHB 2PXYD 4ZTPH 4K7PX 2FL5A 1JMZA 3P9WB 4N90D 1YPZB 1J8KA 3GHEH 3QIBD 2AK1H 1T1XB 2IJ0C 2WLZA 1F97A 4JDTH 1CDCA 1K4CB 2ERJB 3SDXF 3QXVA 1G7MB 3SGJC 5IHUL 4UV7L 4CU7A 4FMKA 1FAIL 4LEXL 3B9KB 4NFCA 2Y25A 4YUEL 1NL0L 1RJZA 3UPRB 4WW2C 2OP4L 2PR4L 3WJJA 4CADB 3O2DH 4N0YH 2IANB 1UH4A 1QR1B 1EJOL 4KZDL 1GL4B 4ZXBC 1INEH 3VFGL 1FHGA 1JZ5A 2V5SA 1FV1B 3DBXA 3MJGX 4FQ2L 2E3VA 4KKBC 5JLZA 3MA7B 3N0PB 3V2AR 4OI8A 5DHVH 3ULUC 3HNTH 2P46B 2ZCLH 1D5MA 4Y2OA 4HX1B 4Z0XA 1T3FB 2BNQA 3UBXA 3BRFA 2Z8VC 1CLOH 4K9EH 4ZFZA 3RWEB 4X99B 1HHHB 4OLZH 1TJHL 4TVSa 5JORA 2UY6A 2XZZA 4M62H 3NABH 2APVA 3O4OC 5F1SA 4AENA 4AG4H 4WU7B 3DVFA 1G9NL 5DWUL 1YEJL 5TDNA 2XWJB 3RIAK 3KWWB 1UWGL 3VD9A 4AM0A 2GJZB 2VL5B 3QUKA 2JCCF 2B20A 3VXUB 2D0GA 5F97E 1HZHH 3GJFA 5HHPB 5D7LE 4NC1C 2JJSA 5C0EB 3BUTA 1WAAA 4HCRA 4OLEA 4EXKA 4M5ZH 3SDDC 2ZOKB 4XVUC 3WLBA 2HN7B 1MCQA 3PWUA 5K33A 4NN6C 5AEAA 2CO6B 5MEPA 2Z92A 1X5XA 5E8OB 2ZNXA 4ZO6A 3F5WA 4XB7A 3CVIL 4EEEA 1HILA 4NQDB 3V6OC 2P5EE 2XWTB 3G08B 4X5LA 4HS3A 2PXYA 2K3TA 2YD2A 1O7SA 1PKQB 2FSEB 3NVQA 2V2TA 5IVXF 5DFVD 1NMAH 2WW8A 5IW3A 4PP2A 3MSPA 5HDOA 3VXMD 4D3CL 2VIRA 4NZTH 3V0AC 4OZIF 4MVBC 4ZUVA 4WI4A 2FGWL 3MJ9H 5TE6L 3ULVL 3MPCA 3PWVB 3RKDD 4LVNB 4NP4H 4TNWK 4DUWA 3TVMC 4OV5A 3SDXB 4I18C 3HCVA 3HG1E 2RB8A 1RUQH 1KN4H 2PYEB 1DBML 1KXQE 4ETQA 1FE8L 3FT4A 4JAMB 4NKMB 2NYYC 1C5CL 2HT4C 5IB3A 3OKKA 5CEZD 1T66D 4YXHL 3BH8B 4NNPL 1QVOB 5KSUB 4Y5XB 4ZO9A 3BQUC 4N9GA 5D7IF 4PGDA 3MUGB 5IBLD 4GS7B 1LK2B 3NACH 4DGIH 4OLVL 3SDDB 4LRNL 3QEGL 3BGFB 1JPTL 3C5JB 3QQ3B 2F8VA 5SX5K 3KPRD 5DMIL 1FZMB 1ZWIB 4NN6B 5H94B 2R69L 3GKWH 5C6TL 1EZVX 3RY4A 2QQKL 2DS4A 4QRRE 3ES6B 4GW4A 2CDGA 4UIKH 1UG9A 1GGCH 3T0VA 1AJ7L 3PQYD 5D7LB 3MLUL 3DXAB 1E4XL 4MD0A 3ZTJH 4KKLC 3QHFL 3VXRD 1QA9B 3RWGB 1FNGA 3DX8B 1HE7A 3L5JA 2XRAH 1BEYH 1JPFA 3BKCL 4TVPD 3AAZB 4O51A 2JCCB 1Q72H 1UZ8A 4H20L 4MNGA 4ZO8A 1ED3A 5I1AA 3RVTC 1XGTB 4HUVB 4HKJB 1JPGA 2YN5A 3CC5A 3GNML 3TVMB 4EXPX 1I4FA 3C09C 3L1OH 4BZ1L 1KT2A 1QO3B 1VFBA 1CZ8H 2XQBL 3FN0H 3GSQB 4NSKB 3S9DB 3BPCB 5D71L 3CPLA 3OKNA 3DTXA 1EO7A 5E8PA 3H9ZA 4CRPA 1T5WB 3T0EA 5A3ID 1K2DA 1WTLA 1IFHH 5L8JB 2PTUA 1YMME 1CN4A 3AS0A 2OJEB 4N8VB 4D0DA 1I9EA 3VXMA 4MLSA 5IVXB 1MAJA 3BQUB 5E6IC 4JHWL 3RZWA 3IDXH 4U49A 3GIZL 4E5XB 5T5FH 3OJDA 5TDPA 1FVDB 1CK0H 1C7SA 1G7JA 2XZQH 4IOSD 4MCYB 5JIPA 1QLRB 4RGNC 4QRPB 5FIEA 4OZIB 5L2KB 2J6EH 4WO4D 3L5HA 1LEKB 5I1EL 3D9AL 5M95B 4QNPE 1ZANL 1KB5L 4PPTA 3C8KB 2CMRH 4LGPB 5C0BE 1GZQB 1JZ8A 1E6JL 5KTEL 1BGXL 4Y4FD 4ODHL 4HT1L 3JWDC 4KGLA 1U8MB 2XNAB 5HXMA 2EKSB 1J18A 1DANU 2ESVD 5LBSL 2VC2H 2YKLH 5EU3B 5ID1A 3FQUA 3JTTB 4D9QE 4UQ3A 2AEPL 3ARYA 3V52L 1RHHB 1OAUH 5CD5D 1BQLH 5IOPA 4ZSOE 4X8XA 5D7IB 3HI6H 4QRRB 3I9GH 1FFPA 1JV5B 2FECL 4RFOL 4G9DB 3QEQA 4GXUN 3C09B 3K2UL 4JG1H 3EJYD 3RVXC 2VDOL 4G9FD 5C8JA 3M8OL 3PQYA 1IQWH 1BVZA 4NFBA 4C56D 5HHQB 2W9DH 3G6DL 1T1YA 2E8ZA 2ZKHH 4P5MA 5DJ8A 4AIZB 1DQLH 4Y4KA 4J4PD 3PGFL 5FO8B 1KV3A 1Z5LA 3ZTNL 3V5DB 2YD7A 5EZJB 3DJ9A 4RGNB 4WVRA 2UZIL 2N7BA 2OR9L 3D69A 5E00A 5GSVA 4E41D 3IYLW 4YFDB 1BD2B 3HZMA 1G6RA 4FFYH 1QRNB 1I3RA 1YC7A 5T33L 1T7ZA 5I1KH 1CT8B 2BCKB 4X7CC 1T7VA 3KPPA 5IMOB 1FGVL 1EEQA 2VSDA 4QOKB 1FFNB 2FD6H 4DK3A 1K3ZA 5TQ0H 1UXWB 4X5WB 1JN6A 1YN6B 3PDOA 3REWA 1JUFB 3G5XB 1OTSC 3T4YB 1ODAA 3OHXB 4W6WB 3IDUA 5C0BB 1S7QB 4WO4A 1RZJH 3N06B 1MHEB 4IRZH 2GT9B 1D6VH 2NW2A 3X13B 4KK8C 4Q2ZB 4F58L 3FHQA 1P9MC 4Y4FA 3EO1A 5I76B 2LU4A 3S36L 2CUMA 1NJ9B 1WUNT 2ESVA 5DUML 1HQ4B 1MPAL 1A7QH 4KGJA 1MCNA 2D4DA 5EA0L 1PDKA 2AGJH 3B9EA 4GRWF 2VDRH 2QV2A 1OP3K 4FXGA 4RMWA 1Y6NR 2OZ4L 4K9EC 1T21A 4HHAB 5LKNA 5GS1C 2BSED 4LNVA 4XP1H 1N8ZA 1QPXA 1F4YL 1BQHB 5B38G 1MRDL 4OGXL 1H8NA 4GRWE 3DUSA 4JRYE 1PZ5A 3C6LD 4G9FA 4L4TB 3V0WH 4FQQB 3GO1L 1SQ2N 4C56A 4JFQB 5IROA 3DVGA 4R0LC 4YDIH 1ZLUH 1V5JA 4J4PA 2DAVA 2Q1EA 3WE6A 4FG6D 4NKIL 1IM9D 4L5FH 4O02H 1CGWA 1NC4B 1IVLA 3VFWB 4D0CB 4PJ7A 4JR9L 5JZ7D 4Y2DD 3ROOA 3H9SB 5BOZG 3BPOC 1KJMB 5F89B 4GW5B 4L8DB 5FHBH 7CGTA 5DTFB 3MOBH 2FH6A 3FZUD 4HUUA 4E41A 3OKDA 1JGUL 4PLOB 4P9HL 3FTGA 3S7GA 5EN2B 2OM5A 1HHKA 3WUWB 3QCVH 2NXZC 1BLNA 4P99A 5DUBA 2R9HC 5K9QI 5DHVB 2QHRL 4MX7A 4Y5YB 2GY7B 4MA7L 5JIHA 3PGCA 2AK4D 3OKMA 3SKNA 3FO1A 2G5BB 2GSGB 3QFJB 3WL9A 4PD4J 4ZDHB 4PGBB 4Z77B 1XF2A 1KTKE 5D2NA 1TIUA 4J3SA 3I02B 2UYLA 4QY8B 4JM2F 4Q0XH 3Q6FB 4QXGH 3RWFA 4KTEL 4BELD 1Z3GH 3GMMB 3ZDXF 4LSRH 3CFKB 4S1DD 1AGDA 3VFVB 2MCPL 2AJUL 3O45A 2G60H 1YEDA 2WQRA 4OZGF 4R0LB 2XZCH 3J8F7 4QYOB 3TN0C 1XF3B 1RZFH 5CBEB 3DVIA 3WIIH 5GGVH 3OPZH 1E27A 2MKWA 4X6CA 1Y6MR 3FHAA 4X6FB 2DB8A 3ZDXE 4XCYB 4HQQL 4GRWB 5LQBH 5EOQH 5GZOC 4LSUH 5D93C 1FNSH 5HHXH 3W0WB 4TSCL 1YEFH 4FN0A 3ME0A 5IB1A 3C6LA 3IF1A 1EFXD 5GS0C 3TIEA 3HNSH 5F9DC 3L3GA 4P57A 3MRNB 2FRGP 4JM2C 5FYJL 1RVFL 4YDLB 3AU1A 4POZC 4I77L 4EUPH 1U3YA 4WEMB 2NXZB 1UB6B 1MVFA 2Z31C 1N59B 4A6YA 3ELAT 1KCRL 3KPMA 4OZFG 43CAB 2RR3A 5A1AA 5KVFL 1IM9A 3NPZB 1BBDH 4MD4A 2PYFA 1FYTE 5D2LF 3IXAA 5BJTB 4R7DB 3P3YA 4Y2DA 3BEVB 2B0SH 4HXAL 1IAIL 4IMLA 2ITDA 1ES0B 4Z7WA 3MRJA 1YEKL 5JW4M 1AR2A 1IGML 2R1WA 1N4XH 1U8NA 3WEXB 4M03A 5ERWA 5H8DA 5JPMB 35C8H 1JTPA 4JLRB 5FKAB 1CE1H 3HMXH 4KAQL 2LAAA 3MBED 1C1EH 1PW3A 5L2JB 3WSQL 2Z93B 1HYSD 3GM8A 1T22B 4UDTA 4P59L 3TN0B 2AK4A 3EHBC 4WHCA 2BSSA 5IW6B 1IEHA 3GFUA 3I3BA 2VLMD 3B2VL 2EDDA 1AXSA 4O5LL 4JVUA 3RGVD 2AJVH 4W70A 5BV7L 3KYKL 5ALCL 3ZHDA 4PJBF 5D72H 1QQDB 3MA9L 2A9MH 4IMKC 1UWXK 4OD3L 2ZUQB 1DEEB 4JM2B 5TQ2H 1AO7D 2E9IA 1AGCA 5GXBB 2Z31B 1Y6KR 3SPVB 43C9B 1KCKA 1IGYB 3RX7A 3VA6A 1H3PH 3WLWD 3FRUB 1KACB 3F7VA 4NO2B 4OZGB 1Q0YL 2YD3A 3ARGB 1MFDH 2YUXA 3WJLA 3CFBB 3V4VL 3K2MC 4YPJA 3MRQA 3BP6A 4ODWB 5A16A 3GSRB 3ZKNC 3BIKA 2J4WL 4FNLH 4ZS6D 4P46D 3WMSA 3ULSA 4G7YL 3CD4A 3VE0B 4X0KB 2Q20A 4UOW0 2R56H 4M7LL 2BNQE 2GY5A 3QIWC 2X4QA 1ITCA 4K8RD 15C8L 1MAML 3N1MC 1QPPA 1TZGL 3H3KA 1JNLH 1XGPA 1S5IL 1XH3A 4G6FD 4PJ9C 5DRZB 4Q58C 5DFTA 1JMXA 3TIDA 2EC9U 25C8L 5EBLB 3TNMA 5F7YC 4FQLL 3H0TB 4Y8AA 1PYWA 1U3JA 3NFPB 2BOCA 4NCC1 4OBRA 5D2LB 5TE7H 4U0RC 3TV3H 1RMFL 1WAAE 5CZXD 2NPLX 4Z76B 1R3LB 4GKOA 5ICXA 4L8BA 1DDHA 2A6KB 1LILA 2B2XH 2AKRB 3BMVA 4OJFL 2IBZY 1S7XA 4OCLC 1TZIB 3MBEA 4OT1H 5K9OB 4ODSH 2FL5B 2IGFL 1F11B 4JZNB 4NBZB 5F7EH 4LASL 1U8JB 4ERSH 1YYML 3HAEA 1WJ3A 3ARZA 1QACA 5GJSH 5IFJA 3BKMH 4U7SA 3DMMD 3H7BA 5DK0A 4N90E 3JUYA 3WCYA 2AEWA 3OKEA 4TN9A 4WHDA 4WHTB 3MV7B 4LSPH 3RGVA 3TWCL 5JIIA 1U3HD 1H3WM 4HIJA 1CCZA 1ND0B 4YHML 4K3HA 5D1QC 3MR9A 3UCRA 4MNQD 1I8KA 3FQXA 5C0RH 3OV6A 4X4XA 1AO7A 1UACH 3QIWB 4RQQB 4UINH 4H5SB 2A77L 3R0NA 1ZTXH 4PJBB 5KS9F 4YBQD 2J12B 2RQ8A 4PJ9B 5EULV 5JLZB 2VLKD 5I19L 1TJGL 3HHRB 5JMOC 1I7TA 4R4NC 3T0DA 1OGTA 4R3SA 3U7WL 3CX5K 4NJ9H 4POYA 2WUCH 3CDCA 1JHTA 4Z0XB 4G8GD 3UBXB 2FX8H 3I3EA 2B1AH 5DRWA 4U0RB 4XNUL 2OR7A 4GXVH 4XXCA 3TCLA 4AENB 5FUZH 2OBGA 4N0UA 2ICWA 2EE2A 5CILH 4P2QB 1H3UA 3GMRA 3SGKC 1OF2A 4AM0B 4NN5C 5I1HH 1JGLL 2YXMA 1A6VH 1DUZB 4J6RH 5KW9L 3NCBB 4NYLB 3WNOA 2LTQC 3PWUB 4HKXA 1AFVH 1FPTL 2HWZH 1ZVSB 4MB5A 1DQDL 1KLUB 5FB8A 4MNGE 5FCUL 1SY6L 2V17L 3F5WB 3SO3C 3IRZA 1HILB 4NZRL 5GRJH 4ODUA 1XR9A 4UTAH 3SOBL 2DQCL 2V2TB 3L5IA 3VXOA 1T1WA 4JG0H 4HLJA 3JVGC 2JB6A 3MJ7A 3ECBA 3HC0A 1BF2A 1MFNA 3DMMA 2CKBH 3LD8B 4LLQA 5C0ND 1JGDB 1PQZB 4LLUA 1A4KA 3T0EE 3O3DA 4ZFOL 2FJGA 4OCSH 1U58A 1U91A 3MRRA 4HV8B 4NT6A 3VXME 5I30L 1YN7A 5TF1H 5EWIH 3N50A 4LRIA 1SM3L 2W60A 4LVOC 1MRFL 4ZYKB 1D9KC 3C08L 4XXDA 1N7MH 3RIFF 1AD0A 3NIGF 1KNOB 1X5LA 3LPWA 3STZA 1HKLH 5HGAA 2FWOB 3ESUF 2IALB 3KNBB 3S5LG 1CU4H 2FNBA 1SVZA 2JK5B 5BQ7A 4LAQL 2VLKA 1K3IA 5KAQG 4UILH 1JYWA 1IAMA 3TNNA 3MTRA 4ZUUB 5KS9B 4N9GB 3BJ91 4D2NA 1JK8A 3G5YB 3I6GA 3NIGE 5B22A 3CZFB 2G9HB 4GBXC 5K93A 3L95B 2XQYG 4MJ5A 4KMTH 5BW7A 2C1OA 1TITA 4G8GA 1MIMH 4PYGA 5F7NC 2M2DA 2JF1A 3V4UH 4IRJC 2CRYA 3SO3B 5F9OL 1RHFA 1DL7L 3VI4E 1DQJA 3QEQE 1VFAA 5E94A 5HYQA 4ENED 3F7RA 5D8JL 3C60C 3PQYE 4UT6H 5HVHC 3KAAA 4KJWC 4RMSA 2DDQH 1DSFL 4D0BA 1JPFB 4MYWB 1JPSH 5DRNB 1SJVA 3LKRB 1I8LC 2EDEA 4MNGB 2OSLA 3P77B 2NCMA 1JPGB 3CC5B 4Y5VA 5IBUB 4TVPE 4PBWD 1T5XA 1JGVH 1I4FB 4JKPH 2YD1A 3ILPA 1MNUL 4LVOB 4R90L 1D9KB 1VFBB 4LHQB 4IOFD 2QSTA 4WV1A 5FECB 3ARED 4DGVL 5KSBF 5DJ6B 2DQUL 1X4YA 3OKNB 4XH2A 3T0EB 4HPOH 1P69B 4D0DB 4F7EA 1IC5H 4ODVL 5D1ZD 1MWAH 5I17B 3RUGF 3LH2L 3LS5H 1C5BH 2MQ0A 3CAFA 5KANG 3FB6A 3OJDB 4GBXB 5TDPB 4TTDD 5LG1A 3V0VA 3UYRL 3RY6C 2CLRA 1HHJB 2I5YL 3QXAB 4X8JA 4PGEB 2VUOA 4M43L 4L3ED 1OPGL 4WEUD 4DFHA 1U2HA 3A6CL 2LAGB 4M6NL 4Q9RL 4XPTH 1G9ML 5J6HA 2AJ3B 3BDXA 5FGBA 1UA6L 4WWKA 4TTGA 3UXFA 3KJ6H 4NUJA 4G5ZL 1R6VA 4HIXL 4K2UL 3UZQA 4P4KD 5HVHB 5ID1B 3X3FL 4JVWA 3F6LA 3IDMB 4UQ3B 1RJCA 3WFBL 2ESVE 5ACZA 5T5NG 2NTSP 3MNVA 4L1HA 4XP9H 1NKOA 5IOPB 5E56A 4CDGC 3X12A 3U46A 3W5NA 1B4JL 1FFPB 2O5ZL 1NBZB 1BF8A 2X1XR 5EU7C 1BVKB 3QEQB 1HDMA 3TBSB 4RCAA 3MQIA 4DJMA 3ZT7A 2B4CL 5TJWK 5MERB 2N1KA 4PJGF 3OL2A 5FF6A 4XNXH 4PJDA 4G9FE 4OCMC 4C58B 5IB4A 4Y4KB 4LARL 4C56E 1KIPA 4D8PA 5A43C 1RURL 4C83A 3WN5A 3FQWA 2HVKA 1LEGB 1U8PB 4WU5A 4MXVE 4PJ7E 4YZFF 3D69B 3R1GL 4LIQL 3TO4C 3HZMB 1G6RB 4JO4L 3RIAF 1I3RB 1JWMB 3MLXH 1V3MA 3AREA 5C6WH 4E41E 1CXIA 1RUMH 2D7TH 2DIJA 2APTA 3LKOA 5ELIA 3RWJA 5AUMA 2DQTH 5HDLA 5KSBB 2FB4L 5AYUL 3RZCC 2Z4QA 2VZ1A 5D1ZA 1JN6B 1BAFL 3QQ4B 3MOQA 3REWB 1IRAY 1DVFD 4LOUD 3LEVL 4TSAL 3RUGB 4U6XA 3ULVD 2OK0H 4NGHH 5HGDB 4EDWH 1R3JA 4L3EA 1W0VA 5IQ9B 5B4MD 4JJ5B 4XC3H 1P53A 3MROB 2NW2B 3NTCL 4U0QB 4ZAKD 4QT5A 1FLRL 2Y36L 3S6CA 4WNQA 5D2NE 3WS6C 1JZ2A 4OCYH 3O6LH 4MDJB 4YPGB 2E6PA 2F5AH 5EBMA 3FB5A 3U36B 3PV6A 4ODXB 1HK6A 4HLZH 1IARB 2BY2A 1UH3A 2A0LD 1EEZB 4XZUA 4C4KO 4DVRL 4FXGB 2X4SB 1HSBA 2P24A 5HI4C 3L3IB 1RZIA 1MREH 1T21B 3IFPB 4OCRH 3PWNB 1B6DA 4RFEA 2CD0A 1R3KA 1IAIM 3WNMA 4Y4HC 2FJHA 4WTZA 3CVHL 4P23D 4X6CE 2MTPA 4F57H 3SCMC 4DOHE 5JR1L 5E2UL 5C0AD 4NQCD 1A1NA 1PZ5B 3IS1X 5F1IB 1T0PB 3WKMH 3PE9A 4F7PB 4JM4L 4G9FB 4K3DL 2AQ1A 2VITA 2CRMA 4GO6B 3T65A 2NY5L 5CJOH 1ADQL 3MNZA 1UM4L 4Z7OF 5D7KD 4XNYH 3RZCB 2ED7A 3DNKA 4PJGB 1KJ3H 1FL6A 3MCG1 4J23A 5T1KD 5BOPA 1I7ZA 3ROOB 1MH5B 3TH2T 3CZJA 1QFPA 1NGZA 2DBLL 1XGRA 3DPBA 4I4WB 4DGYL 1ORSA 1FLTX 4NWUH 3VRJB 1CLCA 1QSED 3GJEA 4Z7WE 3JBG7 4B5EA 4PJ8C 4GUPA 5D6DA 3QG7H 3IFNL 4AEIL 2H1PH 5C7XL 2E6QA 4PJXF 1N64H 1CDIA 3QPQC 4KXZH 4LPWA 4OZHA 2WAHA 3OKMB 1OAKH 1ROWA 3FB8A 3FO1B 1KPRA 3QO1A 1PD6A 5C08B 1KIRA 3UZVB 3ZSTA 4G6AD 1E4XI 2AK4E 5JW3H 4EN3A 3MRDA 2IAMD 2Y07L 4EJ1C 2X4TA 3DURA 5BVPL 1EVTC 5HBBA 2UYLB 4K7PH 3RWFB 4YHYC 3QJHB 3ZKXB 1A9EA 5HYIA 1XF1A 2AEIT 4HF5L 2X1OA 3I6KA 5EO0A 2W1NA 1OAQH 3U48A 1HNFA 1WEJL 1IGCL 2GAZB 1WWAX 3DVNB 4L8CA 5E2JA 4GMSL 4P23A 2HJFA 4X5XA 3CK0L 4KH2A 3ZYIA 1A7RL 3BGMA 4JB9H 4J7RA 4MDIA 5C0AA 4NQCA 3IF1B 1J0IA 4JN1H 2W0KA 4P57B 4EI5C 5J13C 1HHGB 5DUPH 2DQIH 3Q3GA 2PO6C 4PJ8B 1MUJA 1QG3A 1J1OH 1GZPA 1CVRA 2QADD 3OAYH 4FZ8L 1K8IA 1SYVB 3T09A 5C09D 4JPWH 4ELKB 4OFYD 1NCBH 2PYFB 4S1QH 1YY8A 4U6HB 3T3MF 1CXFA 1QEWA 1RU9L 3IXAB 5T1KA 3BGAA 4Y2DB 4J3VA 3MRFA 4IMLB 3EJJX 2ITDB 3OXSA 5ADOL 3MRJB 2FZ3A 1F58L 3RJQB 3HC3L 4LGRB 1U8NB 2D03L 5I8KH 1QSEA 5DLMH 1VGKA 2ATPA 2V7HA 1CFBA 2IPKB 3QQ9D 5EZIH 1A1OB 4YHYB 5I0DA 1N6QH 2JB5H 5J6GA 2BRRH 2IPUG 1KEML 4U05A 5IBTL 5C0IB 5MP6L 2RFXA 3RNKB 2FECI 1SVCP 4NQTA 5EBGA 4R8WL 1JVKA 3O3UN 1T20A 4PJXB 5JXAL 4M6OL 4RRPG 4G80A 2KZ1B 1AXSB 4UV4L 2IAMA 5GRYA 5E03A 3R0MA 3RWHA 3MV9B 4O2FA 2AABL 2VAAA 2WIMA 5ABDE 3FRPG 2HTLD 2HVJA 2EEBA 3ZE2F 4LLWA 1KB5A 3U30C 5A2IH 1S7TB 4GSDL 3W11C 3R06A 1J05A 2UUDK 4BFBD 2EEDA 5E70A 2BHZA 4KROD 1IL1A 4NHCH 4JY5L 1PLGH 1S3KH 2BRQA 4UDUB 1AO7E 4PG2A 3T0XA 1JZ6A 3MLPA 2UVEA 3EYFA 3PWLA 1AQKL 3HKFA 1UYWH 3LSOA 4HUWB 4K3GA 3UC0H 3F7VB 4GKNA 5KSAD 3EOBB 5DJYB 3CFEB 2A1WL 4JN2A 3FO0H 1KENL 3BP6B 1UWEH 2YPLB 1F42A 5CKAA 2YC1B 5F7LB 4HBQA 1ZLWK 4PJ5D 3ULSB 4OZFH 4GAYB 3HE7D 4IDLA 2HFEB 2XXCB 4K55A 4Z7VF 2X4QB 3FCTA 4IRSC 2ADJB 2MNUA 3BH9A 5CS7A 1S9WA 3DX9B 2X4UB 4PRBA 1XGPB 5C09A 3WDHA 4OFYA 2F5BL 3REVA 4N0UE 3H42L 3QRGL 1S9YA 3TBTA 3TIDB 5CSZA 4YIQB 3TNMB 1X7QA 3S5LA 1EMTH 4J8RA 2CLZB 1KCVH 1CQKA 1QSVA 4BFEA 4R97C 1A6TB 1CXKA 1Z9MA 2SEBB 1JYVA 2BC4A 1DDHB 2APWA 2I60L 2ARJQ 5DHYA 5F72S 4MXWL 3KLAA 3ZL4H 3U30B 1S7XB 5HHVH 5KSVA 3BP7A 4NO0B 4UB0H 1AE6H 1HI6B 3O0RL 3T1FB 1MHPL 1BZ9B 3LS4L 2HMIC 4QXTA 2EDYA 2IPUK 5DQDL 5DK0B 3T04D 4HZAA 4NRXA 1SMAA 4HH9A 4N0CD 3LPFA 2B1HH 4G7VH 4M1CD 3DRTA 3OKEB 4F7CA 1WBZB 3BP5B 1TVHA 3VFRA 1ZLVK 5IVZA 5ICYA 2E6JA 4GMTL 5FGRA 5I1CL 5GPRA 5MEQB 1QTYT 4MQXC 1DE4B 1NAKL 4HIJB 4QO1A 4HAGA 4YDVB 5KN5A 1I1YA 3MR9B 3IGAB 3FQXB 3UTZA 1AO7B 2NY0D 4OIIL 4IRSB 3ZDYF 3UTTD 5FV2A 1F8TL 4APQA 5INCA 4JQXC 1M7IB 1AIFB 4ZFFA 4P5KB 12E8L 3U9UB 2YK1H 4PBXA 3QULA 3BHBA 5DMKB 4RA3A 1OT2A 1IZKA 4PTTA 4NOBA 3VFMB 3AMLA 1OGTB 5KSAA 2VLKE 4OIBA 1PZUB 3DI2B 2OZ4A 1Q9OB 4LCYB 1PFCA 1Z6JT 2I9LA 4R97B 1IBGL 2FX7L 4PJ5A 5FUCC 4PJFA 3HE7A 2GTZA 2V7NB 3KGRA 4G8GE 5E1AB 3S35L 3GMNA 1F3DH 4NKQB 1JFQL 2ICWB 4N0UB 5IVOA 4DCQA 4G6MH 4L9LC 5FYJD 3E6FA 1S8DB 4Z7VB 2BMKA 4AEFA 2VQUA 4QWWC 4XTRD 4F2MA 5D9SA 2F54B 4LF3A 1B4RA 4JY6A 3RVWD 5ADPL 4KUZL 4OCWL 2A6IB 2JIXB 1RV6X 4H25A 3PDGA 1RK0B 5JW4N 3NCJH 2YMXH 3P0VH 4MLIA 5IIEB 3SE8L 1I1CA 5GS2D 3WFDL 8FABA 3SDCC 4RIRA 1HHIB 1OAYL 1SBSH 2WUBH 4FQCL 5FB8B 4PY7B 2D9CA 4PGCB 1AI1L 4M6ML 3L3JA 1KCLA 3TA3C 4NHUA 3VXOB 1KLGA 1T1WB 5AYQA 3MJ7B 4KK6C 1WBXA 1P7HL 3GBMH 3TT1L 3WO4C 1H3GA 4HCRH 4XCCH 1YNTB 2NX5B 3BE1L 1U58B 4JO3H 3K4AA 5EZOH 4FP8H 4WI9A 4XCEA 4NT6B 3P9MA 4WFFD 5I8OL 3DECA 1RSFA 4XX1E 4O4YH 4LAJH 4DN4L 2W60B 4KPHL 3QG6A 1QBBA 3HLAA 4YXKH 4XXDB 1AD0B 1IAII 2VXQH 5AZEL 5I0ZA 1RAMA 4B53A 1FYHB 3EOTL 3STZB 3UTTA 1WICA 1YEIL 1F13A 4DW2H 3CXHK 4X7EC 4L9LB 1ZOXA 2NMSA 1OW0A 5BXFB 3TJHC 3GSOA 3P4OA 2EDFA 3P40A 3BN9C 3OG4B 3EJZD 4P2OC 3ARBA 3X11A 1XF4A 3P11H 3GI8H 1JK8B 3I6GB 4OBSA 4RDQG 4K23H 2Q7YB 4X4MA 2ZUSA 3G9VA 4AY0A 4BJLA 4G8GB 3MXVL 2AAVA 1I85A 5CBAB 3S4SG 4LFHD 2NY6C 3JSSA 3SDCB 1YNKL 3L5WB 1LE5B 4PB9H 5ID0A 4F9PA 1F6LL 2R2HB 3W82A 1S7WB 3VMPA 4LLVA 5A40E 1KXTB 4U1IA 2NY7H 3EOYG 2W38A 4XMLL 3TA3B 2G5RA 2Y06L 4J2XA 4MHHI 1GXEA 1SJXA 5CWSB 1KJVB 3RDTC 4ZTPL 3WO4B 2XN9B 1TCRB 3A67H 1MEXH 4OUUA 3HS0A 1EBAA 5L0QC 1S9XB 3MREA 1D5ZA 5DEGA 3MUY1 1IEAB 2FATH 2VXUL 3CH8A 3WNLA 1XGQA 4KRNA 3RNQB 3PWPD 4U1KA 4EZMA 2R0KL 1JWUA 3JV4A 1EVUA 4FFVC 5BO1H 4KI5D 3LIZL 4WV1B 4Y19B 4HIEA 2BNUB 3TO2A 3O2DL 3HPJA 1HQRA 1I75A 4JE4B 5B38B 3M1BB 3PV7A 3FONA 4JFYA 4XH2B 5FHAL 3PP4H 2JELH 2X4OA 2H2PC 2VMFA 4F7EB 1NDMA 1UCBH 2NY4C 4P2OB 5HHMD 2QEJA 1S7RB 1B0RA 2H32H 1M71B 3AM8C 3UO1L 3HNTL 2ZCLL 4H8WH 1J88A 1RZ8A 4EI6B 4HEPG 3CU7A 3BPLB 2F58H 4X8JB 3SO5A 1FORH 4G6JL 2LE9A 3NCYP 3VCLA 3V4PH 1J12A 3PIQB 3FQTA 4L3EE 1FIEA 1CD8A 4WWKB 4M62L 3E3QE 4AG4L 2CK0H 4J3TA 4NUJB 1MFBH 3O6FC 3W9DA 1BBJA 2H6PB 2ZP0T 2CSPA 3NOIA 4X9FA 3RDTB 5FOJA 1EERB 5ACZB 3M17A 5L0QB 2W65A 1P2CB 3QYCA 3X12B 3U46B 4GLRI 3WFEH 2YN3A 4UT7H 2V2WA 5IMMA 4BUHA 1HEZB 5CEZH 2CDFA 1IKNA 3QCTH 4MWFB 3LN9A 1X5FA 1A6UL 3MFFB 2DLFH 3CSYA 2VZ3A 5HI3D 5FF6B 1R5VB 3TCXA 1VACB 2HKHH 1G7HB 5JIKA 4OLUL 1B0WA 1ZHBB 2P8LB 4D8PB 1U42A 1ZAGA 2NY4B 3WN5B 3FQWB 2JJTC 1AH1A 1DLFL 1U0QA 2MWCA 3JV5A 4WU5B 5IFHL 4WUKL 3D18A 5KJRL 3ARDD 1F3JA 1KBGH 3E6HB 5JUEH 3PWPA 3EYQD 3HUJF 3KS0J 2J3SA 3QSKB 2R0WH 3AS1A 2B5IC 1VFOA 4Z95L 1RUQL 1KN4L 2FEEL 3OGCA 3QIUC 1T2JA 1ORQB 4JGMA 1CG9A 1X44A 2PW1A 3RWJB 3W2DL 3MCLL 5DEFA 2LABA 5B8CC 4JFOB 2A38A 3O6FB 2Z4QB 4U1JB 5EU6A 1CGXA 2NLJA 4YHZH 3HR5B 1SEBB 4M7LT 4OZHE 1A6WL 1WGOA 1A3LH 2LU7A 4Q9BA 3QA3A 5IB5A 2XKUA 5J1AA 1VKXB 1KTDB 2HRPH 1CLZL 1NCTA 3EZ8A 1TCMA 4NQUA 3ZKMD 2VQ1B 4HEME 4QT5B 3ULVE 3PL6C 4CVXB 3LN5A 3GKWL 4RSVA 3LAFA 4UZGA 2X05A 5EBMB 3C8DA 1V7NH 3EKCA 3PV6B 3NCCB 4M9PA 4UIKL 3DO7B 4KJQC 4B50A 4WW1B 1F4XH 3ILQD 2EKJA 3MRIA 5CZKA 2P45B 5GS0L 1LGVA 1U41A 2I27N 5F6IB 1DQQB 1OM3H 1CDGA 4O2EA 1WIUA 1C7TA 5BMFH 1ACYH 1PAMA 2HKFL 3TESA 1ZHKA 4RFEB 1R3KB 3MXWH 4Z8FH 3RX8A 4WDIA 2FJHB 5DZLA 1LNUA 4F7TB 5B3JE 5F7WC 4G8EB 1TPXC 4UNUA 1A1NB 4TYUA 3W81A 1AD9B 3MJ8B 5E99H 3MOAH 3GSWA 5C0AE 3QIUB 5IJKC 1U9KA 3WFHA 2DQGH 1UM6L 3BMWA 1R24A 1SEQL 1F00I 5I71C 5B8CB 1U8IB 4YX2L 5TF0A 2QTEA 3D2UB 3QNZA 1FL6B 4XAWH 2Z35A 4KHTH 1WV7T 4YDKL 3SJVD 3OX8B 4KDVA 5D7KE 2P8PA 4WEBH 3ARDA 4N8CL 4KJPC 4YFLF 1GGYA 3IDXL 2CRZA 5T5FL 5IKCA 3PNWB 5E2VH 2XZQL 2Q86B 3VU2A 5J7CC 1B2WH 5CJQH 4PRNB 1Q0XH 2J6EL 4FQXC 4GUPB 3PL6B 5ECJE 3EFDL 1U95A 3HUJB 2JJSC 1CR9L 1JTTA 1QSEE 4TPRH 3T1WA 2BX5A 3T4AA 1YQVL 4JHAH 4YXLH 3VD4A 2C5DC 2DQEH 1SBBA 3K46A 1FL3A 4YC2B 4M1DL 1A7NH 2E7MA 2V2XB 4OTXL 5DVMA 5E1HB 4J3WA 2YKLL 5CKGA 3AUVA 5IHLB 4HS8L 5HD8D 4MAYD 4EN3B 1BQLL 1MJ8L 3NIFF 2GJ6D 3DARA 1CL7H 1JZ4A 2RHEA 3V7MA 3WDJA 3QDMD 1A9EB 3DV4A 3QIBC 4JGJA 1E0OB 5I73C 4LVEA 5I75C 3I6KB 4H88L 1AKJB 2H8PA 3HB3C 1JYNA 4LPYA 4QRSA 3RTQC 2Q3ZA 4XT1C 4XGZA 4Q7DA 3RL2B 3PHQA 5K9JH 2V6HA 2VN4A 4XP5H 1EHAA 3GZKA 4P23B 4X5XB 5JXEC 3DGGB 1QYGH 2QSCH 3DSNA 3BUYA 4R2GC 4JO1H 4MDIB 5C0AB 1CF8L 3B6SB 3HMWH 5F1NA 5CJXA 5HYEA 1U8OA 1HH9B 1UADC 4FQXB 4JFEB 1MUJB 2BERA 2XA3A 1K8IB 4UI2A 4K71C 5CHNB 5I1KL 3ZHKA 2JKXA 1JRHL 4RZCB 5DJAA 4JFXB 1NGWA 3SDYH 1KIUA 1NCCL 4JFPA 1EX0A 5C09E 3SJVA 3C5ZD 3SEPA 1X4ZA 5TQ0L 4OB5L 5C0DB 3D3VB 2Y5TA 4OI7A 2FZ3B 1A6PA 3V7AE 2Z8RA 5DHXB 2W9LA 3I75A 4NZDA 1RI8A 2YSSA 5DD0L 4HW6A 5IK3B 3QUXD 1GHFL 3QI9D 4A6YH 3AMKA 5I73B 2NTFA 2YXFA 1TQCC 3MLSL 5I75B 1N5YH 4RBPH 3BP4A 3FMGL 5DT1L 5ETUB 3RTQB 1IT9H 2W0FB 4H8WC 1A7QL 2J8UA 1RUAH 3KDMA 5BVJA 1BIHA 2PCPA 4MAYA 5EDXA 1NDGA 2W9EH 3G6AA 3D5OF 4XP1L 4W4NA 4KZEH 5DRXA 3KPSB 1VADA 4GRMB 1D7FA 4F3FA 3LVEA 4HZLA 2HVJB 1NGXA 4GAGH 1ZSDA 3ROLA 1FNEB 4WJ5A 4K71B 4X6DA 4I1NB 4FQPA 1IM3A 2KPNA 2DQFA 3PWLB 3IJSA 4O58H 5DYOA 5H35A 5F8RC 1H8OA 4NQEB 3SE9H 4GKNB 1WLHA 5HTSA 4L5FL 1QFWL 4O02L 3QUMB 1ZMYA 2BVYA 3P4MA 4LSVL 1T66C 1LO0H 1NGPL 4NQVA 5IEHA 4S11A 1KXVC 4S1RH 2BSTA 3TZVD 1KG0A 2I9TB 1A1MB 1J7VR 1XZ0A 2DQJL 1ZA6A 4UTBH 4PJ5E 3BH9B 1MHHA 1MJUL 3G5ZB 4PJFE 4BYHA 4XMPH 1IKFL 4TULL 5C09B 4YHNA 1W72B 1T4KA 1TQCB 1G7PA 5SWSD 1BIIA 4DVBA 5I1LA 1S9YB 3ESVF 3C5ZA 4BQ9A 2H2SD 5FYJU 5E08H 1BX2B 2XACC 4XAKD 3S5LB 3S34H 4DKFH 2OJZH 4PRIB 1J5OL 2DWEB 3F58H 2AJYL 1LVEA 4Q6IA 3A6OA 2ED9A 2Y6SD 4BFIA 2BC4B 1OTUC 1QBML 3OB8A 4U1LA 5LXGH 1FL5B 1ETZA 1VESA 5DHYB 2DKUA 3NN8A 3QUXA 3QI9A 1H5BC 2VDKL 2Y1VA 4YHKH 1EDQA 1Z3GL 4GRLC 5IB2A 1G7IA 4F9LC 2EH8H 2F8XC 6FABL 1CDHA 4KTDH 4PRHD 2VXSL 5JMRA 1UJ3C 2XZCL 1SMOA 1NEZA 3VI3E 3QUZC 1I8IB 4HH9B 3WIIL 4J3UA 3DRTB 1JL8A 2QQLL 4WUUB 5E6ZA 4GKSA 1RUKH 1SJEA 5EOQL 4IJ3B 1FNSL 4DEPC 4ZG1A 5A3IC 5F88A 1UJTA 5IFAL 3UTPD 1S7SA 3DYOA 3NBNA 1CFNA 3UTZB 3MRGA 2D7PA 2OQJA 1FRGH 3B9KD 4APQB 5INCB 3WXWL 1RZKC 1EV2E 2DN7A 2CIKB 3UTTE 1ONQB 3U7YH 2E7LC 1MCPH 2IAND 1E4WH 3C5SB 4PTTB 1BBDL 3O2WH 1A6ZA 2HFGH 4OM0H 4UIMA 1LEIA 2B0SL 4H1LG 3LQZA 1PX3A 3GSVA 4X4ME 2YR3A 1CGYA 4HWEH 4FXKA 2GTZB 4NZUH 3TZVA 4MA8L 5EIVA 1J11A 4JEGB 1B0GA 3MLYH 3GMNB 3P30H 4G8FA 3TPUA 2DJSA 2VLLA 1BPVA 3MLRL 4E0RB 4GRLB 3E6FB 2ZOLA 3OZ9H 3MLVH 1KC5H 1EUUA 1CE1L 3HMXL 2BMKB 5SWSA 1ADQA 1P7KA 1PSKL 2EE9A 3U82B 3PDDA 5D9SB 3O4LD 1NH6A 1QKZH 3GI9H 4EBQH 4ORGA 4JY6B 2O5XH 1YNLL 1OB1A 4ISVB 5CLWA 3UMTA 4PJCF 4P5TA 3KR3H 1YECL 1O5DT 1JHKH 1JI1A 4Z0BL 2ZJSH 4RAVA 5MHSD 8FABB 3VXUD 1FFRA 1P5UA 2HP4A 4YEEA 4YHLL 1WK0A 3MCKA 4K8RH 1ZVHA 4M93C 3F8UB 1HN1A 1EPFA 3O3AB 4RAUB 1GRWA 4NPYB 1J8HB 4I3SH 32C2B 4PB0L 2R4SH 3JWNC 2B7DT 3ALWA 4PRHA 1RJYB 1G6RL 3GBNH 5F96L 2ZCHH 4JFZL 4NQDD 3OKOB 3TBVB 3QH3B 1FZOA 4ZXBD 1YUHA 1A0QL 2OL3B 1HSAB 1MFDL 5F7UA 1YPZA 3AY4C 3L7EB 1T1XA 3KPQB 4X4ZA 4KKBD 3DSFH 3QG6B 3HLAB 4WFFE 3VWJC 3ULUD 5DI8B 3X3GH 3UTTB 4QXUH 2EYSA 2F53B 3B9KA 4OD2A 3I85A 5LGJB 3KVQA 4PY8J 2FDBP 4TRPL 3ALPA 2PYED 4CADA 1QR1A 3ARBB 3LB6C 4J12A 1J9CT 4JCMA 1GJIA 4KFZC 5GGTL 3B9DA 4OFKA 1FBIH 4PLJC 4U1HA 2FLBT 2X41A 2VDQH 1RZGB 5TE7L 2ZSWB 5ID0B 1WBYB 4M3KB 5AWNH 3N1QC 3GDBA 2DMBA 1MJJB 3NFSL 4CJ1A 4M93B 3VXNA 2BNRB 1N3NB 4RISH 4U1IB 3SDDD 4HX1A 2B2XL 5EFIA 1U8KB 1YEHH 4XVUD 1JI2A 1P84K 1HHHA 5C0GB 4M7JL 3O4LA 3S88L 1NBYB 1NCDH 5D70L 3MO1B 3MREB 4WU7A 5DEGB 5GJSL 4RGOL 4YNYB 3KWWA 1P4IH 3VH8A 3CDYA 3EYUH 5BS0D 3DXAD 2XYCA 2GJZA 2VAJA 4BUGA 2VL5A 1NAMH 5GISH 1XGQB 1L7IH 2M1KA 1FDLH 4U1KB 5HHPA 2OCFD 1GIGH 5GRUH 3IKCA 4PYHA 1OQOA 2IFFH 4PP1D 3VWJB 2ZOKA 3PWPE 4MVBD 3SGJA 1P6FA 3CLEH 2HN7A 3HPJB 4S1SH 5E8DL 3ZLQC 5C0RL 3VFUB 4LDLB 3FONB 4JANB 4KI5E 4UINL 3TVMD 1U6AL 3L5XH 3UP1A 4WW2A 1AXTH 3HFMH 2F19H 4GQPH 4NQDA 2NYYD 2XWTA 3G08A 2XA8L 1L0QA 4ZXBA 2HT4D 4KVCL 1PKQA 5EU4B 4I0KA 5EU6E 5HHME 1OAZL 4NJ9L 2WUCL 2CR6A 1X5YA 1WQVT 4JO2H 2UV3A 4AL8L 3ZT5A 4OM1L 1JWSA 3BAEH 4PG9B 4X6BB 3BQUD 1KPVB 4GXVL 1DTUA 3QZWA 3FQTB 3PWVA 4G6KL 3GMLB 1Q94A 3NAAH 3SDXA 1SJHB 1XFPA 4QRPD 5DJ2B 5L2KD 1E6OH 5CILL 4RA0C 3WFCL 2PYEA 2RCSL 2AI0L 3QEHB 3KHQA 5I1HL 1P1ZB 4S0SD 3TH4T 1JNNL 4LKXB 2W65B 4XVSH 4JPVH 3BH8A 1QVOA 3CIQA 5HJ3B 2F15A 2H3NA 4YHIA 1ZS8B 5JPNA 2V2WB 1R5IB 3L7FA 4KKLD 3EDJA 5EO1A 3MUGA 5GJTH 2NY1C 3EO0A 3SDAC 1II4E 1LK2A 4P48A 3SDDA 2HH0H 3NCFB 4JQIH 1MIEL 1QR4A 3QQ3A 3C5JA 3WD5H 3RVTD 3CSYB 3U0WH 1IC1A 1FZMA 1ZWIA 3RWCA 4LQFH 2AEQL 3VG9C 4X9BA 2IWGA 5L9DH 4JG0L 3ES6A 3V6OA 1QNZH 4RX4D 3JZ7A 5DD6A 3VFPA 5BS0A 3DXAA 1L4IA 1F3JB 4OCSL 4NN7C 4TOYH 1KB9K 1QA9A 4MJ2A 4QTHA 3RWGA 4XC1L 5ISZD 3DX8A 3AAZA 3IU3B 2JCCA 5E6ID 3ARXA 1XGTA 2O61B 2IMMA 3S37X 5JDSB 3TVMA 4RGND 1C5DA 4I18A 5DJCB 4QF1B 1BD2D 4BH7B 5EU6B 1QO3A 2OTWA 4JCLA 4QHNB 5HHMB 3RAJH 1QRND 4KY1L 4UILL 1FO0B 4HAFA 2NLJB 4NSKA 3BPCA 4K3EH 3UJIH 1XGYL 2VH5L 4KK9C 4HFUH 1MLCA 1U93A 4NC0B 4XMKH 4KMTL 2R2EA 5E9DA 4QOKD 5IB5B 4N8VA 1L7TH 2A9NL 5IVXA 3OR7A 5FOBA 3BQUA 4NBYB 2CLVB 2NY1B 4IBLT 4E5XA 1W0WB 3CLFL 4OD1H 3SDAB 1K4DA 4Z78A 4HK3J 5EH1A 1W8OA 2WWMD 4MCYA 1TXKA 3WFZA 4MJ6B 1QLRA 5GGSB 4QRPA 4OZIA 5L2KA 5C9KA 2X70A 4XNMB 5DK2B 3K8KA 1IGJB 3CDFA 2YPVL 3VG9B 1GZQA 2BJMH 4UT6L 1IC7L 3RVXD 4XP6L 4CVUA 1U8MA 1ZHKB 2XNAA 3PHOB 3U4EA 1FAIH 2EKSA 4WDIB 1K9TA 1LNUB 1KIQA 4YUEH 1JPSL 1NL0H 3KPLA 5ALBL 4NN7B 5EU3A 1LDPL 2OP4H 3JTTA 2HJKB 2PR4H 1KLFA 1MCKA 3K4DA 4Z7UF 1EJOH 1RHHA 3KXFD 4JKPL 4ZD3L 5DXWA 4KZDH 2DI8A 4PLKC 2R2BB 4ZNEA 3VFGH 5T1LB 3GSWB 3D87B 2QL1A 5D7IA 2RIKA 5GRZA 1BM3L 3FQNB 1NCNA 3WFHB 5F44A 1FG2A 1KGCD 1JTOA 2YWZA 4FQ2H 4LU5L 5FO9A 4G9DA 3GMQB 4OAWA 4L8SC 2HRLA 3QNZB 5JA9A 4P46C 2Z35B 1DLHB 3VGAC 4L4TD 4RX4A 3FFCA 1OT1A 3D39A 1HNGA 5L6YH 5HHQA 1MWAL 2P8PB 4LMQI 4AMKL 3DO3A 4FQIL 2NR6C 3SJVE 5IKCB 2FO1A 3BYTA 2XT1B 3IKKA 2VZTA 1F2QA 5ISZA 5FO8A 4CVZA 4GG8B 3GHBH 2C1PB 1NC4D 4JZJC 5E6IA 5JOPD 5B39G 4FZEL 1OTSD 3H9SD 2O5YL 2BVEA 2GEEA 1G9NH 5DWUH 2WINA 1YEJH 2XTJC 4IHOB 4NQXA 1U8HB 1D3CA 1UWGH 2Q87A 1X6NA 1RJLA 4HIIB 1BD2A 4BH8A 1Q1JH 1QRNA 4YEFA 4KK8D 5F1OB 1LE9B 1H3XA 1I7RA 3MRPA 4MSWB 5IMOA 4WY7L 2FJFA 3UDWC 2J8UE 4QOKA 1FFNA 2E9WA 4HD9A 4X5WA 4NJAL 4M8QB 4R26H 1YN6A 2P8MB 3CVIH 3G5XA 3DV4B 2JJUA 3DI3B 4X6DF 5FDYA 3T4YA 3QFJD 3LKPB 3OHXA 5B3NA 1S7QA 1XMWA 4F37K 2H8PB 3GSNA 3BVNB 4BSWA 4Q2ZA 4L8SB 4P3DB 5HDBE 1U3HC 1CGSH 1CFSB 4EIZC 4X6DE 3OTTA 3KPNA 1NJ9A 5TE6H 1CIUA 3ULVH 1HQ4A 2YD9A 1KN2L 3TFKC 1TNMA 1WWCA 2VKWA 2BVUA 1IZJA 1DBMH 3NFNB 1FE8H 3EFFB 3KXFA 1C5CH 1MLBB 4DQOL 1UXSB 4QHMB 4RNRB 4Z7UB 3RA7L 2XTJB 1EK3A 2W59A 3O11B 4JHZA 4NNPH 3W0WD 5K59F 3VGFA 1AXIB 5IMKB 4NCDA 4L4TA 4X7SL 1SYSB 2W0PA 4OLVH 1NBVL 4JFQA 3QEGH 3W9EB 2NXZD 2FYYB 1JPTH 1GYAA 1HH6A 4RDQF 2VDML 2R9HD 2VWEC 1PG7X 2ITCB 2R69H 5C6TH 1J0KA 4YFEA 1FFOA 1NC4A 2C3WA 2QQKH 4NGHL 4EDWL 5CINH 4EUPG 1ZGLP 2X89D 5ENWB 3H9SA 4GW1A 1AJ7H 5TE4L 1F2XK 4X98A 5CMAA 5F89A 3F12B 1NCUA 5HVWA 1T03L 3MLUH 3O2DA 4LIQE 1E4XH 3JXAA 5MEOB 4TUOA 3O6LL 1C12B 4OGAC 1KJ2H 3FN3A 3QHFH 4QTIL 2R29L 3X14A 3BXNA 3RBSA 1ZLUK 3BKCH 1P9MA 5J1SC 4P3WA 1S7UA 5J12C 5DHVA 5I1DA 1MREL 4PS4L 1QBLH 3G6AB 4OCRL 4NO5B 1S9VB 2ZCKL 3GIVB 4XPGL 1A22B 2X7LB 3TN0D 1MI5B 2MQ3A 4BZ1H 3WXVL 4NQSB 2GSGA 3H3PL 3P0YL 2ADGB 3QFJA 3ROLB 4ZDHA 4DKDC 5GS1A 4PGBA 3SGDH 5D71H 4DKEH 4Z77A 5GZOD 4LCCC 1MHCA 1MOEA 3I02A 5FDWB 4QY8A 4X6DB 3LQAH 4F7MB 5CJOL 1F4WL 2DQFB 3TPKA 1JCKA 1DBKL 5GS0D 3IJSB 3CFKA 2FEEI 1DQML 3GIZH 3VFVA 1NAMB 4JM2D 1KJ3L 2VO5A 4POZD 1U36A 3OMZA 1HWGB 2D9QB 2Z31D 3TBWA 4R0LA 4ETYA 4QYOA 3K7UA 2ARWA 5I1EH 5IESH 1U92A 3D9AH 5CBEA 4V1DD 3PHSA 4MAUL 4X6FA 1XZ0B 4FQHB 4XCYA 1N6UA 3ARGD 4NWUL 3O41B 5KTEH 1ZA6B 3AVEA 2GUOA 4HT1H 2YPKA 5DGRA 3E2HC 1MCWM 5SV4A 3NIDF 5DGQA 3W0WA 3QG7L 1T80A 1GH7A 4K94H 3AB0C 4DVBB 1DBJL 3FFDB 3MRNA 2AEPH 1IC4L 3V52H 2GFBB 1ZLSH 2O26U 5SWSE 1WFUA 1OAKL 1UB6A 2PTTA 4NCC2 1H9VA 1N59A 2C3HA 2OLDA 3EO9L 4Q6IB 5J12B 1H3TA 43CAA 4LHUG 2EH7L 3L3DA 2P4AB 4RFOH 4ENEC 5F3BA 3WS3A 5BJTA 1DANT 3EHBD 3K2UH 3OKLA 4R7DA 2X89A 1ETZB 3BEVA 2VDOH 4K7PL 3NN8B 3M8OH 4CN1A 3RVUC 2ZPKL 1V3JA 1X5AA 1ZHNB 3IU4L 1ES0A 3G6DH 4XBEL 5EC1B 5INDB 4LCCB 1AQDB 4TNVK 3PGFH 1GGBL 2BY0A 1FNLA 5JPMA 2HYMA 4YHOH 5I15L 1NEZB 1A7PL 2GI7A 4PRHE 3V8OA 3ZTNH 5L2JA 2UZIH 1X5KA 2OR9H 3TN0A 3QNYB 4KVNL 3SKOB 3G6JF 1YPZE 4PY8I 5T33H 3MRGB 1M6OB 2OQJB 3QUYC 3BDYH 3E2HB 3MV7D 3UTPE 1FGVH 1GC1H 1M1SA 2DQIL 3B83A 5DUPL 4XWGL 5DJDA 3ZKND 4OF3A 2YEZB 3EIFA 1HWHB 3AB0B 3CFCL 1QQDA 4JPWL 4P9ML 5E24E 4JM2A 1DEEA 3FOLB 1MAKA 3QIWD 3QNXB 1NGQL 3ZE1F 2Z31A 4K3JL 3SPVA 3LQZB 2VDNH 4PJ9D 43C9A 2VISB 1IGYA 4V1DA 5EORL 1BOGB 3TZVB 4Y1AB 2GITB 4F58H 4OZGA 2BVOB 4X80L 5I8KL 4EIGB 4P4KC 3DGCR 5DLML 3CFBA 3S36H 3C8HA 2YUZA 3GSRA 5DUMH 4MA1B 1MPAH 2R0LH 4LSTL 1P7KB 4NZJA 5F8QC 5I66B 4X0KA 1OB1B 2OZ4H 1J87A 3RFZC 5BZDB 1I9JL 4P5TB 3IJYB 3O4LE 4YGVB 1IE5A 4P2QD 1I9IL 4PJEF 4RAVB 4CL7A 5ITFB 4OGXH 3ZYZA 4FFZL 5DRZA 2P5WA 5JQ6H 1G9NC 3VFOB 1A3RL 1T7YA 2MQCA 1INQB 5T1DL 3I84A 5EPMA 3MCKB 5EBLA 3MRBB 5JO5B 2J6EA 5MHSE 1TTUA 3GO1H 1T0MB 4HSQA 4JKLA 4NO3A 4WW2F 1EAPB 5D2LA 1A5FL 4MMZC 2MMXA 3QUYB 4RGMB 3ALXA 4Z76A 1R3LA 3WKNA 3STBA 5CCKH 4NKIH 2A6KA 2IADB 1FN4A 2AKRA 3VGBA 2XY2A 4QHUB 5L7XL 5D1QD 3UBXI 4I8DA 4HJGB 4JR9H 4IMKA 3BWAB 3JWOC 1TZIA 1FZOB 1GSMA 5K9OA 1A7OH 1S9KC 1TQBC 1JRHI 4NQDE 3ULUF 1F11A 4JZNA 1U8JA 5IEKA 4JFDB 1PKQE 4P9HH 1LMKA 5E5UB 5M7QA 2AV7A 2WBJC 3Q6GL 3HI5H 2EYSB 2NY2C 3SE4C 4OD2B 4HBCL 4WHTA 2DMCA 3MV7A 3ULUE 3G6JB 2R1XB 4LOUC 1DVFC 4OLWL 3SQOH 4H1LH 1ND0A 4MA7H 1OP5H 4EOWL 3SDXE 2AV1A 3QIWA 4RQQA 4H5SA 4CGTA 4ZAKC 1KCSL 2PYEE 3DETC 2EECA 4PJBA 3IDJA 4U1HB 4PJ9A 1EMTL 3I6LD 1TDQA 2J5LC 4KQ4L 3DIFB 2YRPA 4KTEH 1WWWX 1CLYL 3VXNB 4KRLB 3OF6A 4P3CH 5EFIB 3HPLB 1BJ1J 2MCPH 3SGEI 4NC1E 3ZL4L 4XBPB 3VWKC 4XNZB 3QDGA 3O4LB 4CVWA 5GZNC 3FAWA 2VXTL 1CICC 5J8OA 3NGBC 3QB7C 4YBLB 3FAXA 1ZEAL 1MY7A 4HQQH 2EXYC 4P2QA 5EO9A 3B9AA 4KHXH 3VH8B 4G7VL 4TSCH 3V6OE 1DUZA 1UENA 1TJIH 5IJVB 4LPXA 5BS0E 3DXAE 1KUMA 1F90L 3IKCB 3IDYC 1QFWI 2D7MA 4M61B 4NYLA 5FYJH 1RVFH 2WBJB 2NY2B 4HKBB 1AGEB 2APBA 1KCRH 1ZVSA 5KVFH 1T83C 2JCCE 1KLUA 4L3CB 4WW2B 4NM8L 1D9KD 3PF2A 4M1GH 5D1QA 3VXPB 1F02I 4ONOA 2QKIA 3M45A 2A74B 4ZXBB 4XPFH 1IAIH 2Z0BA 3EGSB 5GS2H 5TH2B 1YEKH 3T0ED 2CXKA 3NCYS 1IGMH 4HIHA 1GOFA 2UWEF 4BA8A 1BFVL 1PGRB 4I5BB 2R8SL 1JWSB 1JGDA 1PQZA 4CDHA 2EIBA 5E9DE 2IQ9L 2VLJD 2ICWJ 3QZWB 3LQAC 4GBXD 4HV8A 1OGAB 3QPXL 4KAQH 1UB5B 5IVXE 2DTMH 3UPAA 3VG0L 4L4JA 1Q94B 4AIOA 2ADFL 4PUBL 1FG9C 4XPBL 1FNHA 3WSQH 1WIPA 4P59H 4ZYKA 5C6PB 2OS7A 3VWKB 4XWOC 1AY1L 1WZ1L 3V95A 3DUHA 1KNOA 4NKOA 1CICB 4QRPE 5LGHL 4OZIE 4IRJD 5L2KE 3O4OB 4U1GC 2FWOA 3B2VH 3FOMB 2IALA 3KNBA 5FUOL 3SGKA 2JK5A 5CP3H 1YY9C 2H3NB 4YHIB 2W0LA 5JPNB 5BV7H 4X7DC 4X7TB 3L7FB 3C60D 1FZKA 3NCJL 3KYKH 4ZUUA 5T3XL 5KS9A 5EO1B 5ALCH 5ANMB 3G5YA 4KJWD 4OSUL 5DMYA 3EO0B 3CZFA 2G9HA 3MA9H 3L95A 1LO4L 3IDYB 4OD3H 1KJ2B 4K94C 4HC1L 1Z0NA 3K8MA 3VMNA 3U2SB 3RWCB 5C0CD 1EFQA 3U1SH 4C54A 4ZNEE 3QEQD 1LO5A 5D7IE 4MMXC 1DCLA 4OCNC 3ZKSD 4MJ4A 5FKPB 5C0FB 5DD6B 3V4VH 3VFPB 5BS0B 3WIFA 1D5BA 2EDNA 3MC0A 1UEYA 2J4WH 3JVGA 2V9TA 5EZOL 1DBAH 2CRIA 3FFCE 3D39E 3IXTB 4G7YH 4QTHB 4QXWA 4Y4KD 3Q0HA 3TC9A 4M7LH 5DRNA 2EO9A 2DKMA 3LKRA 3LRSB 15C8H 1MAMH 1TTGA 4YXKL 5DR5L 3P77A 5ISZE 4M7KL 1S5IH 1FZJB 4LNRB 5HHOD 1C5DB 4I18B 1N5AB 5FCSH 5JHDD 1P4LA 1A14L 2PN5A 3GEWB 4EKXA 4Q74A 1D9KA 2OTWB 1JF5A 4ZUWB 5DVNA 4RGNE 2ZNWA 25C8H 5FECA 4WFGD 5DJ6A 3LOWA 4L1DA 1BD2E 1MLCB 3DV6B 1QRNE 1U93B 1Q9KB 1YEGL 2EDKA 4K23L 4XVTH 2R2EB 1RMFH 5E9DB 5D6CB 3ORJA 1CYGA 1L9MA 4WHYH 3OR7B 5I17A 5FOBB 3RWIB 2IH1A 4OJFH 1GC1C 2VLJA 4QOKE 2UWEB 4GBXA 1BWMA 4KV5F 1K4DB 4Z78B 5KVDL 1HHJA 2EC9T 3OGOE 3QXAA 2N7AA 4PGEA 2IGFH 1ZHLB 2X70B 4LASH 2IPTL 4GLRH 3KPOA 4IRJA 1JF1B 2AJ3A 1EZVY 5SWQA 4LMQE 3U4EB 5EUOA 1KIQB 4UOJA 2DI9A 3TWCH 3KPLB 3DROB 3C60A 1VGEH 5KVGH 2DTSA 3BKJL 1U8LB 3IDMA 1IGFL 1CXHA 4P4RA 2Y7QB 4HLZG 3QUML 2DQHL 2IEPA 1I8LA 3MZGB 1ZT4B 1BFOB 1CDYA 5DJXA 1LQSR 1FG2B 3KXFE 5C0CA 1NBZA 5FO9B 1BVKA 3HMXA 1MRCH 4TQEH 5I19H 1B3JA 3KJ4C 4OAWB 4NWTL 4Y88A 1HXYA 1BZ7B 3TBSA 4IEFB 3TO4D 1KGCE 3FFCB 3U7WH 3D39B 3LRGA 1NLBL 3KLSA 2ZUUA 5C2BL 5MERA 1W72L 1AR1C 1F6FB 1XR8B 4L4TE 4XNUH 2N56A 4WI7A 1G6VK 4H8WL 3DYMA 5ISZB 3RZCD 2ADIB 1IQDB 4CVZB 3INUH 4OZ4B 5E6IB 1LEGA 1U8PA 4KMLB 3V4PL 2WINB 4NQXB 3RY6A 5JOPE 3IT8D 4XVJH 5HHOA 5JHDA 4YE4L 4HUKB 1RJLB 1PEZA 3GMPB 3H9SE 4DN3L 3Q48A 1JNJA 4BH8B 4M3JA 1A02N 4GQ9H 2I07A 1JWMA 5KW9H 1BQHG 1QLFB 2YBRB 1TENA 3GRWL 1I7RB 2EIDA 3MRPB 3BYYA 2XKSA 4X6EA 2XICA 3ARFC 2FJFB 1FPTH 1T04B 1YDPB 5KSBA 3U4AA 3LMJL 1DQDH 2EDWA 5FCUH 1SY6H 1M7XA 2CUHA 1EA9C 3QP3A 3QQ4A 2P47B 5C08D 4NZRH 1OCWL 5GRXG 5HI4D 3F7QA 2DQCH 1CE6A 4LP5A 3RUGA 3UJJL 5HGDA 1OD7A 4GKZA 5IQ9A 3GSNB 1DUYB 3QFJE 4JJ5A 3MROA 4BSWB 3SCMD 1CXLA 3KJ4B 3D85A 2KDGA 3HR6A 4MDJA 4YPGA 5JOEA 3KPNB 3U36A 5L88L 4ODXA 5GGTA 2P42B 5I30H 4BQCA 1EEZA 1JNHB 1OWWA 4MS8C 2EDBA 3C08H 2X4SA 5FGCB 1KBGL 2VJXA 5JUEL 5DURD 3KXFB 4KKAC 3L3IA 1IGTB 4LCWD 3IFPA 4NNYB 3PWNA 3Q5OA 1G7QB 1CFTB 1C08A 1B6UA 1FSKC 2V5YA 4N5UA 5CUSH 3OAUH 4JY4B 2MPAL 5F1IA 2KKQA 4HJ0D 3TO4A 5A2JH 4F7PA 4LSQL 5BRZD 4OI9A 3RU8L 1MQKL 1TTFA 3W0WE 2ORBL 3T0WA 2J2ZA 2CIIB 4PJ8D 3TBYB 1CI5A 5CIPH 1I1AC 1HH6B 3ZYJA 2X5PA 5GRVK 3ARFB 3GB7A 3MUJA 5F3HB 1RFDL 4XRCA 2OYPA 1A8JH 3QPQD 5EUKB 3RZCA 4PJGA 1FFOB 5F9OH 1T7WA 4U1MA 2OTUB 1MH5A 1YEEL 4GW1B 2BXZA 4X98B 5CMAB 4I4WA 2YA1A 4TUOB 4FABL 1A4JB 2F74A 3VRJA 3BEWA 2BHUA 3X14B 4JGUA 1F4XL 3BXNB 4GT7A 1DSFH 3WS6A 1J1XL 4PJIF 3MMEA 5E8NA 4LP4A 1S7UB 3DLQR 4PBVC 1RZKL 5I1DB 3EYOA 1DQTA 4WCYL 4FOMA 2BSRA 4Z8FL 2APFA 1MNUH 4R90H 5C08A 2BDNL 5EIIB 3LKSB 2OL3L 4OUOA 3BO8B 4AQ1B 2NY3C 4DGVH 5GS1B 5IR1A 1RIUH 2DQUH 1BZQK 4YDJB 4YQXH 4GAJL 1MHCB 2D0FA 4ZFGL 2DL9A 3MV9D 3SCMA 8CGTA 4KUCF 3IFOA 3QJHA 2PF6A 4IOIA 2GK0B 3LH2H 4EI5D 3ZT6A 5AG8A 1NFDF 5CGMA 3CX5J 5BV7C 2PO6D 4ZPTA 3UYRH 4KHTL 1L0YA 3IDIA 4EQ3A 3TBWB 2I5YH 1M4KA 1OPGH 1U92B 3O6MH 2GAZA 3A6CH 2MHAB 4DZ8A 4LCWA 4M6NH 3OXRB 4Q9RH 1G9MH 3DVNA 2AERT 2PW2B 1B2WL 2GUOB 4V1DE 2YPKB 1UA6H 2GKIA 2VN7A 3BPOB 5FYKL 4PRDB 2AJXH 4OZGE 3NZHL 2YPLD 2AP2A 2DQDL 4B0MM 7FABH 3UPCA 3HC4L 1T1ZB 3CSPA 1ZT7B 4HIXH 5BRZA 4JHAL 3X3FH 4QRTB 3RX5A 1HHGA 4PJ8A 1NPUA 5GQBA 4DKAA 2ICEB 2M8XA 2PTTB 4TSBL 1SYVA 2VKXA 2P43B 4ELKA 4KQ3L 1R5WB 1B4JH 2O5ZH 1F3DJ 3L3DB 4FQ1L 4U6HA 5F3BB 3WS3B 5DF0A 3OKLB 4HUXA 1CL7L 4FS0A 1OQXA 4AH2B 2P5WE 2FCBA 2NY3B 5MI0C 3LZFL 1VSCA 4H26B 2MSPA 2HTKC 3ISWA 4URTB 4LARH 2VDLL 3OAYK 3OQ3B 4LK4A 1XGUA 2IPKA 3U7AA 1A1OA 2XFXA 3QDJB 5D2LE 1RURH 5FEBA 4JFFA 4JZOB 1EBPA 4YO0B 5FM5M 4ZPVB 1B9ZA 1X5HA 4UBDC 3W11D 5C07A 2D2OA 2H45A 4NO0D 2C3GA 4ZUSB 5C0IA 3RNKA 3RL1B 4PJIB 2CJUL 4XP5L 2DMKA 1XCTB 3R1GH 4PJXA 4L29B 4ZOEA 2AXJA 4JO4H 5SX4I 4BKLB 4H0HB 4M5YL 1DEDA 3VFSB 5C70A 2ZSVB 5KOVC 3BWUC 5ESVB 5D93B 4PJHF 1RULL 4NRZB 5IGXL 5DJDB 3MV9A 1W0YT 1LO2L 2D7NA 5AYUH 1KCUL 2DIBA 2XWBA 3I50L 3MV7E 1BAFH 2GIYA 4EI5A 1S7TA 2PO6A 4IRSD 1P6AB 4LCIL 4TSAH 5DC4B 2R4RL 3RGHA 1A2YB 4NM4L 3LV3B 4EVNA 2EXWD 4UDUA 1NFDB 1E4KC 4V1DB 5JHLL 1L9NA 2QR0A 1WZKA 1WT5C 4HUWA 4PJBE 1T0NB 2Y36H 2X9YA 4F37F 3K80A 1OTTC 4P49A 3EOBA 5DJYA 3CFEA 2QHLA 3KLHC 2YPLA 1UKSA 2YC1A 2VB5A 1AHWC 2Y72A 4GAYA 2MJWA 1QBAA 2L7JA 1KPUB 4DVRH 5MENB 5EOCH 2HFEA 5EZLB 2ADJA 1J1PH 2DOCA 1RZ7H 5GSRA 1QFHA 3DX9A 2X4UA 3QDGE 3QXUA 4M48L 4CU6A 3CVHH 1RUAL 1MWAA 1YJDH 4O00A 3O81A 5JR1H 2P5WB 5J06A 1KEGH 1A6AA 2CQVA 4P2QE 5GIRB 4KKCD 5D5MF 2F54D 3MRLB 5EPMB 4YIQA 2HMID 4JM4H 5FYLL 4NUGL 1I1RA 2JIXD 2ZZUT 2CLZA 4NO3B 1R3HB 3BKYL 1A6TA 2SEBA 1CD1B 1ADQH 3G9AB 1MFAL 3SKUD 4ONFL 1FN4B 4JKMA 4MQXD 3FT3B 1PY4A 1P5VA 5ESAB 2VTFA 1EHLL 2DD8L 4NO0A 2GHWB 2LVEA 5DD1L 1UQSB 2DBLH 1HI6A 3NA9L 3C9NB 3T1FA 4DGYH 1BZ9A 2R0ZL 4MCZB 3S37H 5IEKB 1FO0L 2ICWI 4Q9QL 3T2NL 1RZJC 2FX9L 2E9JA 3N1FC 5J9PB 2NX5D 1L0XA 2AV7B 1FGNL 1VFUA 2VL4A 1WBZA 3BP5A 2IF7A 4AT6A 1NANI 3OB0H 5MEQA 4N1HB 5D4QA 1AHWB 1DE4A 4XMPL 4YDVA 2ZWLT 4PJHB 4ONHB 3IGAA 3L3KB 4FQJH 2AV1B 5ESQB 4IRSA 1BVLA 1OAXL 3F62A 3IDJB 3QWRD 2Y07H 2AJZA 1M7IA 4WFED 4MA3B 1AIFA 3S34L 4C4KT 5BVPH 4P5KA 3U9UA 1I1FA 3F58L 4QWWD 3PJSA 5CP7A 2VLRB 2GCYB 5DMKA 3VFMA 3I6LE 1OSPL 5FAAA 1Q9OA 1HINH 5F7KC 3GUTA 1A21A 4HF5H 4LCYA 5KS9E 4WGWB 2J8HA 2VXVL 4EDXA 4YHKL 1OVZA 3DHJA 2X2YA 5I1GL 3QDGB 4KRPC 2XPGB 3SDCD 2V7NA 2IG2L 1W8NA 1IGCH 5E1AA 4PGJA 5E4IA 3SBWC 3TA3D 5EO9B 1NFIB 4Q6YA 1S8DA 3CK0H 4Z7VA 3CMGA 1ZGLA 5IW1B 4KK6D 2F54A 3NPSC 2A6IA 2XN9D 2JIXA 4PLNC 4PV8A 1RK0A 4DK6A 5D5MB 1YMHA 1WFTA 4FZ8H 5IIEA 4PIRF 5TFSL 4JHBA 4BK4A 3D0VA 3KYNB 3HZYB 4MQTB 1HHIA 4PY7A 4PGCA 2R39A 5HI5C 5D1QB 4IIQC 4NKDB 2QKIB 1MF2L 3U7YL 4Y19D 5IWLC 1T89C 3U0PA 5ADOH 3O2WL 1F58H 5A2LH 4JQXA 1CTNA 3HC3H 4HIHB 2D03H 3TJHD 1K8DA 4KDTC 4JDZB 1RIVH 4KXZI 5DJ0B 2WBKA 1YNTA 3BN9D 4P2OD 2NX5A 1LO3L 2WP3O 3LHPL 3B8SA 4TNVF 3VXQB 4NZUL 1KEMH 4ZOBA 2EIZB 3U9PL 3M07A 5IBTH 2VLJE 1VDGA 4R8WH 1L6ZA 2NY6D 1TMCB 4KRPB 1KC5L 1RUPH 5JXAH 4M6OH 5B39B 2LFGA 4NKOB 5DC9B 1Z9OA 5EUOF 5IBUG 1NLDH 5F9WC 4UV4H 2J88L 3U4BL 5JNYA 3QWRA 4L9LA 3IDNB 4WWKD 3DOSA 1OY3B 3H7LA 5BXFA 4NN5B 5CLTA 4ELMA 1FZKB 3RDTD 4MQSB 5EUOE 4YHPB 3MACL 3NPSB 2Q7YA 4GSDH 2LTQB 3PP3H 3THMH 5CBAA 1N6VA 1PEWA 2H41A 3S8WA 5T1MB 1KELH 3KS0H 3L5WA 3SDCA 4F15C 3TH3T 1LE5A 2R2HA 1LO5B 2R4SL 1AQKH 2C9AA 1YYLL 1S7WA 4JFHD 1O7VA 4FFVD 3GBNL 4IIQB 1G1YA 5C0CE 3TA3A 2A1WH 1VHPA 3WIFB 1D5BB 3E0GA 4NRYA 4LSDA 2JTDA 5CWSA 4FTVB 1KJVA 3F7YA 2H2PD 3VRLF 2XN9A 3MV01 1TCRA 1PG7W 2R23B 2NY4D 1S9XA 4WENB 3DSFL 4QHLA 3K3QA 1IEAA 5KG9A 2C4FU 4N8PA 4S2SB 5EG6C 3MRHB 3RNQA 4Z9KB 4ZS7L 1P4LB 4C57C