1E4XI

Crossreactive binding of a circularized peptide to an anti-tgfalpha antibody fab-fragment
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
217
structure length
217
Chain Sequence
QVQLQQPGAELVKPGPSVKLSCKASGFTFTNYWMHWVKQRPGQGLEWIGEILPSNGRTNYNEKFKTKATLTVDKSSNTAYMQLSSLTSEDSAVYYCARSPSDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRVPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TAB2
publication title Cross-Reactive Binding of Cyclic Peptides to an Anti-Tgf Alpha Antibody Fab Fragment: An X-Ray Structural and Thermodynamic Analysis
pubmed doi rcsb
molecule tags Immune system
total genus 46
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2000-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1e4xI01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1e4xI02
2DLHA 1JGEA 3VXRD 1A4JB 4OI8A 2HFFB 3DX6B 5DFWH 2Q8BH 4ELKA 4QRSA 2BSRA 2F5AL 2MNUA 2VLKD 4YFDB 4O4YL 2EC9U 4F3FA 2D0GA 4K3DL 3G6AB 1LEKB 3HRPA 2EZ0C 4I2XA 3T0EC 3T2NH 4ZYKB 2DTML 5C3LD 1MCEA 3U7AA 1M7IA 5E9DA 1RJZA 3ZDYE 4JVWA 3TNMB 1XCQA 1MF2L 3HNTL 1FLTX 4LHQB 5LAXA 1AP2B 3D87B 1T6WA 4JFHE 3QUKB 2YSSB 1XAUA 5CJBA 4O2CB 4FN0A 1CLYL 1CQKA 4L9LB 4UT6H 4Z7VA 3DRTB 5F1IB 3E2HB 1Z6JT 3QEQE 1VENA 3UEZA 2FR4B 2CR6A 1MHHB 4RFOH 4Y2DB 4NRXA 1L0QA 2Z92B 1A7RH 1NFKA 1DE4A 5KJRH 2JCCB 2A9ML 2OP4H 4G6AD 3ARSA 7FABH 2X4NB 4EZMA 2PYFB 3C6LA 3MBEC 4G7VH 5GHWL 3QJHB 4PJIB 3G6JE 3D5OF 3P9LA 3M07A 4XHJC 2XZCH 1DUYA 4YHZL 2LABA 2NY5C 3N0PB 3RWGA 2OI9B 4NZTH 4H88H 3HZYB 5D7SL 4JZNB 4Z77B 4Y1AA 3EOTH 2ITDB 1Q0YH 3PHOA 3RY6C 1A9EB 4FQLH 4N0UE 2H6PA 3TO4B 3VXUE 1BZ9B 3HE6A 4M5YH 4X83A 5KG9A 1DVFA 1JRHL 3I2CL 4ETYA 8FABA 5SX4I 1FPTH 4A6YL 4A6YB 3NPZB 2FGZA 1UWXK 4U6YB 5EOCH 4WI9A 4GBXD 4NCC1 5DMJB 5MHSE 4F7MA 1KCKA 2B5IC 4PJXF 1F90L 3U79A 4OLYH 4EDWL 5F8RC 5MENB 2IH3A 3HLAB 1SBBA 1URLA 5DD5L 3DJ9A 2BY2A 3MREA 4FFYH 2FZ3B 5HYJD 4X8JB 1UA6L 1U8NB 1G0XA 4I77H 4LP4A 1XGYL 1CR9H 3LD8C 2FX8H 3RWFA 4U6XB 4JO3H 4PTTB 4HIJB 2XWBA 1T7VA 5BS0B 4Z5RA 4FQPA 1I8IB 2I5YL 1N2RA 1JGLL 2Q7NA 3FB6B 1HHIA 1KCRL 2IAMD 4MHHG 1J0ZA 3GSRA 3WIHA 3QUZC 2DLFL 4JPIB 5GGUB 3O3AB 3WHXB 2RAMA 4G42B 5SWSA 2NY7H 3ZT6A 4WHTA 1WBXB 5C0DA 1LMKA 2RBLA 2CMRH 3CZFA 2W92A 4CVXA 3IJSA 1ZGLA 4FQQB 4L4TE 4TVPD 3VXNA 5E94A 4AEHL 5H94B 3E6FA 2HKFH 1MI5D 1BX2A 4TUJA 3AAZB 43C9B 2BY0A 3CCHA 3P40A 5BMFH 1MSPA 5KW9L 5FO9A 4WWKD 4RGMB 3FTGA 3LV3A 1M7DB 4MWFB 2FGWL 4XAKD 3MRJB 5C6TL 1PQZB 3WSQH 1E4XH 3GMNA 2Z8SA 4PG2C 3ZHKA 1D6EB 5JPMA 1KNOA 1X4XA 2FJFA 3M1BB 1ORQA 4RGOL 1IGYA 2F54E 2XFXA 3WJJC 3ARBB 5GZOC 3P73A 3X3FL 3PWVA 1NBZB 1XIWD 5A2LH 1NCCL 5GPRA 1S7VA 3HR5B 4HWUA 3ZSSA 1PZUB 1DQLH 2ESVB 1ACYL 5F88A 1HE7A 1IAIM 3QIWB 5IB5A 4D0CB 1W72L 1W72B 3G08A 4WI8A 3AM8A 5D7LB 3VFWB 1RHHA 3UTTB 1NDGA 4G9FB 2OR7A 4XPFL 5GGSY 2WIMA 2NXYC 1U93A 2H41A 4DGIL 3VW3H 2AK1H 4KTYA 1PY9A 2AAVA 2QQNL 3HS0A 2FEDD 1JFQL 4P2RD 1U6AL 4NP4L 4YGAB 2H32B 1LK3L 4PJ8D 4YZFE 4QRPD 2ZG3A 2X4SB 2P5WD 4L4VB 3ZKQD 2MPAH 1TLKA 3ULVD 3T4AB 2DMKA 2Z31C 5AG9A 3VH8G 2BMKB 4EBQL 4DK6A 5J3HD 5I1DB 1H3PH 1J8HA 3W2DH 3QXTA 4JKKA 1RUML 3BJLA 4AZ8A 5JPNA 2COQA 5IW6A 2QQKH 3HI6L 3VG9B 5MEOA 3QHZH 5ICZA 1U8QA 1A6UL 3V4VH 4CU8A 5C2UB 1G6VK 3DVIA 4L8SB 4K71B 1GVIA 4QKXB 4ONGH 4DKFH 4XTRD 2X4TA 4ZDHA 3WNKA 1PX3A 2A6KA 1N5YH 1U92B 4Z78A 3G5XB 5T3XL 2XZZA 1A02N 3WXWL 4R7NB 4R4ND 4FZEL 3TT3L 1AGFB 3WV0A 4G6AC 1L6XA 3QEHA 4OLUL 5CHNB 3BZDA 4PV9A 3GJFH 5DD3L 3C09C 4G6KL 2X70A 1KJMB 1U8LB 3RI5K 4PGZA 5B38G 1MJJA 3IXAB 4NO0B 4X99A 2DM3A 1B2WH 2PXYB 2RIKA 3BZFA 3QQ3B 4U0RB 1CF8H 2B1HH 3LEXB 4X6CA 1GZPB 1V3LA 2HA1A 2PYEA 4XZUB 3SKMB 1CDJA 3UP1A 3BZEB 5J89A 1IRAY 2ERJC 5L7XL 4Y16A 1BP3B 1T0MA 4GBXC 3MACL 1TZIA 4GS7C 3S96B 3ARFA 4HXAH 2BSSA 5EUOB 3OKEB 5C0JB 4J3OC 3F7VA 3EUUA 3DLQR 5T1LA 3S9DB 4BFIA 4K3JL 4LEOB 4QGTA 2P4AB 2X1QA 3MPCA 1R24A 3GMOA 4KRLB 1MH5B 4S1QH 4X7TB 3OB0K 5IQ9B 2DQDL 2IPKB 3O3DA 2IEPA 3OGCB 5IFJA 4R8WL 2Q8BL 3MLTA 4QHLB 3HRZA 5J8OA 4JN2B 2OL3B 3VFVB 4LSUH 3GGWA 3GRWA 5EBGA 3OTTA 1LO4L 1A6ZB 1LDPH 4RMWA 5GRXG 3RIAK 4BH7A 3IFPA 4NSKB 2NLJA 1JGDB 3QDJA 1JNLH 1OARH 1TENA 4HEME 5KSVA 1HQ4B 3B6SA 1AGEB 5FF6B 5I9QB 3GHBH 4XNMA 1AGBB 5KSBE 2AV7B 5KS9E 3KPRD 3MRNB 2GSIA 5I1HH 4GO6B 4MCYA 5GGVY 3QFJB 3QJFB 3UTQB 4KZDH 4YIQA 5EOQL 2HWZL 3TO2A 3ZKXC 4E0RB 3LMJL 1CFTA 2X42A 4UTBH 2ICEA 4XCNA 4WWKC 3RKPA 3KYOA 5DJ6A 1S7UA 1CBVL 3UC0H 1VFUA 3LN4B 5E8NA 4GG6B 4ZUUB 3WKMH 1RZFH 1IAOA 2ZZUT 4R0LB 7FABL 5ETUB 1S9WB 1EFXB 3EOBA 3EOYG 4OZFG 5I1AA 1I8MA 3QUXB 5F7UA 1OTSC 5D7IE 1HHHA 3L7EB 2AXGB 1QLEH 3DXAD 3PE9A 3CH1A 4ZFGH 2IANA 4X80H 5IMMA 1XIWC 4ZFZA 1MCJA 1S7SB 4I4WB 4NOFA 5DXWA 1WFNA 1R5WB 5J7CC 3R8QA 1CXEA 5ITBH 4Y1AD 5HVHB 4FQLL 5TDOB 5SX5K 2GI7A 4M5YL 1MCNA 1QO3B 4NFBA 3HE6D 5I30H 4G6FD 1FPTL 2HT4D 3TVMA 4WUKH 5L9DL 3UMTA 2AK4B 3B9KD 3EHBD 4PRPA 4QYOA 2P49B 2VABA 4WTWA 3MODH 4FHBD 5BV7B 2WUCL 5BO1H 5GGRA 2FEDC 5BZDB 2XN9A 3S34L 1NDMB 1AJ7H 2ARWA 3TPUB 2VZOA 4PJ8C 5E6IA 5D1ZA 5D2NB 4PLNC 1QBLL 2XQBL 2QQQA 4UDTB 2NY0B 4EKXA 5HHOB 2VLRB 4FTVE 2CLRB 4QT5B 5EC1B 3BVNA 3ULVC 4H1LB 4JDVB 4LVOC 5J3HC 1HEZB 3PWLB 2OXHA 3RDTC 4GRLB 5C1MB 3M8OL 4LNRA 1K4DA 3HG1A 3J7HA 3RWJB 5ABDE 4CJ0A 2IADA 3QHTC 3WFCL 5JHDA 1T5WA 4XTRC 5DK0B 5GIRA 4MAYD 3U4EB 3RVWD 1U3JA 2QSCH 4L29A 4DZBA 2CJUH 3VI3E 3TT1H 2V9QA 2G9HB 2CMRL 3VJ6B 3C08H 1DL7H 3V0AC 4JB9L 3SGJA 4CADB 4DWHA 4JM2F 4S2SB 1AD0A 5H35B 4HV8B 3QDGA 4IRSA 1WFOA 2ZCKH 4TSBL 3T1FB 3SDYL 4XNUH 5BMFL 4RSVA 4JRXA 4OCRL 4UV7H 4Y2OA 4NHCH 3E6HA 1HILB 2EDWA 1J1OH 4FQXA 4PJDB 1N0XH 3BPLB 5FAAA 3KS0H 4DTGH 4YDJA 2ZSVA 1WAAA 4HXBH 1BD2B 1CIDA 5CSZA 5F1NB 1OCWL 1BQUA 1G6RA 1FFOA 1IQWL 3W0WE 2H2PD 3A6BL 1UZ8B 1UQSA 5ICXB 2Q8AL 3RPIA 1A1MB 3L5JA 4NKQB 3EGSB 4PJ9B 4XCCH 5CINH 1BFOA 4FFWD 4OCSL 2AABH 2HG5B 1SJVA 1XF2A 1XF1A 3K8MA 1QRNA 1OAUH 1JHKH 1NGYB 5D9SA 4LCCB 1T04A 3VDBA 2AK1L 3RTQD 5EU7E 3GSXA 2IBBA 4JFDA 4S1SH 1KYOK 4G8FB 4OCMC 5J06A 4IMKA 4WW1B 1B6DA 5EZIH 1MCRA 2AJUL 2ZCLH 1CGSH 3V5HA 3DV4A 1I1FA 1HINH 4FQ2H 3C2AL 1I9JH 3ARXA 1P9MA 4MNQB 5A3ID 4P2QB 3BN9D 1OGTB 4LCWE 4L8BB 5CLTA 1EXUB 4QHNA 5I66B 4JHBA 3RL2A 3CLFH 1E6OH 3FFCE 4KHTL 2DBLH 1H3PL 3MNWB 4LL9A 5D2LB 2RCSH 1TQCB 3IDGB 4PJXE 4Q9BA 2YPLD 3U36B 1NBVH 5F70A 4M4RA 4GRWB 3BPNB 3MUZ1 3U9PH 3W39B 4ONGL 1CFBA 1CL7L 2D3VA 2X4OB 3BKCH 1OAKL 1DTUA 5E2VH 1HYSD 1R0AH 3S88L 1JWMA 4TYUA 4XCEA 2VOTA 5E6ZA 1X5JA 2BRQA 4KI1A 3W5MA 5JQ6H 4NO5A 1JPGA 4DKEH 1XF3B 2BNQA 1C16A 4K2UH 1OHQA 1RURL 4H8WC 3ZE1F 1X5HA 4PJ5D 4YK4B 5EC2B 1OP5H 3WL9B 5E00B 4HWEH 2XXCB 4FQ1H 4XBGA 5DUBB 2XQYG 2CLZB 1IM3B 1MQ8A 1TFHA 1CD1A 4OSUH 2A2QT 3C8KB 3U82B 3GNMH 5I1IH 2ICCA 2BERA 4MCZA 6CGTA 4IRJD 1F97A 1YA5A 1UKQA 3EKCA 1B9ZA 3EYSL 4ZUSA 2B2XH 3UYRL 2PKDA 1ZMYA 3C6SA 3GI8L 3HE6C 3WUZA 4ZTOL 1DVFC 3FB8B 4M7ZB 2HT4C 4OZGF 2M26A 3KWWB 3EHBC 4RZCB 2CD0A 4JZOB 4MQXD 3UTOA 4NO2B 4LFHG 5D1QD 3ARFD 2IJ0C 4Q0XH 1ZLUH 4JKWA 3TV3L 2HN7B 1HXMA 1H8NA 1BFTA 1F58H 4NQDD 2I26N 3DGCR 4J2XA 4MJ2A 4ZS6D 4KQ4L 1SM3H 3WDHA 1OVZA 2AJ3A 1A3RH 3LKSB 5D7JB 3T0AA 4UIMB 4HFUL 5DYOA 5GJSH 1UM4L 5I8OH 4OLZH 2Y07H 5DSCA 3BT2L 4AQ1B 1MCWW 2BSED 2ZUQC 2A6IA 3K2UH 2BVPB 1U3HD 5EZJB 3TP4A 1DJSA 5DEGB 1LDPL 4W4OA 1MVUA 1KTDA 4H26B 5IR1B 1INQA 4MAYC 4CVWA 3CX5K 3BDBA 4RWYH 3RVWC 3QDJD 5DLML 1QBML 2HRPL 3U30C 4Y4KD 5IB1B 3RWIA 1BAFH 5JQHC 5I19L 4U7KA 1RUQH 2FATH 1JUFA 4YAQA 3GM8A 3U83A 5ANMA 4RA0C 5C86A 3NCYS 5F72S 4LARH 1EA9C 3VFMB 3OKNA 1UACL 3G5ZA 1IC5H 4LLMB 4HWZB 1N4XH 4M5ZH 4OCYL 4XP5H 4OD3H 2XTJE 4NQSB 3UC0L 4M93B 4GKSB 1RZFL 5AUMB 1FP5A 4KI5D 1Z9SA 5CKAA 1V7MH 2L7JA 5BRZE 3SDDD 2EH8H 3X17A 3JUZA 4OFYA 1CFNB 1ZK9A 1UXWA 4ZFGL 3V0WL 1N59B 3O4LE 4LK4A 5F21B 1R3IL 1DQMH 2H2PC 2IAND 5F7EH 3DO7A 2JTDA 2ZOLB 1MCLA 4MQSB 3SGDH 2R56H 5CFHA 1AQKH 5HGHB 3RGVB 3F7YA 3HPLB 2XWJB 3BGFC 4P5MA 5F1SA 1AXIB 5HBBA 5HHME 4FMKA 2Y7QB 4KZEL 2DKMA 4KXZI 5FGRA 4U1JA 1IAMA 4P3DB 4F9LA 4MQTB 1EVUA 1ERNA 2VDOH 3Q6GH 4K55A 4PRPD 4PV8A 5ESQB 5C08A 3T8XB 2EDNA 1Y18A 1EIBA 5DD0L 1FNHA 1KG0B 1G1YA 1AJ7L 4L1DA 1ZXQA 2I9LB 4V2BA 2DQGL 1EMTL 4LAQL 4Y89A 5D1ZD 2EXYD 5A3IC 2R1WB 3BN9C 3QNXA 3SJVA 1HK6A 1KXTB 2Y25A 4K8RH 4QTIH 4M7JL 5IMOB 3OKOA 2YRZA 1VPOL 3OF6A 1IBGL 1FZMB 2YD4A 3HPJB 1H5BA 1IGML 1M71B 1C5BL 5I2IB 3HG1D 5E4EB 3KNBB 4C83A 3ARZA 3EDEA 1DANT 3AVEA 3PWUB 2GCYA 1C08B 2GJ6E 4MA7H 3S3SA 3SDXA 3HZKA 5JW4Q 2CJUL 32C2A 3WEXB 1HYSC 1C12B 3TT1L 1E4WL 1WC7B 4JDTL 1AKJA 3U4AA 3OJDB 5I1KH 2G75B 5JXAL 1JF6A 3RVTD 1FCCA 1NL0H 2XNAB 3Q5YA 1KIRB 1FZJB 2DJUA 4OBSA 4G8GE 1K85A 3ARDB 1WWCA 1DBJL 2CIIB 1Q8MA 5HVFB 3NZ8A 4UV7L 4NUGH 5CUSH 4NHCL 5LXGL 1I7UA 2DWDB 3CVIL 4ODTH 4P5KB 1J1OL 4XHQA 3CU1A 4X7EC 4ZUWA 5DEFB 3QDHA 3CAFA 3P0YH 1K8DB 2Y72A 2ZNWA 4GQPH 2E7CA 5M94B 2R8SL 1YMME 1FDLH 2JKXA 1P4BH 1NMCB 4EJ1C 1IEAA 3VXOA 4MQXC 4JJHA 4Y19B 4NJ9H 3VXMA 3LQZB 1LP9F 1JE6A 5CBAA 5D1QC 3ARFC 1F13A 1P2CA 2NTSP 5FIEA 2Q7YA 2ESVE 2NY4D 5CINL 3PGFL 1UC6A 2F53B 1CD9B 4FQJH 1ND0A 3QCTH 1R3JB 3VH8A 4G3YH 4ZS6C 4PJ7A 3UTTE 4TUKH 1MCOL 1RFDH 2ATPA 1QRND 1KB5L 5GRJH 3LRGA 2P5EB 4NHUA 1OAYH 3MRGA 3HAEH 4ZFOB 4QRRB 4MGXA 4LCUA 4AQOA 2EE3A 2IWGA 4Z0BL 4X5XB 1A0QH 4X9FA 2VN7A 5IVZA 3O4OC 4GKNA 3RA7H 1I4FA 2ZCLL 5CS7A 1CGSL 2IBZX 1HINL 4HWBH 1U3HC 2BRRH 1JPFB 2FIKB 1U0QA 5HY9B 3QEGL 3LAFA 5GGVH 5LCVL 1VEPA 5T33L 3KDMA 2EE2A 1AY1L 4PFEA 4G8EB 4R96B 3CLFL 3EYOB 2DBLL 4ZG1A 1VDGA 1ZSDA 1U8HA 2O61B 4Y4KC 3UTPD 4RAVA 4MA1C 3WUWB 1OF2B 3TBVA 1NBVL 2UY6A 1JPTL 4PRIB 4N9GB 3U9PL 4M1CD 2ADIA 35C8H 2PO6A 5B38A 1C5CH 4P9HC 5E08H 3IDJB 5F96H 3WFBH 1YEGL 3UPRB 4D8PA 1KENH 4MQ7A 4JR9H 4BM7A 3UJJL 5HPMB 4ODUB 3CK0H 2KBGA 1U9KA 5BXFA 1LHZA 4WO4A 2DRUA 4JKLA 4P4KD 1JP5A 3PL6B 4DEPB 4ONFH 2YUVA 1NCAH 2BNQD 2C1PA 1NC4B 1M6OB 2MWCA 4DQOH 4O5LH 5ESVA 4DZ8B 4FQ1L 2HAZA 4KY1L 4KKAD 4RGND 4M1GH 5DTFB 2FNBA 1IC4L 4WFGE 4OSUL 1G7JA 3RWDB 4MDJB 3KPNA 1HXYA 2Z35B 1NUFA 2DJSA 1I1AB 1IZKA 3QUMH 2VJXA 4LKCB 4UT7H 3H0TB 4Z7UA 4O2FA 1F4HA 1GRWA 5DJ8B 3L3JB 1F02I 1YEEL 3DVNA 5TE4L 3QG6B 2Q20A 1LDSA 2HVKB 1F4AA 4Q0XL 4MXVF 4X9BA 3MRQA 1VADB 5IFHH 1F6LL 3PQYA 4RIRB 4C59B 2DB8A 1MLBB 3OSKA 4KROD 5FECB 3VFUB 3BXNB 4WEBL 5D1ZC 2EXYC 3RX5A 1F11B 3V95A 1KLUA 3TA3B 1Z3GH 1INEL 1HSAA 5FOBB 5JW4N 3NZHH 3BIKB 3LH2H 3MJ9H 5C0BA 3CSYA 4HGWA 1TCRB 1EUUA 1JWSA 3RL1A 4KJPD 1CDCA 2V6HA 5GS2H 3VXQB 2EE9A 4OZIF 4MSWB 2D7MA 4MJIA 5IFAH 4OIAA 5CJXA 3U9UB 5F3HB 5AZ2L 1YUHB 3DMMA 5DJ2A 5ICYB 3MLSH 3U2SB 4XWGH 1SMAA 1R3HB 2EYRA 4IHOB 4AMKH 4W70A 4IOSD 2BOBB 1UZ6F 4GW4A 3OXSA 1BAFL 3D39A 4OZFA 4WDIA 1FHGA 2ZUUA 3TJEH 3R06A 2FATL 5FYJE 4BQ6A 4Z7WA 3SGJC 3HE7B 3RIFF 2D31B 3VI4E 3QEQA 3RVTC 4PTUB 3EFDL 4HUXA 3QFJE 3S97C 3V4UH 4YO0B 3STZA 4M5ZL 3G9VA 4OD3L 1X6LA 4QTHA 3O2DA 4RFEB 3UDWC 5ITFA 2JIXA 3T09A 3MJ7A 4JFPA 4URTB 4FQXC 2WK2A 5JW5A 3SDCA 4GQ9H 1OSPH 1A4KB 3DX7B 2YXFA 3VMPA 1I3UA 4EVNA 2L4OA 4ZQKA 3UBXB 1JF5A 3KXFB 5DD6B 2DWEA 4ODSL 3BKYL 5TE7L 2YPVH 1HIMH 2APWA 1NAMB 5I76B 3I6LE 4NFDA 1EAPA 3MRCB 3ZTNH 1AQKL 2FLBT 4N0UA 3HC0B 4RAUB 3CFKB 4KUZL 3KYKH 1WBZB 2NY4C 3KAAA 3K1DA 4FXGA 2BNRA 1FVDB 3JTTB 4ZTPH 5CGTA 3CVHB 5IGXH 3LKNA 3ZE1E 4YEEA 1YEIL 3WFHB 1EJOL 5T1DL 3RUGB 4DJMA 1RIHH 5DJ0A 4JFEE 5ADPH 2J1KA 3OJVC 1L6ZA 2J6EA 1PG7W 5FYJH 5C08D 1ORSA 2EEBA 3KVQA 1MAML 2DL2A 3OPZL 4X6FA 2XQYK 1HHKA 5AEAA 5E2TH 2CXKA 4TUOA 4JFZL 4IMKC 2OTUB 2AW2A 1KIPB 1QHOA 1OW0A 2BJML 3SN6N 3DYPA 3MLRL 1FFRA 4L4JA 4ZD3H 1P9MC 5D2NE 5D72L 3MMEB 3THML 4OZGE 1VFAA 4IEFB 3QDMD 3TBSB 5EZOL 3VFOA 3OF6D 5E8DL 4OF5A 3S3JA 4QNPF 1FFPA 1JL8A 3C5SB 5CLWA 2A6DA 1YJDL 3KPPB 2A1WH 2K7QA 2OJEB 3OAZK 2D7TL 4RX4D 5GS1A 4M1CC 5E7BA 3CUPB 4HFWA 3FQWA 3IFLL 2CXGA 5J6HB 4N9OB 3ULSB 3MV8E 2Z8RA 1WZKA 4MA7L 3MRLB 4PGCA 5T5NG 1N7MH 1IAKA 2YHGA 1ZT4B 3NTCH 3OV6A 5EU6A 4ZAKB 3CPLA 3UTSA 1SVCP 3H9SA 2WBWB 4L4TA 1UB6B 1TNMA 3ULVF 5I1LB 1AKJD 5J1TC 4MJ5A 1AI1L 2IH1B 5EPMB 3ZDZF 3S35L 1P84K 5JXEA 4KKAC 4RGNC 4Z95H 3VD5A 3NIGF 2C1OA 3S36X 1CE1H 3D6GA 3CH8A 2I9TA 4YWGH 2EO1A 4M6AA 2OQJA 1G9NH 1Z9OA 4FP8H 3MUHL 2RQ8A 1ZTXL 1FDLL 3IJYA 5K9JH 3I02A 1D9KA 5DA0B 3FO0H 1Q1JL 5FKPB 2AJZA 2B0SH 4JY4B 4ZO9A 3D3VD 2HKHL 2JJWA 1U36A 4HKJB 4XBPA 1FQ9C 5C0GB 2MOVA 1HQRB 4BQBA 1P5UA 4KROC 1FYTD 1YEFH 4FQJL 4K9EL 4WW2B 3C8DA 1SBSL 3GJFA 2FBJH 5FFLA 1MFDH 1Y6KR 3OKKB 4L3CB 3MV7D 2X2YA 1DBKL 5GRJL 4QCIB 1CFQB 2BY3A 1OAYL 1UWGH 1CGXA 3O3EA 2ZKHH 3LQMA 5A16B 5E8OB 1E4JA 1A0QL 2Y36H 4KJPC 2NX5E 3OR6A 3QFDB 2H3NB 1L9NA 4HWBL 4BH8A 5I6XB 3QB7C 1KEGL 2YRLA 5DDHA 5GGVL 1QSFB 3VA2C 1KNOB 5ID0A 2UWEF 5L2KE 5IW3A 4EI6B 2RB8A 5IKCA 3CD4A 1QD0A 2R0ZH 3KYAA 5I17B 3RFZC 3OAYH 3V5DB 4F15C 3ME0A 4BQ8A 5F6IB 3QEUB 2GTWA 5JOFA 4YPGB 4ELMB 5DRXB 5CGYD 4ZPTA 4U3XA 1JGUH 4PJAA 5LVEA 4JFFA 3ESVF 35C8L 3C5JB 1C5CL 4PLJD 5F89B 5F96L 2IBGA 4OZHB 1F5WA 3WO3B 1UEYA 4EI5B 4R6UA 3N1MC 3OHXA 3Q1SH 4OF7A 1SYVA 3SPVB 3FT3B 2XPGB 3WFZA 2YA1A 3KLSA 2APXA 3LQAC 5IBTL 1VGKB 5DRNB 2ED7A 4JFQB 3HS0B 1RJLB 3QISA 4PGDA 2EIBA 2EDKA 4HSQA 4PP2A 5B8CA 4M1GL 1D5BB 5JOPD 1RVFL 2CGRL 4WFFE 3B5HA 4NQEB 1FZKA 4HIXH 3WN5B 3O11A 1KPRB 2EO9A 3PP3K 4GJTB 4Z7VF 2CUHA 3QUML 1BZ7A 3MRHA 4YR6B 1RZKH 4UT7L 3EW3B 2ZPKL 4YQXH 3DECA 4U4BA 4XPHL 4KV5F 4ZS7H 3ZKND 2A83A 3AROA 3QIUA 4Z9KB 4G5ZH 5JPNB 3I6GA 1NC2A 3W9DA 5SWZB 1Z5LA 3TCLB 3X11B 4P5TB 3GKZA 2JJTA 2VQ1B 2AXHA 2OS7A 2E27L 3IU4L 4NKOA 2EYSA 1FLRH 15C8H 3NH7H 4CVUA 5CEZL 4ZUVB 4EQ3A 5IFHL 2NY5H 3DRQB 3IETA 3MV11 1KIQB 1GIGL 3LPGA 1XZ0B 3OXRB 4M7KH 4NQVA 2FB4H 2VXQL 1AO7A 2E7LA 3N1PC 4QRUB 4DN3L 1DLFH 3KHQA 4HS8H 3QT2A 3MJ9L 3O6FD 4P99A 4F7PA 5D1XA 5C0BD 2VSDA 1LP9E 4KVNH 4D0BB 2B4CC 1H5BC 5D6DA 4TPRH 4U3HA 4M61B 5J1AB 3W82A 1J12A 1UCBH 3WO4C 3MLSL 4XWGL 3DMMD 3C5ZB 4ERSL 3D0LB 3GI9H 1CE6B 4ZOEA 3MX0A 1HWHB 1SJEB 3FCTB 3L3IB 5EWIL 2VAJA 5LWYL 4QOKB 1IGJA 4JFHD 5FXCH 1G7IB 3QNZA 1A2YB 2OR9H 1ZHKA 1JGVH 1CZ8H 2R23B 3QEQD 1CT8A 4WEUD 3MBXL 1PW3A 5C0AE 4LGPB 1KGCE 4JHAH 1ZS8A 1A7QH 3W81A 3V4UL 4K3EH 1GYAA 3BQUA 5IBUB 1ZHBA 4HS3A 5DGQA 3P9MB 3GIVA 3A6CH 3MXVL 3SQOH 4JFOB 1J1XL 1KFAL 4OD1H 3QUYA 2JIXD 5TF1H 4WUUA 1XGPA 1A64A 3FOMB 4LPWA 4TULH 3MO1B 4KAQH 4OD2A 1ZVSA 4I0PA 3C8HA 2CRMA 2VE6A 3NGBC 5TDPA 1D3CA 4EXPX 4R90H 3SCMA 4OCWH 4PRHE 3QI9B 4WV1B 1P6FA 3ZTNL 4X4YB 4YDLC 3TNNA 4GFTB 5B3NA 4P57A 1ROWA 2OX5A 3VXUD 4C56B 5JLZA 1DBBH 3KPLB 5HDBF 1W0VA 3T4YA 3K8KA 2IQAB 1A6PA 3TN0D 2YA2A 1GC1L 2UZIH 1QSEA 3FL7A 1FG9C 4QHUA 5EOTB 5MHSD 5IOPA 3R0MA 1I8KB 2VLJB 1VFBB 1A6AB 2PR4H 3G5VB 4XMPL 3VFGH 2CKBA 4U2YA 2AJSH 1YN6A 2DYPB 1FG2B 1S9XA 5IMKB 4NWUL 3SE4A 5ADOH 2GTZA 2NZ9D 1TJGL 1UB5B 2QADB 3FQTB 4OQ1A 4RMQA 3ILQC 4IRZH 4NYLA 2BNUA 3WIIL 3N9GH 2QJDA 3P30L 2AJVL 2LVCA 5E2UH 1FNSH 1CGTA 1UYWH 4Y5VC 2AP2A 2D7QA 3LRSA 4MXVE 1A3LH 4O9HH 4LRNL 4HJGA 3LKPB 2A1WL 3NFPA 1K6QL 5FGCB 3GHEL 3GMRB 4PLJC 5D7KE 5KN5A 2ORBL 1EEZB 2PO6C 4Y5XA 3S8WA 4UDUA 4QRQB 3FFDB 1N7ML 2YN3A 2BVQA 3FJTA 2VRAA 2VITB 4NZRH 3UTSD 4TRPL 4L4TD 4H1LG 4FNLH 4HKBA 1MAJA 3MR9A 4OZIE 3PV6A 4DN4H 3BP7A 4TTGA 5C0EA 1J0KA 3MNVA 3GSNA 1WF5A 2P45B 4ODVH 4HUUA 3DSFH 5JXED 4ODBD 3B9AA 4P2CG 5E0QA 1UZ6E 5CZVH 1KLGA 4YWGL 2A9NH 4KH2A 4HUVA 5DK3A 4KKCD 1PKQE 4CMMB 1FN4B 3MYJA 1FNGB 3QZWB 1QPPA 3N06B 4KRPC 2NTFB 2X4UB 3LHPH 3FO0L 4JPWH 1D9KD 4Q9RH 2GUOA 4ZOCA 3DX8B 1ZLWK 4ZO7A 3EJZC 4U1IB 4J3XA 5SWQB 4DUWA 4KVCH 4KQ3H 1DZBA 2W91A 1FGVH 4XXDA 3NOIA 3UAJC 2WNGA 3MRPA 5F9JA 5DURB 5D8JH 1U91B 1I7TB 1JPSL 4GKZB 4RDQF 5FA4B 4NQCE 4TVPE 5ISZB 3RWCB 4DVBA 4X6CF 3O6FC 4M8QA 1SVZA 4JREC 5JR1L 2EICA 3ROOA 4KTDH 1K2DB 1MHCA 4DOHE 1N8ZA 5DUPL 3T3PF 4F58H 1RHFA 2DQUL 5E5RB 3TBYB 4J8RA 5IVXB 5CJXC 1BOYA 4BSWB 2XRAL 2I25N 1C5DA 3DMMC 2VLLB 3EYFB 1FIGH 4JRYA 4MJ6A 4APQA 4UINL 4GXVL 5I0DA 1GJIA 4PJXA 2Y1VA 3C60B 3HA0A 4LQFH 3ZDXF 1F4WL 4HQQH 5CKGA 4UTAL 1WISA 4K7PY 1FGNL 1JGUL 5INCB 5FCUH 4OJFL 2V9TA 4JFFD 2F58L 3BW9B 1DBMH 3FAXA 4HAGA 3UXFA 2V5RA 2NY3D 2OSLA 4MLIA 2YC1B 3F7RA 5DQ9A 1VACA 2VL5A 3NVQA 3PGCB 4CVZB 3T0EB 3TIDB 1OD9A 2Z4QB 3MRFB 1IL1B 4F7CA 3K0WA 4QNPE 1E28A 3SDCC 3QWRA 3BWAB 2UUDH 5CP7A 1MRFL 3F6IA 2FWOA 3NA9L 4XCFH 2XA8H 1JJUA 3WFDH 3WNMA 3DV4B 4Y5YA 4HIXL 4P2RE 3OKMA 4PJGB 1JMXA 1FVEB 1UH4A 1V3KA 4QRPE 4ZXBD 3L5XL 1MCCA 1AR2A 3IKCA 2R4RH 1BF2A 4ZS7L 3ULVE 2PNDA 4XVSH 5F9OL 4YX2L 1NMAH 4JG1L 1NC2D 4XNZB 3V6FB 1K9TA 3SHSA 3WLBB 2GSGB 3ZDZE 1OD7A 3H7BB 1FSKC 3NIFF 5DJXB 15C8L 4DGVH 4ODXB 3NIGE 3I3BA 1HI6A 2IF7A 2NY5L 4Q9CA 1XGTB 3SE8H 1DR9A 2EDQA 3T2PA 4LCYB 2VIRB 2NZ9C 1JPGB 4OT1H 2VZUA 4XWOC 1OW0C 3WE6A 1DBAH 3QIBA 1DLFL 5EO9B 1YQVH 2KKQA 4YDIH 1A4JA 5D1XD 1KJ2H 5I1GH 1B0RB 1UWEL 2HFFA 2W0LA 3DX6A 1MIEH 3GSQB 5LGHH 1IEHA 4OZ4B 4UQ3B 4LHUB 1MEXH 1YPZB 3KJ6H 3L3KB 5IF0B 5CJ8A 3G6AA 5GS1C 3HC4H 1LEKA 2DQCL 5HYFA 2WWKO 3LKQB 4ZYKA 3INUL 4X6DB 1Z9LA 5J12C 1DQDH 4EUPB 3CC5B 2A77L 3TNMA 1EHAA 4P46B 1AP2A 3U48A 5C7XL 3QUKA 4J1UB 2YSSA 4I0KA 4O2CA 5KAQG 1DCLA 4L9LA 1NGWB 5GGRY 2R0WH 3DRTA 5F1IA 4JHAL 1T4KB 2W59A 5GISH 2YZ8A 1I3GL 2FR4A 3QHFH 2VC2H 2BDNH 4K3EL 4UZGA 3PWJB 1YN7B 3F65A 5JXEC 1MHHA 3UJTH 4Y2DA 3BPOB 1HKLL 3BQUD 4J23A 3QUZB 4XAWL 4CMHB 3W11D 2Z92A 1TZGL 4MB4A 4OD1L 2JCCA 4KK8D 2W07A 5IBLC 4KKCC 2QBWA 3FT4B 2X4NA 2PYFA 5FCSH 4KK9C 4TULL 1P53A 4HK3N 3QJHA 4PJIA 4U3CA 4PG9B 4MB5A 4X9GA 4OGAD 4YUEL 4PJFB 4F9PA 1FO0L 1D9KC 4MNGB 1WT5A 4M6OH 3E3QC 3SCMD 4WVRA 3KXFE 3HZYA 3MUGB 4MNHB 3F58L 5C6WH 4JZNA 4CDGC 1D6VH 4Z77A 3NPSC 5AWNH 5FO8B 1IM9B 2EDFA 2ITDA 3CX2A 4HKZB 1DBBL 4I2XE 1A9EA 4WY7H 5E2WH 3PDOB 3TO4A 3K80A 1BZ9A 1AHWB 3RIAF 4V1DB 5E9DE 5AYUH 2LU3A 3OKDB 4A6YA 2BXZA 1QSED 4U6YA 3EOAB 1IGFL 1WAAF 2I07B 2J8UB 1BGXL 2CIKB 5MEQA 4Z7VE 3F8UB 2NMSA 1JHLH 2AQ3A 1C1EH 2R0KL 1HZHH 5MENA 3HLAA 1RJYB 5ADOL 4G43B 4KV5E 5DK2B 1S78D 1LO3L 2Q6WB 4X8JA 1U8NA 3JWDH 1KJVB 3N9GL 4M6NH 1SY6H 1FNSL 4AK1A 1NGZB 4U6XA 3NBNA 4PTTA 2NXYB 4ZNCD 4TSAH 2DIJA 2ITCB 2QV2A 4HIJA 3VXRB 1WCBB 5BS0A 4XVTH 1I8IA 4RQQB 4HULB 5ALBH 2VLKB 3RVVD 2W0FB 2J3SA 4JPIA 5GGUA 3WHXA 3O3AA 1QKZH 2NY3C 4G42A 1NAMH 3HHRB 1S9VB 5HTSA 1X6NA 4NZRL 3JTSB 1MFBL 3QXWA 3NFNB 1WBXA 4FZ8L 4XNQB 5GQBA 4U1JB 4E5XB 1EO7A 3DUSB 1MJUH 1VA9A 2WZPD 5JW4M 1FL3B 4B7LA 4FQQA 1NLBL 5H94A 1NKOA 5EU4B 4DN4L 2QSTA 4AENB 4J4PD 5DWUH 2SEBB 3AAZA 3QQNA 43C9A 4NBYB 3DSFL 4FFVD 5B8CC 1T21B 2WQ8A 3EJYD 4DW2L 2OTPA 5HVWA 5FM5M 4MWFA 1M7DA 4JGJA 4YXHL 3MRJA 4ZXBC 1PQZA 1TJHH 5E1HB 3V9FA 1D6EA 1DN0B 3MLXH 1BJ1J 3KLAB 3SQBA 3M1BA 3Q48A 3W0WD 3ARBA 2D0FA 3DX9B 2LU7A 2UVFA 4JPWL 2GHWB 1NBZA 2JJTC 3DTXB 4ACPA 3HR5A 2UV3A 1B6UA 2ESVA 5KZCB 1RUKH 4GAGH 5KVEH 3QIWA 4XVUD 1JZ6A 4D0CA 4GH7B 1W72A 5D7LA 1JNHB 4IDLA 1QR4A 3VFWA 1CICD 5SWSE 3UTTA 3GSVB 1FYHB 2DLTA 4G9FA 2E7LC 3IS1X 2J5LB 3IDMB 1J88A 4KMLB 3VGEA 2YKLH 1PG7H 4HX1B 2DI9A 5D1XC 3P2TA 4HG4K 3MLUL 3LDBC 5D6DC 2H32A 2X5PA 4YHOH 1F3DH 5HDBE 3IF1B 5GSVB 1GOHA 4L4VA 3VXPB 4KJQD 1Q72L 1QSFE 3T4AA 5HYJB 2AGJH 2BMKA 1RSFA 2VL4A 1IKNA 5CEYB 5I1DA 5JORB 4PJEB 1CXFA 5FCUL 4L8SA 4ALAL 5C07B 3BDYH 4PP1D 3LZFH 1DSFH 3AU1A 2IAMB 4LLDB 4UU9B 4GW5B 4LLYB 5JMRA 3G04B 2DDQH 3BQUC 5HGBB 4OTXL 3W11C 1U92A 5E56A 2MCPL 1JTTA 1JZ4A 1J8KA 4R7NA 4KK8C 1AGFA 2VDPL 5GZND 4NM8H 1MWAB 1IGCL 5IHLB 3WUWG 3CDGB 4E41B 5DRZB 5CHNA 4I0PC 4W6XB 2P24B 4TVPL 2X05A 5AD0B 5IV2B 2WV3A 5F7HA 4PYGA 1KJMA 1S8DB 2C3WA 1U8LA 3ULUH 3SGEH 3ZKXB 4U6TA 3SCMC 1S7TB 4D9QE 1PBYA 1Z2KA 2Z8WC 4NQEE 5EUKB 4AG4L 4HK0B 3IXAA 5FYLE 2R4RL 2KQMA 4NO0A 3IAGC 2PXYA 4XVSL 3QQ3A 2KPNA 3OR7B 1B0WA 3LEXA 3SKMA 4XZUA 1NMAL 3WD5H 3BZEA 1T1XB 3MGAA 4XPAH 2DN7A 4R2GD 1J8HE 1U8JB 2VDLH 2OM5A 2QHRL 1W8OA 5JW3H 5MP6H 2H2SD 4DGVL 3S96A 5D93B 1NFIB 1XT5A 2DM7A 5EUOA 3OKEA 5C0JA 1PFCA 4LSRL 4LEOA 1OGAB 3VXSB 3I6KB 2R29L 1LE5B 2LE9A 1XFPA 1U42A 1ZOXA 3SE4C 5E03A 1F4YH 2PTUA 1S78C 1MH5A 3QO1B 1ZWIB 4X7TA 1YQVL 4ODWB 5IQ9A 2IPKA 1KJ2L 2AEQH 3HNVL 4QHMB 5I1GL 1BVLB 3OGCA 4GUPB 4U1GC 5L0QB 2W38A 4QHLA 1TCMA 5LGHL 4JN2A 3BUYB 2OL3A 3VFVA 4LGSB 1FC2D 2P46B 3PWNB 5J11C 2YD9A 1A6ZA 3NAAL 1YYLH 3KPSB 1QR1B 3GBMH 4NSKA 2D7NA 1JGDA 4Y5XC 1DUZB 2QQLH 3G5YB 4PREB 3QRFM 2P5WB 1KULA 3O6MH 1DQDL 5FYLH 2EIZB 3I84A 5ALCH 4X6CE 1HQ4A 2R69H 4YE4H 2JF1A 1AGEA 2PYEE 3QNYB 5TE6L 5FF6A 3ULVL 1AGBA 2AV7A 4LVOB 3MRNA 3PXHA 3T3PE 2X09A 3QFJA 2R0WL 3QJFA 2VR5A 3UTQA 1UWXH 4PBVC 3NCFB 3VWJB 2VXSH 1OOAA 1GGCH 4J4PC 4C54A 4E0RA 4OFVA 1X4ZA 5AG8A 4FFVC 4IMLB 5DZNA 4IOFC 4K8RD 1J5OH 3WCYA 3V7MA 1PJ9A 1NCWL 2EKSB 3LN4A 4HF5L 4GG6A 4ZUUA 2VKWA 3ZDXE 4R0LA 4Y4FB 5H37G 5ETUA 1S9WA 3SDXF 1EFXA 1TQBB 4M48L 4OF8A 4HGWB 1BWMA 3QUXA 2VNCA 4JN1H 3L7EA 2AXGA 2XIDA 2DD8H 1XGRB 1MY7A 4F7TB 4JO2L 1S7SA 5IQ7H 1LGVA 1MCPH 4I4WA 1R5WA 3ARGB 5AWNL 2CLVB 3NABH 1XH3B 3MLWH 4XVUC 1MFCH 1I9IL 3SKJH 5E2WL 4Q97A 5TDOA 3QDJE 3VXTB 1CICC 1T22B 1QO3A 2MSPA 3TO4D 2C7UB 5AYUL 3CFEB 5C71A 1XR8B 2DLIA 5I18L 2E7BA 2IG2H 2VZ1A 2AK4A 5EG6C 1YNTB 3UBXG 3FN3A 4F7EB 1KOAA 1K8IB 3BRGC 1JHLL 1XGUB 3O0RH 8CGTA 5I1CL 1A6VH 5BZDA 1NDMA 5C70A 3RZCD 1AXSB 3TPUA 4K7PH 2W0KA 5DVNA 1NCDL 1RZ7L 5D2NA 3VE0B 1JWUB 2ZWLT 1FFQA 4UDTA 1WLHA 1WEJL 5HHOA 2VLRA 1N5AB 3VA6A 4QT5A 2CLRA 2DQJH 4KJQC 4WU5B 3IDIB 5EC1A 5IESH 2VXUH 4M6NL 1SY6L 5HI5D 4APQC 4L3EB 4H1LA 4JDVA 3NIFE 4PGEB 3SE3A 3BGMB 1HEZA 3PWLA 4P59H 1T7YA 4GRLA 4PJ7F 1KCSH 4KPHH 5HYIA 4WU7B 1RV6X 2LAAA 5FB8A 5ALBL 5HYSB 4GT7A 3JSSA 4G7YL 4GRMB 4LPCA 3FZUD 2GJ6D 1CLOL 4YHYB 4YDVB 4PP1C 5DK0A 4X4ZA 3SOBL 1QKZL 3U4EA 3GRWH 1GZQB 2DLEA 1X5XA 2IPUK 1BJ1H 3FONB 1Y0LB 2G9HA 3VJ6A 4CADA 4S2SA 2B20A 5H35A 4HV8A 1JHTB 4N0RA 2EXWD 3VFSB 5GZNC 4PRPE 4LVNC 3AB0B 1LK2B 3KPRB 3T1FA 4M1DH 3TYGH 4HBCH 2OR8A 2EIDA 4NPYB 2C4FU 2ED9A 3HUJB 4P9HH 4Y5YC 2XN9E 3MOBH 5I75C 3EYUL 1HILA 1TJHL 2YUWA 2HFGL 4PJDA 1OP3K 3ORJA 3O3UN 1OPGL 4XP1L 2V2XB 1YMMD 1KCLA 3K7UA 1BD2A 2W65B 5F1NA 4P2OB 1T66D 3HZMB 4H8WL 3ARBD 4R2GC 3CFCH 4N8VB 3ZTJH 3U46B 3Q5TA 4LPTA 1GGIH 2XOTA 1DFBL 2H2SC 1UZ8A 3DHMA 5ICXA 1GH7A 2K3TA 1K4CB 4GAGL 5K9KB 2ESVD 5JHDE 3CGTA 1A1MA 4PRBB 3ZHDA 1MUJB 1PEWA 3QIWD 3EGSA 4QRTB 4PJ9A 2GK0B 1EDQA 2GFBB 1MJ7L 2NY2C 4LLUB 2HG5A 5DI8B 3ARUA 3UTTD 1MY5A 2WWMD 3MZTA 4Z7UF 1YY8B 2YKLL 1OM3H 5C6PB 2DKSA 5KVFH 3QDGE 1NH6A 4QY8B 4J6RH 1MCIA 3IRPX 5IG7B 3B9KB 3MRDB 3T04D 4CU6A 4OM0H 1PGRB 4XC3H 4G8FA 4P9MH 5TFSH 4WW1A 4M43H 1A7NH 4N8CH 3ZL4L 4JRXE 4H0IA 2XG5A 4U1NB 4MNQA 4P2QA 4XGZB 3DI3B 1OGTA 4L4VD 4L8BA 3A67L 1EXUA 5I66A 4NCC2 1FRGH 1WAAE 2QEJA 2VDRH 3MNWA 1CG9B 5D2LA 3PGDB 2P1YA 3IDGA 3OB8A 3V2AR 3N1FC 3U36A 3FB5B 3SDAA 3HI1B 5EORH 3RZWA 1OAZL 4LASL 3W39A 5IW1B 3BDYL 1G7MB 2X4OA 3E2HC 3LZFL 3V6OA 3TWCH 3KPOB 4F8QA 2XT1B 1QFWI 2DDQL 4K8RC 4C4KO 3C9NB 4MAYB 3WIHL 4B53A 4R4FH 3MXWH 3ZDYF 1S7WB 5GS2D 1XF3A 4NM8L 1A6TB 1FNLA 4JDZB 5CP3A 1S9KC 3UX9B 5E00A 1X3DA 25C8H 4Z7WF 5ILTH 4WFGD 1T7XA 1IAIL 3OB0H 4IM8A 4F9PC 4JFDE 1KXQE 5DUBA 4TSCH 2CLZA 1IM3A 3QR2A 1WT5C 1FC1A 4H20L 2OI9C 3C8KA 1YNKL 1CDYA 1S7QB 1MCKA 5D70H 1D5IL 4YBQC 4AEEA 4H0GA 3WD5L 3X3GL 3TO4C 3UTPE 3FB8A 2XKNB 5L2JB 3KWWA 3ET9F 4RZCA 2E5EA 4JZOA 3CLEH 5LGJB 4NO2A 5TF0A 4K23H 1G6RH 4NN5B 2F19H 1CGVA 4KMQA 2DIBA 2HN7A 3KPMB 1F4XL 4J3TA 3ELAT 1CCZA 1PAMA 3D9AH 3W9EB 1CLZH 3RZCC 4D2NA 3CJJA 1SYVB 1F4YL 4F2MA 3BKMH 4U1KB 2P8LB 1NFDB 2IGFL 4OCXL 5HI5C 1D5ZB 5D7JA 4YHIB 5B22A 2BNQE 3HN3A 3HMWL 4UIMA 2FECI 3WXVL 2F5BL 3MLZH 5EULV 3RTQB 4HLZG 1NAKH 1HN1A 1KN2L 2BVPA 1TVDA 5DEGA 2B1AH 3NFSL 3B3IB 4WRLA 3I50H 3FZUC 4H26A 3T77B 1Q0XH 4Y0GA 5IR1A 2EDDA 3FB7B 3VU2A 1J10A 4HHAB 5FYLL 4G6MH 5IB1A 5ALCL 2FLRT 5FYJD 4OLVL 3IDUA 3NCJH 4NQTA 5SX5H 4LCIH 5TQ0H 3JWOL 3U0PB 1J9CT 4BFBD 2EXWC 3GK8H 2YPLB 4I9WD 3QFJD 2VXSL 4FXLA 4I48B 4LLMA 3MZGB 4HWZA 1G7PB 4NQSA 4RGMC 4BSVB 4GKSA 4NKIH 5MERB 4OGXH 2R39A 5AUMA 1QYGL 3KYMB 1P7QD 4XPGH 4JN1L 1CFNA 1T66C 2DD8L 3EDKA 3I6LD 4OI9A 2R2CA 3ARBC 3CU7A 2ZUVA 1N59A 2DAVA 4PJ5B 4NN7C 3LEVH 5IQ7L 3DIFB 2ZOLA 3GKWL 4PJFE 4KDWA 4XXCA 4LSSL 3UYPA 1BBDL 4MHHI 4OV5B 5IBUG 1MFCL 3BESR 5HGHA 3RGVA 4DGYH 3SKJL 3QIWC 1IKFH 3HPLA 2XWJA 1PLGL 2YXMA 4WI2A 4BZ1L 3MCLH 2FO4B 4IRJB 2BC4B 5I8CB 2WWMC 2Y7QA 2I60H 4M62L 4JE4B 3B43A 5C0CB 4P3DA 3RWHA 1QLRB 3BE1H 2AK4D 5ESQA 3T8XA 4ETQB 2DQIH 1RMFH 3EBAA 5ANME 4OCLC 4PJBB 4X9HA 3P77A 1R3KB 2PN5A 3O0RL 4ODHH 4ONOA 1KG0A 4FABL 5EBMB 3GUTB 1WJ3A 2I9LA 4K7PL 1YEJL 1IGIL 3VFRB 4CDHA 3BKJH 4WI3A 4NQDB 4ZODA 4UILL 2VLRD 5EU3B 4N1CA 1ZVSB 1I9RH 3GMQB 4JFXB 4HLJA 4P3CH 3WNPA 4N0YH 5IMOA 1C7SA 4OLXH 1FZMA 4P59L 1OP5K 4HS6B 3S37L 5TJWK 5JDSB 2VZVA 3HPJA 4CNIB 1M71A 3TNNB 5I2IA 3VG9C 4P57B 1GAFL 4L8SC 4K71C 3KNBA 2VKXA 4XNYH 2IFFH 5EH1A 4YZFF 3PWUA 1C08A 4QGYA 3MCG1 3WEXA 1C12A 5IP4A 3U7WL 5GGQH 1FZOB 4GLRI 3STBA 2GKIA 1WC7A 1A22B 4PBWD 3LKOB 4MD0B 4NCDA 3OJDA 1KELH 4Y4KB 2G75A 4Z0XB 4OFKA 4S1DD 2XNAA 3MV9B 1KIRA 5DT1L 5C08E 1H3WM 3TYGL 1FZJA 1NGQL 1SQ2N 1QFUH 3LSOB 1ZLUK 5AZEH 2X4QB 2RHEA 5E5MB 4MX7B 4P9HL 5D5MB 2CIIA 3MOBL 4PJAF 3CDFA 2WIIB 3L95B 4YHLH 4RMSA 5BZWB 2DWDA 1KTLB 4P5KA 3PHQA 1NSNH 1XF5B 4M03A 3SJVE 2JK5B 5DEFA 1VGEH 1K8DA 3U1SH 5B39B 4U0RC 5EOCJ 3SDDB 2EIEA 4HT1H 4YH6A 4Y19A 2I24N 5D96B 3LQZA 4MXQD 4HIHB 4XB7A 1BREA 3ARYA 4OGZA 3GSWB 1OT1A 4PY8J 4XBEH 5C0FB 1MRDH 2AJXH 4PJ9D 3SDXE 5JDJA 4O58H 3ES6B 1GGYA 2F53A 1R3LB 4JQXA 4LLQB 1R3JA 4M3JA 3GO1L 1ACZA 1YNLL 2IPTL 1NCBH 5DVLA 3QZWG 5GRUH 4ZPVB 4N90E 2P5EA 4J6RL 1JV5B 1LQSR 4UIKH 2NX5D 4I8DA 4ZFOA 2HJKB 4HUUB 4QRRA 5IWLA 3LS5H 2RFXB 4X5XA 4XC3L 2QR0B 2R1YB 1G7QB 3JVGA 3TBTB 3UO1L 1A7NL 5B4MD 4N8CL 2K7PA 3FQXB 1JPFA 2FIKA 5DJCB 1IFHL 5HY9A 5M95B 5L2KD 1KC5H 4G8EA 4R96A 4MZ3A 3EYOA 2O61A 2P8PB 4TTDD 3B9EA 2XYCA 3WUWA 5I9QC 4PRIA 4I3SH 1KCUL 4N9GA 3MRKB 5FUOL 3VXME 1LD9B 1RIVH 3IDJA 3IDYB 3TWCL 5F7FA 4LSQL 1R6VA 3UPRA 3MSPA 4HKXB 1RZJH 1NGXB 3JV6B 3NACH 3H42H 1ZLVK 5HPMA 4ODUA 4OQTH 4R4FL 3EDFA 4P2YA 3MCKB 1QVOB 4XC1L 3PL6A 4O2EB 1GPOH 2VXTH 4R0LC 3IDXL 5HHXH 1NC4A 1M6OA 2KZWA 3B2UC 5FUZL 1MREL 4WFFD 1DLHB 25C8L 1MOEA 4Q6YA 5ILTL 5DTFA 3JV4B 2HLFC 4BKLB 2GYSA 3RWDA 1NPUA 4MDJA 3QCVH 3QH3B 3AREB 5FHBH 2Z35A 3LS4H 4JRYB 1I1AA 4LKCA 1D5XB 4NZDA 2EC9T 3H0TA 3TIEB 5HVHC 3K3QA 2YD3A 3L3JA 1H3UA 3QG6A 1LWRA 1E6JL 2ID5A 3DVFA 4GLRH 5HYQB 4QWWC 2PW2B 2HVKA 2VDKH 5BOZG 1G6RL 2AXJA 2X7LA 2Y06H 3QYCA 1VKXB 4X4MA 1A14H 1VADA 5C2BH 2OMBA 4RIRA 5BV7C 1MLBA 4NO3B 1PYWB 3ZKMD 5C92A 5MEPB 1G9NC 2OZ4L 3P4MB 5FECA 3VFUA 3BXNA 3H9HB 2NY4B 5D2NC 1KTRL 1F11A 1OGAE 5DC0A 3VXSE 3TA3A 2NY0C 5FOBA 4E9LA 3GB7B 2FWOB 3BIKA 2AKRB 5D7JD 4U0QB 1TCRA 2CKNA 5J6GB 4U7MA 3OG6B 3SE3C 3RKDD 4PY8I 5GGTH 4GRLC 2ICWJ 5T1KD 3VXQA 5FOJA 4OIIL 4MSWA 4U1MB 1MWAH 3U9UA 3AXLB 5F3HA 5DUMH 1YUHA 4WI6A 1XF4B 5ICYA 3U2SA 4JHWH 1R3HA 4IHOA 1I7ZB 1T0NB 3IXTB 2BOBA 3HMXA 1FE8H 4Z7UE 4B7IA 2RR3A 3KPSE 2VH5H 2FD6H 1AIFB 2XKUA 4JO1L 5KTEL 1F45A 1GGUA 3NCJL 4LCIL 2KH2B 3HE7A 2D31A 4M7LH 1UXSB 3GK8L 4AEFA 1KGCD 1I7RB 4S1DC 4ZSOB 2JELH 4RFNC 4PTUA 4LHUG 3PQYE 4YO0A 1ZT7B 2CRZA 4NKIL 4RFEA 1QOKA 1IC7L 1AFVH 1A4KA 3BPLC 2HH0H 4X9IA 4DK3A 3DX7A 3EO9L 5KANG 4EUPG 3TCXA 4P4KB 5C0BE 4NGHL 3UBXA 1JVKA 4XP6H 3KXFA 4UV4H 5DD6A 5L6YL 4PRHD 3LEVL 1NAMA 1A1NB 2ATKA 4M4PA 5I76A 1E4XI 3MRCA 4MJIE 4RGNB 2AVGA 4L8DB 4MXQC 2J12B 4DGYL 3HC0A 4RAUA 2Z31D 4I5BB 4J3WA 3CFKA 4GSDL 1IKFL 1L7IH 3RGVD 3D85B 4AL8H 1S3KH 1QFWL 1WBZA 4PJ9C 1ZEAH 1FVDA 3JTTA 3MCLL 3CVHA 5FYKU 3D39E 3WFHA 4QXUH 1CDUA 1PZ5B 1UJ3B 3RUGA 1MFEH 3BE1L 4Z7WE 5EIIB 2DQIL 4EN3D 4J3UA 4YXLL 4LCCC 2R4SL 3LN5B 3SGKC 1X7QB 1RZKC 2EDHA 4ODHL 1WZ1L 4B41A 5B4MC 4MS8C 2OTUA 4MXWH 1KIPA 2E8ZA 1MNUH 1HYRC 4NZUH 4LQ1A 5KVDH 3IFNH 3MMEA 4FFZH 4P3CL 3L3GB 4OLXL 4TTDC 3TBSA 1TJIL 3BP6B 4DUXA 4L3EE 1TQCC 2GIYA 3C5SA 1K3ZA 2O26U 3KPPA 3WKNA 5D7KD 2OJEA 1VFOA 3LIZH 1ONQB 3BPNC 3CUPA 4XNYL 1N6QL 2IFFL 3O6KH 5J6HA 3EJJX 3ULSA 3V6OC 2AEPL 3MRLA 4NNPH 2Q3ZA 1I8LA 5C9JB 4JRWA 4ZAKA 1ZT4A 3IS0X 5IM7B 3I9GH 4HZAA 5GSRB 2BNRE 3P0VL 4WHYG 3RJDA 3S4SB 1UB6A 2C3HA 3K81A 4JO4H 2ICWI 2V2TB 5I1LA 1ZA6B 2O93L 3FN0H 4LLVB 2I27N 5MEQB 4OZFH 2J2ZA 5I1JH 1B4JL 1AE6H 1F3JB 1WZLA 1QNZH 2IH1A 4HIIB 4YK4C 5EPMA 2X6MA 3BUTA 1VERA 3LB6C 2IC2A 4XP9H 1PEZA 3Q5OA 4HPYL 4CGTA 2IFGA 3H3PH 3ARDD 4YHLL 1YECH 3DETD 1X4YA 1NSNL 1Y6MR 3FRPG 1ADQA 3GMLB 1OQOA 3V8OA 1VGEL 3IJHB 5L88L 1ZKAA 3O2DH 3U1SL 2R0LL 3LQAL 3L7FB 4GG8B 4FRWA 1F8TH 2HP4A 4G6JL 5FKPA 4HT1L 4M7LT 4YDKL 2D0HA 4JY4A 3CXDL 4Y19D 5C0RL 5C09B 2Y9RT 1MIMH 1A6WH 4HKJA 5ERWB 3U7YL 1FORL 5C0GA 2HLAA 3CFBA 1HH6B 1HQRA 4JPKL 1Q9WB 3SO3B 2AJXL 3ZKMC 2B39A 4WW2A 1ZV5A 5DC9B 4Z7QF 5EU6E 1T2JA 4U6HB 2AI0H 3UTSE 3H9SE 2GJZB 4NQCD 4Y4HD 1BVZA 3OKKA 4L3CA 43CAB 5IHUH 4QCIA 1CFQA 2HJFB 2FX9L 4BZYA 2P5ED 3R1GH 5D7JC 1N26A 4AEIH 3LS5L 1S5IH 5A16A 5E8OA 1BQLH 3V52L 3RKDC 4LIQE 4O02H 3DURB 1KBGL 3ZYOA 4B5EA 3QFDA 2H3NA 4G8IB 3ZE2F 2J6EH 4NJAL 1HDMB 3MLVH 1QSFA 1S7XB 4JANB 2ARJB 1OTSD 2R2BB 1A5FH 2EDEA 1YYMH 4EI6A 5DQDH 3QO0B 3FKUS 3EZJB 2MKWA 5I17A 3V5DA 5DHVB 4XX1G 3BN3B 3QEUA 4Q7DA 5TH2B 1FVCB 4YPGA 4ELMA 1ZGLM 5DRXA 3QDMB 3E3QE 5DR5H 2FL5B 4PRID 2B4CL 3C5JA 1H0DB 5F89A 5IT2H 1IZJA 4OZHA 3X13B 3TYFB 3RWEB 2CR3A 4W68A 3WO4B 4EI5A 3H42L 4XPTH 2JLLA 3WS6A 3QG7H 5B3JF 1MLCB 1X5IA 3KS0J 4M93C 3SPVA 2VDQH 3FT3A 5CD3B 2XPGA 3OBAA 4BSJA 4JFYB 1L0YA 1VGKA 5DRNA 4JFQA 1NC4D 2GK2A 5DA4A 5DS8B 1RJLA 1D5BA 2DQHL 1YEHL 4ONHB 1L9MA 4NQEA 2VISB 4D3CL 3WN5A 5K9QG 1KPRA 2YD1A 4LIQH 3LS4L 4YR6A 4OUOA 4CAGA 1OB1B 3K4AA 4POYA 4ORZC 3RGVC 4ZOAA 3S35X 1AGCB 5IB3B 3RDTD 3RVXD 4GAJL 1FAIL 5SWZA 2JCCF 3EAKA 3TCLA 3X11A 1A7OL 4U1HB 4P5TA 4HIEB 2VQ1A 4PS4H 1L7TL 4PJIF 4EN3C 3BISA 2Y06L 4ZUVA 4PJAE 3GSUB 4JFFE 4H5SB 4ZNEA 1ZT1B 3DRQA 1KIQA 5CJ5A 3AU1B 4LNVA 4RNRB 1XZ0A 3OXRA 4XB8A 4UAOB 5SV4A 2YS4A 4Z8FH 3CDYA 3BIAX 3WNOA 3CXHJ 4QRUA 3VG0H 1FYTB 2F74B 3EZ8A 1OAXH 3AC0A 2YMXH 2J88L 3F62A 3MV7B 4IS6B 4D0BA 4S1RL 2CO7B 2WANA 3OMZA 4M61A 5J1AA 4KDTA 2AJYL 4NNXB 5I8KH 3L3OB 5E4EC 5F7NC 3C5ZA 4K07A 3D0LA 1CE6A 3IB4A 1SJEA 3FCTA 4PUBH 1T2QH 3L3IA 1NGPL 4JM4L 5T5NF 1M1SA 4QOKA 4Q6IB 5GRYA 3BO8B 1G7IA 4M7LL 1A2YA 3DGGB 4Y5VB 5A43C 2YR3A 2R23A 3NMEA 5HGDB 2JB6B 3VMOA 1CVSC 5CJQH 3WDJA 1A7BA 3ARDC 2H8PB 3P9MA 5DGRA 1TMCB 3RP1A 1FFNB 3DETC 4OM1L 4JFOA 1AO7E 1BZQK 4WENB 2P8MB 3FOMA 1QBBA 3MO1A 3UYOD 4PJHB 4MA3B 1KPVB 4UV4L 5DFTA 4N0FB 3KXFD 1NMCC 3OZ9H 3ARWA 4WV1A 1QA9B 3QI9A 1INDH 5JUEH 3MLYH 1O0VA 2D7OA 3MRIB 4X4YA 2G2RB 3BAEH 3T2NL 2YUXA 1YZZA 4C56A 3MOQA 3KPLA 5E9DD 4TQEH 2IQAA 1BQHB 4JQXC 1NJ9B 1UCTA 4Y4HC 4EQ2A 1NEZB 1MFEL 5EOTA 4UT6L 2APFA 4KWUA 3ILPB 3DV6B 3RVUD 1I8KA 3SKOB 2VLJA 1VFBA 5LQBH 1A6AA 3G5VA 1NLDH 1E4KA 5T1MB 4RFOL 5IWLC 3GZKA 1OY3B 1TVHB 2DYPA 4U1LB 5D6CB 1FG2A 2MFNA 5IMKA 1ULVA 3FN9A 1A7RL 4PJBE 4MXWL 5KJRL 1CGWA 2OP4L 1UB5A 1Y6NR 3FQTA 5DMKB 2FIRT 4G7VL 1T1ZB 3M45A 1V8HA 5E24E 3C6LD 4WUUE 2XZCL 3PWPB 4JY5H 5F7WC 1OTTD 1WIUA 4WNQB 5J13C 3O6FB 4NZTL 4H88L 1KJ3H 4Z7NF 1FL6B 1LEIB 1RZIB 4MA8H 3LKPA 3GMRA 5JMOC 3EOTL 4AIZB 1Q0YL 3O6KL 3QA3B 1EEZA 5KVGH 5J0BA 4QRQA 1F00I 3FFDA 4EIZC 1DVFD 2VITA 3I9GL 2ZUTA 4X5WB 2YRPA 5EOCL 2YD5A 4JO4L 3VGFA 1QSEE 5D4QA 1IGTB 4DEPC 5I1JL 5KSUB 4OLYL 2BVYA 1QNZL 3FMGH 1TETH 3MV9E 4XP9L 5HYSG 1MELA 3MOAH 2Y4SA 1N64H 3H3PL 4FFYL 4X98B 4NKDB 2V17H 4U1SB 4I77L 3KPQB 2ADFH 4KDVA 4JG0H 1IC1A 3TZVA 1CR9L 4YXKH 4CMMA 2FX8L 3QDAA 5IJVB 1FN4A 1ZANH 2V7NB 4JO3L 1FNGA 3RVXC 3Q6FB 3QZWA 2NTFA 3G6JB 5C8JB 2X4UA 2OXGA 4LSPH 1HCFX 1ETZB 3BP5B 4HDIB 5FB8B 4HMCA 3DX8A 3V4PH 1MIML 3MRBB 1A6WL 4U1IA 5GS0H 4UQ2B 2HRLA 5SWQA 2NY7L 5FDWB 5SWSD 1BECA 5K9OB 1HHJB 4LRIA 3VXUB 2AI0L 1DEDA 1U91A 1I1YB 3PNWB 1I7TA 4LDLB 3TA3C 3TN0B 4GKZA 5FA4A 2HKFL 3ULUD 5ISZA 3RWCA 1KEMH 2IMNA 4N8VG 1TVBB 1S5IL 3KPTA 2DQTH 4YBLC 2FDBP 4O02L 3I3DA 1K2DA 1X5GA 1HCVA 4BZ2H 2CKBH 3MLVL 2X4RB 3WSQL 3TBYA 1E4XL 1CD0A 5IVXA 4BSWA 5EUOF 1QSFD 2VLLA 3EYFA 1A5FL 3PP3H 5FK9B 5DQDL 3O8XB 2CK0H 1G0YR 2KZ1B 2N4IA 2D9QB 4O51B 3IVKB 2J8HA 1CGUA 3Q2CA 3C60A 1F6FB 1U58B 3VFPB 4CU7A 3DUHA 1DQLL 3HE7C 5INCA 1G9MH 4KTEH 3VGHA 3AS3A 1UEMA 3HTLX 5D71H 2WINB 3BW9A 1EUTA 1DQJB 4CN6A 4NT6B 3JWDC 1UM6H 2YC1A 4JJ5B 1RULH 4U6VH 4XPTL 3MFGB 4CVZA 3PGCA 3TH3T 2R1XB 3T0EA 3TIDA 5CWSB 5T3ZE 3O3BB 1REIA 2Z4QA 3MRFA 1IL1A 3VW3L 4XI5D 2EDJA 4XH2B 1V3MA 3H8NA 3BWAA 3VI4F 1J87A 5FHAH 3Q0HA 2UY7A 4F33B 4D9QD 4NQED 4PJGA 3RGHA 2MPAL 1FVEA 1KUMA 5FYLD 3GSNH 3RU8H 2FJHB 5DC4B 4JRYE 4QF1B 5A2FA 3W2DL 1Q94B 1J8HD 4S0TD 1KCVH 2QQKL 4GG6F 1AQDB 3QHZL 3SDAB 2F54B 3V4VL 5F7MC 3V6FA 3SGDI 1I1CA 4P5TD 2GSGA 2ICWB 3WLBA 4JQIH 1HOCB 3H7BA 5DJXA 3RVUC 4DKFL 4QXTB 4UI2A 4ODXA 2EDLA 1LO2H 3HCVB 1XGTA 4UT9H 4TNWK 1ED3B 1D5MB 5F1OB 4E42B 4LCYA 1N5YL 4U2ZA 2VIRA 3NPSB 4XMKH 3DROB 1SEBB 1JCKA 3K4DA 3ZT5A 4I3RH 5EO9A 2MTPA 4NRZB 3C6LC 5HHQB 2YPKB 4KUCD 5T3ZH 1OTTC 1B3JA 1YMHB 4OUUB 1B0RA 3GBNH 3GSQA 2BFVH 4OZ4A 4UQ3A 3X14B 2PTTB 4LHUA 4K3HA 1EZVX 1YPZA 3ARRA 3VCLB 3L3KA 4W4NA 5IF0A 2BVOB 4WTXA 4OB5H 1B2WL 1T20B 4Z7QE 1GHFH 3LKQA 1CF8L 1DDHB 2B1HL 2BSTB 4ZUTB 4X6DA 2PYED 4IOIB 5CIPB 4EUPA 1I8LC 3CC5A 3QRGH 4P46A 4Y16D 5TQ2H 1E27B 1W0WB 2DMBA 4J1UA 4G9DB 4HXAL 3ZE2E 4Z6AT 1NGWA 3ZLQC 1T4KA 5CMAB 5T1LD 4NFCA 3PWJA 1YN7A 1PDKA 1EO8H 4F2MB 4W81A 3QUZA 2X9WA 4NNYB 2NR6D 4S1QL 4OKDA 3STLB 1QFWM 4R97C 4DKDC 1Q38A 4PLKD 1I3VA 2GAZB 3PF2A 3FT4A 5HDLA 1HH9B 1NMBH 4PG9A 2N56A 4LSUL 4PJFA 1FO0A 4MNGA 3OZ9L 1TTGA 1INDL 4PRAB 3BAEL 4K94H 4LBEB 3MUGA 4MNHA 5INDB 1JNLL 1OARL 2EECA 5B3JE 3OG4B 5FO8A 5IUSA 1UGNA 4KMTH 1IM9A 3V6ZB 3TH4T 4HKZA 5HPOA 3HB3D 4QEGA 3OWEA 4C56D 4ZXBB 3PDOA 1IT9H 1GXEA 1QBAA 3GHBL 1F3RB 4PG2A 1AHWA 4V1DA 4XVJH 4CRPA 5I1HL 4IIQB 4WW2C 4PJDF 3OKDA 1N6VA 3RIFK 3EOAA 4KZDL 3WJJA 3D2UB 2I07A 2J8UA 3ULUC 4KKBD 4JY6B 1DEEB 1NLDL 3I75B 2CIKA 5FM5O 3WNLA 4UTBL 4AIOA 1CFSB 4U33A 5ACZB 3B2VH 1ZLSH 2DYPD 1N3NB 1RJYA 4G43A 3WKML 5DK2A 5E6YA 2CDEB 3O45B 5I6XC 2GQHA 2Q6WA 3ZT7A 4BK4A 2JCCE 1KJVA 2O5XH 3DPBA 7CGTA 1XCTB 1QLEL 1SHMA 4HMDA 4X80L 1NGZA 4PJIE 2ITCA 3VXRA 5F6IC 1WCBA 4MA8L 5ITBL 4RQQA 2MQ3A 2VLKA 1CTOA 4AM0B 2W0FA 3FQRB 1KT2B 1LEGB 4O4YH 3EDJA 1ZLWH 3AM8C 1EV2E 5I30L 1S9VA 3FRPA 1SJHB 3JTSA 4K3DH 4EI5C 4XNQA 1U2CA 3NFNA 4WUKL 4E5XA 3MA7B 3WS6C 3DUSA 3RWHB 2M2DA 3TVMD 1FL3A 2DF3A 4RA3A 3ZYIA 4XI5C 5KSBB 5KS9B 3MODL 4C57C 2QKIB 3P77B 5EU4A 4LSVH 1MF2H 5D2LF 3HNTH 5BO1L 3AGVA 4AENA 3FMGL 2SEBA 5BJTB 3MOAL 2XN9D 4PGBB 1JZ7A 4GRWF 3DYMA 1CLYH 1T21A 5MENE 1LILA 5E6ID 3IDNB 3WN5C 1UT9A 1EHNA 2V17L 3GDBA 5BW7A 1ITCA 4X6EB 4KGLA 1IEBB 1UVQB 2PETA 1FV1B 1ZANL 4MLSA 5HD8D 1DN0A 3ZZ1A 3KLAA 5JNYB 4OAWB 1D7FA 5D7IB 1NBYB 2A9MH 3DX9A 4LSPL 2YWZA 1HHGB 1ODAA 4P5TC 5IHZB 5BS0E 3DTXA 2BZDA 4OQTA 5JHDD 1O7SA 2Z0BA 2QSCL 1CQYA 2DM2A 3MQIA 2P44B 4KK6D 3VDAA 3C08L 1JNHA 1DL7L 5D7SH 1M05B 1C8PA 3WMSA 2EDYA 3GSVA 5F9WB 5DURD 4XRCB 4NN6B 1RI8A 3FT2B 3QDGD 3IDMA 2ZCKL 4IRSD 2DIAA 5B39G 4HX1A 4XNUL 1JRHH 5EU5B 3I2CH 4A6YH 3RHWK 3S98A 3ZMRA 5I16B 4MZ2A 4J12A 4JRXD 4BZ2L 3DUUB 3PHQB 4Q2ZB 1N0XL 1F90H 4FQXD 3IF1A 4KDTC 4DTGL 5GSVA 3VXPA 4HXBL 5DJAB 2CK0L 4FTVB 5HYJA 5DD5H 5CEYA 5JORA 4PJEA 1UA6H 1PSKH 3C60D 4Y16C 1OLZA 1VFMA 4U1GB 4KTEL 1XGYH 1T3FB 5KAQF 5C07A 1YDPB 2E6PA 2YBRB 3HNSH 4LMQE 4NZJA 4XCCL 2E3VA 2AABL 1JGLH 1RULL 2IAMA 4LLDA 4UU9A 4GW5A 4LLYA 3G04A 5F93C 5D7LE 5HGBA 2NR6C 1U8IB 1OAUL 1JHKL 4CW1B 2DLFH 3SKUD 5GGTA 3GMMB 1KB5B 3AMLA 4G9FE 4PLKC 3VFNB 4R3SB 4Z7NE 2WBJB 1MWAA 4LP5A 4S1SL 3CDGA 4E41A 3P4NB 5DRZA 4JFDD 2P24A 5IV2A 5EZIL 4GW1B 5AD0A 4HWNA 4FQ2L 1I9JL 1S8DA 1S7TA 4WV1C 3GSNL 3VRJB 5EUKA 3RU8L 2E9WA 4HK0A 1E6OL 5KW9H 4L4VE 3HB3C 2RCSL 3OR7A 3RX7A 1T1XA 4DAGH 1JZ2A 4LGRB 3JV0A 1U8JA 3R0NA 1ZHNB 3W0WB 4RGOH 2E6QA 3BKCL 4KKBC 4C4KT 1TIUA 1NFIA 4UT9L 5JHLH 5E2VL 3WDIA 1E4KC 1R0AL 4FQHB 1NCCH 1I1RA 1OGAA 4XMKL 3OL2A 3I6KA 3VXSA 1LE5A 4P4RB 5JQ6L 1ACYH 1BJMA 3OX8B 4X6BB 2PCPB 2AQ2A 2Y6SD 4DKEL 3QWOB 4CUCA 2V7HB 4K2UL 1W72H 3TESA 1CICB 5MI0C 3QO1A 1ZWIA 5A1AA 4HWEL 4ODWA 5T3ZL 4QHMA 1BVLA 2VYRE 3K1KC 4GUPA 4MYWB 4EOWH 1AH1A 2W60B 5E7FA 1A47A 3BUYA 3FOLB 4DGIH 2NW3B 5GRWA 3PWNA 2Q1EA 3GNML 5I1IL 2QQNH 3DYOA 2LVEA 3I85A 3KPSA 4RRPG 1QR1A 2APBA 1U6AH 2B2XL 4NP4H 2H32H 4LCWB 4YNYB 1LK3H 4BA8A 1DUZA 4PREA 3G5YA 2JJSA 2P5WA 2EIZA 1AR1D 3FFCB 3QNYA 3N1GC 5TQ2L 5DD1H 3TVMC 4P46D 4L8CB 2X7LB 4HAFA 3CFJB 5DO2C 4WI7A 2FO1A 3V7AG 1RUMH 3VWJA 2BCKB 1F58L 1PKOA 3BH9B 3WIFB 2GY7B 5EUOE 1A6UH 2AXFB 4IMLA 4LVHB 5TPWH 1RD6A 2F9BT 3L5WB 5E6IC 1P7HL 1CXIA 3NN8B 1SM3L 2EKSA 1A3RL 3G9AB 3MRRB 4NKMB 3RNKB 5GJSL 5I8OL 3FAWA 2Y07L 2A74B 4OLZL 4Y4FA 5HD8C 1NMBL 3LCYA 3K2UL 3MLPA 3TT3H 1XGRA 4W6YB 1QFOA 2Z93B 4F7TA 2LTQB 1B0GB 5CCKH 3FO1B 5JOEA 4OLUH 5DD3H 5JW4R 1NANI 3ARGA 4G6KH 1U95B 4RWYL 2CLVA 1XH3A 3BH8B 4KK6C 1P7KB 2Y23A 4PD4K 3QAZB 3BEVB 3VXTA 1RUQL 1T22A 2C7UA 4OFPA 3CFEA 1XR8A 5E4IA 2G5BB 4LRIC 4MB3A 3IAQA 1EVTC 5FO7B 4LARL 3FQNB 1G1CA 4IRSC 1YNTA 4OIBA 5FGBA 4F7EA 1K8IA 1IC5L 4I9WE 5EZLB 5DVOA 3TFKD 1XGUA 5L7XH 1N4XL 5EO0B 4XP5L 3MACH 3Q3GB 3FO9B 1AXSA 3NA4A 4NDMB 1HSBB 3VE0A 1JWUA 1EGJA 3WFEH 1V7ML 1KXVC 4HJ0D 2EH8L 1N5AA 4GG6E 4WU5A 3KYNB 3IDIA 3T0VA 4K7FA 1TZHB 4L3EA 4OFYD 1UM5H 3TLRA 4PGEA 3BGMA 3F6LA 5F7EL 1DQML 5J4MA 3C60C 2ATKB 1T0PB 4ISVB 5GGSB 1KV3A 2R56L 3T0BA 4D94A 4WU7A 2UZXB 1VHPA 2DQDH 5HYSA 4R8WH 4GRMA 4F37F 5E1AB 2NW2B 2OL3H 4YDVA 3VGAB 1GZQA 4OFDA 1I3RB 1LO4H 2IQ9H 3FONA 1JI2A 1Y0LA 4DCQB 4X7FC 2VDOL 3Q6GL 4RWHA 3DVGB 3IFOB 1JHTA 3VFSA 2AK4E 3O9WB 1Q9OB 5HI3D 4LSVL 1LK2A 5BVJB 2ZOKB 1JF1B 3KPRA 1DP0A 3VRLF 1T83A 4NPYA 3HUJA 3MFFB 5EOQH 2HWZH 5DJZB 2ED8A 2XTJB 3LMJH 3SJVD 4K8RL 4QTIL 5HHOE 1I9EA 2VLRE 2V2XA 2E7HA 1CBVH 3ARVA 1VESA 3S4SG 2MCG1 5BRZB 2W65A 3GM0A 4P2OA 1UKSA 4P23B 3HZMA 1LVEA 4N8VA 3U46A 1BPVA 4XNZC 4LLWB 3O4LB 4JLRB 3DXAA 1EEQA 1X5KA 1BBJB 1K4CA 4HCRA 1BWWA 2P47B 3LVEA 5K9KA 5KZCD 4PRBA 1MUJA 4QRTA 2GK0A 2GFBA 3PP4H 4LLUA 5DI8A 2ICES 3SY0B 5I1KL 2Y6SC 5HHMB 4H25B 1YY8A 4N90D 1CXHA 5IB2B 1NL0L 5CBEB 2CDFB 5EBLB 2MQ0A 4QY8A 1U8OA 3B9KA 3MRDA 5IG7A 5L9DH 5DFVD 1G7HB 4NUGL 4HH9B 5CUSL 5DQJB 4ODTL 1JK8B 2FEEI 1CL7I 5HJ3B 5BV7H 4U1NA 1NANH 4XGZA 2WUCH 3RZCB 4JGUA 3S34H 3EYVB 3P0YL 4PJDE 5TDNB 5E5UB 1QUNA 4LPXA 3UTZB 5CSBA 4YHPB 4WHDA 1TDQA 1QBLH 1P4BL 2XQBH 1BD2E 3GFUA 4LEXH 1CG9A 1MCQA 1PSKL 1AR1C 5J57B 3PGDA 5EFIB 3L5IA 3GEWB 4NJ9L 1MHEB 5JO5B 3FB5A 4P46C 3OKLB 4H1LH 3VXMD 3T2OA 3X12B 3HI1A 3D69B 3LOWA 2HLAB 3CFBB 3M8OH 2W1NA 5IW1A 3EYQC 3HNSL 5C07D 2NQCA 1G7MA 3KPOA 2LU4A 3QCTL 1U8PB 2GJ6B 3MROB 3K8LA 4G3YL 3WFCH 1I75A 3C9NA 3BPOC 4MAYA 4TUKL 1RFDL 4FMFA 4CMHC 4UOW0 2JE8A 1S7WA 1FNEB 1RZ8B 3B9DA 3HAEB 5FEBA 1ZA3B 1P1ZB 3BEWB 1A6TA 4JDZA 1A3QA 4JGMA 4DKAA 5M7QA 4JB9H 3RA7L 1QZ1A 4E41D 1B90A 2BRRL 4EDXB 4G8GB 4TSBH 3ILQD 4L5FH 3SDYH 4W4OC 4KK5D 1S7QA 2FYYB 4MNQE 4P2QE 4BJLA 1BLNB 1SYSB 4OCRH 2EYTB 4DAGL 1DQQB 2O5YH 1AHWC 2XKNA 5D2LE 1YMMB 4PIRF 4NUJB 5L2JA 1BIIB 3CFDB 1MQKH 5HI4D 5TGBB 5LGJA 1OCWH 5E08L 4GRWE 2PO6D 3WFBL 2W0PA 5GJTH 4NN7B 4CBPA 5JHLL 1IQWH 3TFKC 3KPMA 1KENL 4JR9L 2EKJA 3A6BH 3W9EA 3CK0L 3V6OE 1ZHLB 2Q8AH 1OGAD 4X7DC 3VXSD 3S5LB 1KPUB 4WO4D 1RZGB 3TBWA 3ROLB 4ONFL 4U1KA 2GT9B 1K5NB 1NCAL 2P8LA 4HJ0C 3VGBA 1FAKT 3T0WA 4DQOL 1NFDA 3KJ4C 4OCSH 1D5ZA 4O5LL 1RK0B 4HK3J 4YHIA 1LO5B 4QHKJ 5I74C 5EO1B 5IHBA 4EOWL 4PR5B 1CU4H 3RUGF 3RTQA 3QUMB 2D2OA 2NY1B 1FIEA 1PG7X 3B3IA 4MD4B 5IIEB 2C26A 5CJOH 3T77A 2HJLB 1R5VB 3KPSD 2YEZB 3FB7A 2G60H 2AJUH 3T1WA 4KRPD 3C2AH 5KOVC 5HHNB 4NQUA 4HHAA 4F80A 2HT2D 3P4OB 4RMUA 5DD1L 2UZYB 4F9LC 1R5IB 5DVMA 1IMHC 3U0PA 3P11H 3EJZD 4KHTH 3QULB 1WITA 5HI3C 2YPLA 5ESAB 5A2JH 1TNNA 5SX4H 3PQYD 3VWJD 4I48A 3UAJD 1O7VA 4GRWH 2IALB 5TPWL 4I18B 1G7PA 1CL7H 1EEYA 1RUPH 2NXZB 1Z3GL 2R2HB 4BSVA 1OAKH 2FSEB 3NZHL 5MERA 3QPXH 5BW7C 3LH2L 1MVFA 4IJ3B 1P4IH 3S88H 2QTEA 4Y4FD 3KYMA 3N50A 5LKNA 1S9YB 5IFAL 5DHYB 4PJ5A 5AYQA 5CCKL 1RURH 4MJID 5CP3H 2CRYA 3DIFA 5F71A 1RZJC 4R4BB 4AMKL 2X4PB 4OV5A 3ARGD 2DM4A 4NC1C 1TPXC 3D39D 3TJEL 4JM2B 1T1WB 3MC0A 4PJCB 4IRJA 2FO4A 4PPTA 2BC4A 5I8CA 1EO5A 1IVLA 5C0CA 3EYSH 1QLRA 2NY6B 2AS5M 5DRWB 2J5LC 3UYRH 4ETQA 3GI8H 4ZTOH 4PRDB 5CIPH 1IQDB 3U0TA 5J1SC 1T89A 4PJBA 4Z7OF 4PBXA 1R3KA 3EIFA 1IARB 5DFVC 3NCEB 5IMLB 3K2MC 5D1QA 5EBMA 3U4BH 2MHAB 3GUTA 3TV3H 1WQVT 3IRZA 3WFEL 3VFRA 4GQ9L 1OSPL 4NQDA 3SDCD 4UNTA 4YFLF 5EU3A 3D18B 1KB9K 4WCYH 1BQHG 3GMQA 4JFXA 1UM5L 4WW2F 4L3ED 1OP3H 1NEZG 1HIML 2YPVL 4HS6A 4KQ4H 5JDSA 1M4KA 4CNIA 4FS0A 3ULUF 5KSAB 5IEHB 2XACC 2B7DT 4HFUH 1UM4H 5E8EB 5F97E 2VZTA 3BT2H 1JZ8A 4NQXB 2ENYA 2OL3L 3KYKL 1T5XB 1U3HA 4ZTPL 3R4DA 1CYGA 3BYYA 5IGXL 2IQ9L 2BNRD 3NCCB 4QHKI 2IAMC 2ZSWB 4MDIB 1FZOA 1RIHL 3LKOA 1T1YB 4MD0A 5ADPL 4WI5A 5L8JB 4Y4KA 5FYJL 5DLMH 1QBMH 2HRPH 4Z0XA 3TH2T 2NNAB 2YD8A 3MV9A 4DUVA 1U8KB 5I19H 1NCUA 5CSGA 1CS6A 1YQ2A 3J8F7 3LSOA 5E2TL 2X4QA 5E5MA 4MX7A 4ELMF 5D5MA 2WIIA 3L95A 4XWOD 4ZD3L 4UNVA 5BZWA 1KTLA 1UACH 3GIZH 4OZHF 4A2MA 4KK5C 1WBYB 1XF5A 5T5FH 4OCYH 2JK5A 2C3VB 1BVKB 4BUHA 5B39A 4P2OD 5HHPB 3SDDA 3PHSA 2VR9A 1P7QB 5HI4C 3HC3H 1A7PH 3V0WH 3L6FB 4HIHA 5F3BB 4ZFFB 2X1WL 5D93C 3GSWA 1Q9LB 1R3IH 3NTCL 1JNNH 2XG4A 5C0FA 5EU6D 4HH8A 3PP4L 2QL1A 3VWKB 1FL5B 3ES6A 3H9SD 1R3LA 4LLQA 4WO4C 5DJYB 3VRIB 3DARA 4HC1A 3BP4B 4ZPVA 4JFEB 1JV5A 3GJEB 4KZEH 1WFUA 2HJKA 4Z95L 2HMID 4ORGB 3ECBB 3PJSB 2RFXA 4R26H 2QR0A 2R1YA 5L0QC 1G7QA 1BOGB 1CE1L 5EN2A 3TBTA 3UZEA 2Q86B 3FQXA 2V2WB 2XWTB 5BV7L 5DJCA 5IBLD 5GRVL 5DD0H 1G9NL 3TZVB 4KK9D 4FP8L 5BQ7B 5K9JL 2DQGH 3FO2B