1E4XL

Crossreactive binding of a circularized peptide to an anti-tgfalpha antibody fab-fragment
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
214
structure length
214
Chain Sequence
b'DIQMTQTPSSLSASLGDRVTISCRASQDISHYLNWFQQKPDGTVKLLIYYTSTLHSGVPSRFSGSGSGTDYSLTISNLEEEDIAFYFCQQGGALPFTFGSGTKLAIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLDSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TAB2
molecule tags Immune system
publication title Cross-Reactive Binding of Cyclic Peptides to an Anti-Tgf Alpha Antibody Fab Fragment: An X-Ray Structural and Thermodynamic Analysis
pubmed doi rcsb
total genus 54
structure length 214
sequence length 214
chains with identical sequence M
ec nomenclature
pdb deposition date 2000-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1e4xL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1e4xL01
3TV3L 3UC0L 1BREA 4BM7A 5EU4A 1RZKL 2HT3D 4XRCA 1UZ8B 2YUVA 1S9YA 3OKOB 5L8LB 2DAVA 5GS0C 4Y5YB 3M07A 3HNVH 5DUPH 3MLPA 5FUOH 4PJ7E 5I30H 5DS8B 5JTWA 4OZFG 2FLRT 3C2AL 2LVEA 5JIHA 3FQXA 1A3LL 2J4WL 3O0RH 5JR1L 2YUXA 4H26B 1XIWD 1EO7A 1AR1C 4K55A 5ID0B 4OLYH 2ORBL 4ODXA 4YHZH 3SGDI 5FA3B 1RZ7L 2KH2B 4Z7UE 3HC0B 1B0RA 1OTUD 4GUPA 4OZHF 2ZKHH 2APFA 4GQ9L 1JI1A 4XBEH 2HTKD 4PR5B 3D85B 4XCNA 3PP3K 4X8JB 5I8KH 3V5KA 4JGJA 3MRFB 4NKMA 4OM0H 1QD0A 3O0RL 1A3RL 4WUKL 3WIIL 4PJ7B 3MV9B 5GZOC 5E2JA 2C3WA 2NXYB 3GSNL 4R4NC 4XNXH 1MFDH 4IOFC 3ZMRA 3L6FB 2J6EA 2APWA 1A22B 4PRID 3RX7A 4Q9RL 2VZUA 3SDCD 5KSAB 1WK0A 4HS3A 4S1SL 4XP4H 3WFDH 1AO7A 2X4TB 1DQLL 5DLML 4HXBH 4Z7QF 2IAMC 4L1HA 4QOKE 2NY5H 3D1MC 4BSWB 1N6QL 3LZFH 3RJQB 5J3HD 4Z7WA 1DLHB 2VITB 1MFDL 5CJQH 3DTXA 4CMMB 4Q74A 3CSGA 1ZHLB 2MFNA 4YXKL 2NCMA 2XNAA 3IFLL 1SEQH 3UROR 1VEMA 3T0EB 1KJVA 2VDMH 4JN1H 3BP7B 4OCNC 3V7MA 2AJZB 2DQDL 1OW0C 1OTTC 4GKZB 4TVPE 4Z7OE 4LK4A 3B9KD 5J56B 2FBJH 3LCYA 5SWZA 1F42A 5B39B 5IJKC 4YHPB 1W72A 1XGYH 5F7NC 5C0GB 1CDJA 5D1QB 5T1DL 4KXZI 4GT7A 3GM8A 3G5YB 1WGOA 4H1LH 4NT6B 3Q6FA 3L3JB 1JBJA 4MA1C 2Z92A 4QOKD 3HE7D 3D69A 5CUSH 3QI9A 3RWJB 1CT8A 4PJCA 1BVKB 1U36A 3WHE0 4XX1G 4RAHA 5FYKD 1A47A 3QEHB 3TO4B 1IGIH 3HE7A 4OF0A 3OKNA 3L6FA 3BWUC 3KLSA 1I9RL 1MIEL 3EFDH 2ZOLB 4LDEB 2A9NH 3U4BL 5D7SL 1FYTB 1JK8A 3CNKA 4LQFH 2ICEB 5KOMC 2O5ZL 3TZVD 4JFPB 1IAKA 5HGDB 3HR6A 1PEWA 3C8KA 1S5IL 2BX5A 1UZ6E 2BVEA 4M1CC 4XXCC 1NCAL 4XX1E 1R3JB 1I1AA 5IIEA 3ARRA 2HWZL 3RWIA 1PAMA 3L3GA 2AP2A 1WSST 2EDDA 5DJAA 1NANH 4RGOL 3NPSB 2O93L 5L88L 1ZLWH 1QYGL 5F9WB 4L5FH 4Z78A 1TPXC 4TNWF 3GSUB 1Q1JL 2NY0B 4JHWH 4NQVA 5ADPL 4Y5VB 3LQAH 3ZTJG 3J8F7 1VKXA 4UQ2B 5HHXH 2HP4A 1IAIL 3FTGB 4DAGH 2FZ3A 3CVHA 4EUPH 5F9OH 5IW6A 2J12B 4JHWL 3SDCB 2PW1B 1VERA 1TFHA 5CUSL 4CVUA 3QB7C 4NO3B 5FECB 1X5HA 4KKCC 4R4ND 4BZ1L 4Y2DD 4QWWD 4ZFFB 4PJ8D 2CDFB 2M26A 5CEZH 1ND0B 1YN7A 4EN3A 2VUOA 5BS0A 6FABH 4YPGB 2DL9A 3G6JB 4C58B 4M7KL 1RUAL 1S5HA 5GGRY 3RWIB 1QQDB 3BZDA 4KKLD 4ODWB 1A7OL 1SYVB 4NUJA 4I0PB 4RMVA 2R39A 5IB4B 5H2BA 5HDLA 5T1MB 5DQ9A 5GGTL 1RURL 2PN5A 4FZEH 4NM4L 4G9FA 2A0LC 5CBEB 2XXMB 5CFHA 5D7IF 3ABZA 2V17H 7CGTA 2ZP0T 4PS4L 2DQCH 5BV7L 3VXSB 2AQ1A 3FQUB 5D9SB 3V4PL 1H3XA 1IAIM 1K3ZA 1Q9OB 3U9PL 1NAMB 3TH3T 5IQ9B 4KJYA 1IGIL 3IDXH 4XNZB 2J5LB 4H25B 3RWHB 3V95A 5EG6C 4ZS6C 4JFEA 1S3KL 1ZHBB 3KPRB 1QBAA 4BFIB 3AB0C 1CYGA 2BJML 4MWFA 1A6UH 4JKKA 3CX2A 4Z76B 1C5BH 1N6UA 3M1BA 3RNQB 4ZPVA 1TCRA 1C08B 5C0GA 2OK0H 2ZKHL 1AQKL 3OHXA 3C6LA 1UWEL 1BX2B 2R15A 4JFDD 2XTLA 1FSKB 1QRNA 1KSRA 1EFQA 1XT5A 1ZHNB 1UCBL 2JF1A 1YN6A 3SKUD 3FN3A 4K23H 3PXHA 4I3SL 3R8BB 2IQAB 3IU3B 1KJVB 3H9HB 2BSSA 2DRUA 4W70A 1VESA 2DYPA 2R1YB 5E00A 2OTWB 2Z8SA 1FLRL 5DZNA 1R3IH 4PRNB 4X4MA 5DMGD 5D7JD 1CIDA 1WFOA 2ENYA 2XWBB 1XZ0A 3MOAL 3SDDA 4V1DE 3OHXB 4HXBL 5DHVA 5C71A 1QNZH 5IEKA 1TETL 2AJXL 4X98A 1JZ3A 4JDVA 1CFQB 2J1KA 3AMLA 5DK0B 1UENA 2AV7A 5DSCA 4L3AA 5HY9A 1FPTL 2GY7B 4XNMA 2Q6WA 5E24E 1FYTA 2XICA 2MKLC 4XPGL 4BH7B 4U31A 2IG2L 1LK3L 1PG7H 5D72H 4L29B 4GQ9H 2VXQL 1FNSL 2AK1H 2KZWA 2X4NA 5CEYA 4TRPL 4LHUG 2H32B 3HC0A 1DFBL 1HYSC 1OAYL 1FCCA 4P2RB 5GHWH 1GL4B 1LE5A 4Y4KC 5EWIH 2MPAL 3VG9C 4AIXA 4P2QD 3GMPA 3ILPB 1E28B 3BW9B 5DYOB 3SKOB 3OAZH 4KAQH 1NKOA 5I30L 2WP3T 5CMAA 5DS8A 1NEZG 5C0CD 3HNVL 4PB0H 3D3VB 4KROC 5KS9F 3W82A 2GT9B 5F1SA 1HSBB 4JFFD 1DBBH 3MLVL 2XT1B 2G60L 2RIKA 4PLKD 4W4OA 1J8HA 3NMEA 2ZPKL 2K7QA 5MENB 2JJVA 2A6JA 4NOFA 4JREB 5L6YH 2CIIB 1AI1L 3D9AH 3SDXB 1H3WM 2X4TA 2EICA 5EC1A 4XXDB 3MLTB 4Y1AD 3CVHB 2NYYC 1E27A 1U58B 3QFDB 4KWUA 1KGCD 3P30H 4PJ7A 1TENA 2V9QA 4JPVH 4TULH 2WINB 4GAGH 1I3VA 1T2JA 3UJTH 2AQ2A 5HPMA 3KYKH 1OARL 3WFEL 2ZSVB 4G6ML 5DDHB 5DQJB 4CNIB 4N68A 1U8JA 3P73A 1OT1A 2NY5C 3MRCB 4P9HC 3F7QA 2X44D 2BVUA 4IOSD 4RMTA 3VWJA 3OGCA 1WTGT 1LP9E 2ZUSA 4JLRA 1LO2H 1VFOA 3GKZA 3RWCB 5TGBA 4D9RD 3NCJL 4O00A 3M8OH 1IEHA 1I9IH 5J0BA 3U30B 4ZUVA 5DRZB 5JQ6H 4Y8AA 4N8VG 3CGTA 2CRYA 2APTA 2P44B 3SQBA 2QSTA 2IGFL 4L9LA 3RNKA 4C57C 2R0KH 5I1GL 4DGVL 1ETZA 5AZEH 4NGHL 5MP6L 1B6DA 2FRGP 5LXGH 2ERJC 1AGCB 3PWPD 4NDMB 3PWPE 1HINH 3MUZ1 1Q94A 3EJJX 2X09A 3AS0A 5JIPA 1IC7L 4HWNA 4M62L 2GK0A 3MLZH 3N9GH 4QNPE 3A0OA 1F2QA 5HI5C 2G9HB 2QV2A 3DBXA 3UPRB 3GDBA 2DBLL 3KPLB 1H5BB 2DQTH 3BMVA 5C09E 1JPGB 3D2UA 3BXNA 3FB6B 1SYSA 4M4RA 3N06B 3GK8H 3S34H 1JZ5A 5J89A 1NH6A 3B8YA 3VG0L 1Z2KA 4RISH 4ZMAT 5KSUA 5JW3H 4MLSA 5EFIB 4NP4L 3BN3B 3MGOB 2D03H 2VLJB 2EH7L 4NO0A 2BY0A 1FVEB 4APQB 3BZEA 1KCUH 3X14A 2HLFC 4O2EA 2R2BB 4JQIH 2X1PA 2NZ9D 3KHQA 4OZIF 2DQJH 2YPKB 4HULB 1AH1A 5FHBH 3QDGB 1ADQH 4MCYA 3HMXL 3VCLA 4WEUD 3ZDZE 4YC2B 1FNAA 4PTUB 3RUGF 4DOHE 2V2TB 5DR5H 2B20A 1MI5E 2ARJA 1EUTA 5C0AD 4X5XB 5AUMB 2OTPA 4OFDA 3CK0L 3GKWH 1OCWH 1G84A 1ZK9A 4OTXH 5DVOA 1N8ZB 4JO3H 2NW3B 5B3JF 3PUCA 3QUXC 4JQVA 2DIAA 2PYEB 4OCMC 4PRPB 4CMHC 1TJIL 2XG5A 4LPYA 4RAVA 3PP4H 3LKRB 3TZVB 1RK1B 1XF5B 4XCFH 3WIHH 3TP4A 3SGKC 5KVGH 2VZVA 1IEAA 3ARXA 3B8SA 5FA4B 5D2NB 3UTSD 2G2RA 4JFXB 5CZXD 3BP4B 2BP3A 5HGGS 1EO5A 4N0FA 2FO1A 4YHKL 4YUEL 4OV5A 4YO0B 2E7BA 3HI6H 4RQQB 2ESVE 3FO9B 3MUHL 1A1NA 1AD0B 1BJ1H 3L5IA 3SPVA 4PLNC 3FAXA 4YNYB 3MNWB 3ZE0E 3LVEA 5D1XB 1UACL 2NY2D 1G7LA 5D2LA 4S1DD 3SDYL 4GH7B 4KK5C 3LV3A 1CGVA 2UZIH 5C7XH 5L2JB 1FYTE 4X83A 1FZKA 5B4MC 3WJLC 2UUDK 1S9XB 2GY5A 4IRJD 3V6BR 5HYJD 4L8SB 4YX2L 4LDLB 5IKCB 3QUYB 2BNRE 2EIBA 2IH1B 5AD0B 1G0YR 5E1AA 4X4ME 1VA9A 4LLUB 5CJXC 1FLTX 4PTTA 3T65A 5C7XL 8FABB 3D18B 2Q3ZA 5JOFB 5FM4A 3S37X 1LEKA 4L8BA 1HYRC 4R96A 1MIMH 3FO2A 4G8GB 4OZHB 3O45B 1FYTD 2ZCLH 4QYOA 2UY7A 3ESVF 3QHTC 4J4PD 1V3JA 4AL8H 4B7LA 5CJOH 4FTVA 4WFED 4FQJL 5TH2A 4YUEH 1X5GA 5HYJB 5F1NB 4J2XA 5J12C 5C0JB 5MI0B 4N0UB 4ZFGL 1ES0A 2R56L 3TYFA 4Y4FA 3LQZA 1Y0LA 1DL7L 2DLEA 1MCPH 1LO5B 1G7IB 1S7UB 4P2YA 4PGCB 4LCIL 2VIRB 4HKZB 4G8EB 1MWAB 1F4WL 5ISZB 1RFDH 2EEDA 2F19L 2IFGA 4C83B 5JW3L 1I7UA 4NOBA 3VGAC 5HDQH 5FCSH 1U91A 3I75B 1LO5A 4OFIA 1BBDH 3PGFL 4LSPL 4NRYA 3CUPA 3W2DH 3MRMA 5E1HB 4Q2ZA 1T1XA 2Y7QA 4XT1C 4W68A 4U7SA 5F7MC 4H0HB 5DJZA 4P57A 1WBXB 2V7NB 1U8NA 1I75A 4U6YA 4H8WL 1T7XA 4N1CA 1UH3A 2EDHA 3MODL 4PY7A 4F80A 3VMOA 4G8IB 4YC2C 5T3XD 3OTTA 4HIJA 4S0SD 3FFCE 3NH7H 4OQTL 5DJZB 1DBKL 5DMIH 1AGFA 2QHRH 4KHTH 1UB6A 4OLVH 1CBVH 4DKFL 2DM3A 1D5ZA 3W0WD 4XPAL 2NPLX 3FT4B 3DX8A 4WV1A 5C6TL 2XA3A 4XH2B 2E6PA 4GG6E 5A16B 1UA6L 1JGLH 1UXWB 4JRXA 5IFAL 5ISZA 1ZLUH 1XR9A 2BC4B 4L1DA 4QKXB 3OWEA 1F3JA 3TPKA 2FWOB 4YE4H 2Y06H 3R1GL 1AY1L 3RWEA 4ONOA 2GJJA 4NRZA 3UYOD 5FGBA 1NFDB 1A0QL 1RUPL 4WJ5A 1IRAY 4DVBA 3T3PE 4KK6C 5I1EL 5EC2B 2OSLA 3EZJB 1T5WB 4M5ZH 4UB0L 1UM6L 3ARDD 4KI5D 3HUJA 5B38G 3IDJA 4HIJB 2GTWA 4KI1A 4NPYA 4PJ5B 2NLJB 2JB6B 3N1FC 1FFRA 1CFNA 1H15B 1A9BB 2CGRL 4KRNA 3DURB 4URTB 3VWJB 3CZFA 3EO9L 4AH2A 1HCFX 5SWSD 2EIEA 1K5NB 4JR9L 2F54E 3D0VB 2NY4C 4JZJC 3V4UH 3OBAA 3TT3H 4F15C 5J6GA 1WUNT 2OR8A 4NO5A 2XWJB 3F65A 1U8MA 3TCLA 1A7PH 4FQLL 4PD4J 4JFYB 1G7PB 5CD5C 4PJGB 4ORZC 1FO0H 2KL6A 4JY6B 5DD3H 3H42L 5EOTA 2HH0L 1P84J 3WD5H 5MERA 4JDZA 5E6ZA 1DL7H 2YD6A 3RVVC 1DN0A 4LSTH 2VDNH 1CDBA 4HZLA 3T0WA 4UDUB 1ZA3B 2BNUA 2CLZA 1A3LH 4HPYL 4TRPH 5TDOA 4PJ8A 2DQFA 3NN8B 4OFYD 1ROWA 5E2UL 3QEQB 4I48B 4M9OA 3L7FB 4Z7NE 1WT5A 1ONQB 2GK2A 4N0UE 1S7WA 2N7BA 4P9ML 5EOQH 5T3XL 4KK8D 3HLAA 1KCKA 5I1HL 1A14H 2OQJA 3IT8D 2VL5A 3AXLB 1FVEA 4YDIH 1CLZL 1FJ1B 4APQA 5KSBF 1KEGH 1MAMH 1K4DB 5C0BA 2LV4A 2IQ9H 1J0IA 1IT9H 3QISA 4FQQB 2UZXB 4G9DB 5EA0H 4PB0L 3T0EC 4PJBE 1FVCA 2ADIB 4HIXH 5BQ7B 3ULUE 3P77A 5BRZA 1S9WB 2FHFA 2O5XH 3L3OB 4W4NA 4JFFE 5T5FL 2H26B 5F3BA 4HIEA 4WCYL 4JM2B 2BC4A 3GMNA 1UJ3C 3SJVE 4RGNB 4I3SH 4R97B 5JQHC 2AAVA 1HDMB 4ODUB 2YXFA 2CK2A 3MUGA 3LH2H 5K9QG 2X89A 4HWBH 3L3DB 3MCG1 2NMSA 4PJXB 1CK0H 3MNVB 4N1EA 1QHPA 5ICYA 1GYAA 4Y1AB 3RA7L 2EZ0D 1N5AB 1K9TA 5MHSD 2ZUTA 5DRNB 5DA4A 2O61A 1G7QB 3SPVB 1BFSA 3QWOA 2P45B 5DXWA 4IMKC 3WS3B 2ADGA 1NBQA 1MHEB 4HBQA 4DCQA 3NIDE 2X7LA 4L3EB 4X4ZA 1ITBB 3WXVH 1KJMB 4P0DA 3C5JB 1NFDF 1GZPA 3CDCA 2BSRB 3EOTL 3HHRB 2V17L 3MBED 5JIKA 1DDHB 3L95B 3ARGB 3B83A 2GFBA 4RMRA 1RULL 4XCCL 2AJUH 2Z8RA 4HUUB 5IJVB 4OD2B 4TSCH 1IKFL 3NFPB 1A7OH 1TZHB 4LOUD 5EU6D 3X3FL 1CICC 1CICB 2B5IB 2JJSC 1MVFA 3T77A 4RZCB 4N0YL 1ZE3C 4MZ3A 2BSTB 4LLVA 3E2HB 3T4YA 4F7PA 1OTSD 4YHNA 3GBNL 3P9MB 3RHWF 4L3EE 1LK2A 3T8XB 3IJHB 3ZDYF 5JQ6L 1AIFA 2XY2A 1RJZA 3RY4A 1QSEB 2DM4A 1IGCL 2GW5A 3E8UH 2BFVL 3OXRB 5FM5O 4A6YL 3ARYA 1CXKA 4GMTL 4PP1C 5A3IC 3BPOC 2DQIL 3QFJE 3IDNB 2CH8A 3RWDA 3S96B 3VGFA 3RQ3A 2MWCA 4IM8A 1LEKB 4PYHA 3QRGL 3B9KA 2NR6C 1DBJL 4C56A 1A64A 3LN5A 4IDJL 1I1CA 1BFOA 2DQHH 3WYRA 5F9AC 3MV7E 3GO1L 4L5FL 2A9ML 4JPVL 1QBMH 4D2NA 3VXOB 2ZJSL 4TSAH 3QEUB 4CADB 3LQAC 4ETYA 4ZQKA 3EYUH 2DD8H 2H1PH 3GMOB 5E8EB 3RU8H 5J11C 3RAJH 3I3EA 5EUKA 3O6FA 5EU6E 1BM3H 1X5XA 4M5YL 4KTEH 4PBWD 1NBZA 1WV7T 1NCAH 3CU7A 1AGDA 1ZOXA 2PW1A 4OD3L 1EA9C 1L7TL 3LN9A 3VGBA 4HUXA 4NO2B 3BGMA 5L2KB 2KUTA 2DIBA 2EDWA 3OR6A 3P2TA 1DBBL 1EEUA 1QSVA 3SY0A 1FGVL 3PL6C 4OFYA 1A5FL 2DQEH 1P9MA 1OB1A 3AB0B 2A9NL 4KK9D 1HH9A 4ESKA 4GMSL 2FCBA 2EC8A 4L9LB 3RNKB 2JCCE 4NQXA 1MEXL 3VXQA 1YY8A 1CL7I 4OV5B 3TNNB 2DBJA 2Q8AH 1KJ2L 4MJ5B 4U6HB 4E41E 3OKMB 4ORGA 4FQ2L 3G04B 3KYOB 3B2VL 2ZNWA 3CCHA 4NCC2 2HFGL 2P1YA 3CLEH 4QHUB 3WFZA 3PV6A 4LLYA 5F7DA 1VGKB 2IPKA 4YXHL 5E8PA 4K7FB 3AVEA 2ITDB 3JTSB 2NY1B 2ZSVA 3GMQB 3HA0A 5ILTL 2B39A 3TJHC 2XQBH 4BSJA 1VFMA 4XB7A 3KPTA 3QJFA 4NJ9L 4WY7H 3F12A 4KGLA 4YEFA 3DRTA 1I1RA 2XWTB 1LQSR 4NM8L 5ACMA 4BH7A 4WDIA 1U3YA 4I77H 3D5OF 1QFWM 4OKVA 4QNPF 1T5XA 1CFTA 1MREL 3O2DA 3B3IB 2JIXD 2NX5A 2NY7L 3SKMB 4F37F 4F3FA 1RSFA 1R3LB 3TO4A 4O5LH 2I26N 3QPXH 5AWNH 2V6HA 1DQLH 5TFSL 1VFUA 1DVFC 4IIQA 1K3IA 4JVPA 2JTDA 5JOPE 4F7EB 3I50L 2PTVA 5F3HA 1EXUB 4XVJL 1FFNA 2APBA 4M61B 4G9FB 4XP5L 5CBEA 5HGBA 5EIQA 2CRIA 3U9UB 2A6IB 3SKJH 5GSRB 5IB4A 3LHPH 4Y16C 1IGYA 2AJZA 2YKLL 3FT3B 5INCA 1NLDL 1AXTH 1VADA 1ZHNA 1INEH 2NR6D 1JHLL 4M61A 4KHXL 4P5KA 3DMMC 1YQ2A 1RZKC 3NCFB 2P7TB 4KV5F 4ONGL 4Z7WB 1QSZA 5C09B 3VFRA 5I8OH 1D5XA 3A6BH 3C2AH 4ELMA 2AK4B 1C16A 4FXGA 3QQ4B 1BQHA 3BISA 1RUQH 1G6RA 2MHAA 5EIIA 3H9SD 3G6AA 5DSCB 3VFMB 5I1DA 1ORQA 5D7LE 4G43A 2FJHB 1ZGLB 3PWNA 4LPUA 1LD9A 1Y6NR 2QJDA 2RGSA 5F1KC 4NQEB 3MRPA 5TF1L 1FLRH 3D39B 1MJ8L 3RL1B 3QO0B 2XOTA 3MFFA 5DHVB 1YPZB 3O2WL 5L8KB 3NFSL 4X80H 1S9VA 2LAGB 3L3GB 5DJYB 5HHOA 3JVGC 3SE9L 1F3DH 4BKLA 4XBEL 2AVGA 2X89D 4OF5A 5ECJE 5E4EC 1S9VB 1UWEH 2Z31C 3BEWB 4AJ0A 1T7WA 4NYLB 4NC2B 2OK0L 4QY8A 1WWWX 4PRBA 3U0PA 3TBYA 2VLRA 1CD8A 1J10A 5GRYA 1JGDB 1OGAA 2V9TA 5F9DC 3SQOH 4LCWD 1S9YB 4PGBA 1TCRB 5FGSA 2EDJA 1ZANH 4AEIH 4KU1A 2ZNXA 1G6RB 2MHAB 5BOZG 4DAGL 3FRUA 3VXRD 1EGJA 2OL3L 5JUEL 4DKAA 3MRBB 2AK4A 3V4PH 4U1SA 5EC1B 3BZFA 4BQCA 4PS4H 4O5LL 4UT9H 5HDBE 3QDJA 3FFCD 1YEJH 5CINL 1NAMA 4AT6A 1FNEB 3TV3H 1T2QL 1ED3B 1QKZH 5D7JA 4XNYL 4NKDA 1N2RB 3SHSA 1P5VA 5J12B 1CR9H 3MPCA 4K8RC 2W1NA 3QSKB 5I1KH 3NBNA 4M7KH 2DD8L 2H1PL 4HH9A 1HXYA 3LN5B 4ZNEE 4YWGH 2VSDA 5K9QI 2QL1A 1XF1A 3PHQA 4PRDB 4HQQL 2R9HC 4U1MB 3QWRA 3OV6A 4XWOC 4UT9L 5FHAL 3OXRA 1JV5A 2NY2B 1T7YA 2ZUVA 3LB6C 1NC4A 4U1IB 1FG2A 2DWEB 3IYLW 5KSVB 2D0GA 4MQSB 4NO3A 1EHXA 3NABH 4Y1AE 3DVNB 1HE7A 4HKXA 1FGVH 1R3KA 2I9TB 4GFTB 4R7NB 1J1PH 2ZSWB 3HZKA 4YBLC 4JJHA 5FYLL 4UI2A 1L0XA 5JXEC 5JPMA 3FRUB 2P5WD 3QHFH 3DX6B 4JY5L 3QUXB 1HH6A 2EXWD 4Z77B 3LDBB 2YUZA 3K4AA 4YHPA 4MMXC 3VI3E 4RIRB 4V1DD 1J9CT 3TZVC 1BM3L 4PB9L 4K7PY 2IPKB 3GSRB 3QFJB 3WN5A 3QQ3A 1S78D 1WEJH 3CFIC 3WBDA 4EI5B 2H41A 2GITB 3NPZB 1YDPB 5GSVB 3GSWB 4U6TA 2R69H 4DGIH 4CL7A 3BEWA 3G04A 4FQPA 2J6EL 3WE6A 1YDPA 3GMMB 5GSVA 3K2UH 1F8TL 1BLNB 4MLIA 4WW1B 5GGSB 1V3KA 3GHBL 3PGDA 4P59H 3LS5H 4D0DA 3ARBB 5EBWB 2F53B 2EDLA 1I3UA 5LCVH 1BGXL 5FO8B 1I85A 3D39A 4ZPVB 1CZ8H 3MRGA 4K71C 4XP9L 2OL3H 3TN0A 1NAML 4Z76A 4JFPA 4EXKA 5GRXG 3ZTNH 4OLWH 5LAXB 5B8CA 4WENB 4IHOB 1HEZA 3V0AC 1MJUL 2OI9B 5IWLC 5FYJL 4QCIB 4NKIH 1JZ4A 2YPVL 2APVA 1BQHB 2VXTH 5JHDD 5EULV 3IJSB 4ELMF 1KNOA 2CUHA 4P5MA 4XPHL 1CT8B 2DDQH 5SX5K 2VZTA 4MXQC 3O9WB 4P46B 1O7SA 1AXTL 4NNXB 2MQ0A 4E42A 4Q7DA 3RDTB 1T0NA 3OKDA 3GMRA 1IARB 1KELH 4Y19A 1IZJA 1D5BA 1FO0A 4ODSH 3ARTA 5JNYB 3CH8A 3OKYA 4WEMB 5F21B 1HHHA 4AMKL 4KMLB 1DQJB 2W0KA 3X12A 5IB3A 5GRJH 3EJZC 5CZVL 1MJJA 4CVZB 4KKLC 3GSQA 5HXMA 1HQ4B 2HRPL 4OCYH 4C4KT 5LGJA 1H8OA 3C2SA 5IHZB 4Y5YA 3LSOA 5ALCL 2VDRL 1N2RA 1MCOL 1ERNA 3F7RA 1JF1A 2JB5H 4X0KA 3OX8A 5D7JB 5D8JL 1K4CA 1EXUA 1T2XA 5HYEA 1RUQL 1AGBA 2CPCA 4HC1A 35C8L 1L0QA 3QEQA 1MJ7H 1YC8A 2H45A 3QH3B 4IRSC 2AGJH 5M7QA 5T3XH 4JPWH 2DMCA 4OM0L 3MGTA 5L2KD 1IQDA 3UAJD 4O2FB 5I74B 4PJBB 3V6ZB 2EDQA 5ILTH 1P7HL 5D2LF 2AEQH 4G6FB 4HLZG 4Q9BA 4HK3J 4PJFA 4R7DB 1A6PA 1INEL 1G9NH 4I3RL 3RIFK 1HHJB 1B90A 5L0QC 2WBKA 3ZE0F 5IF0A 4NUGL 1TZGH 1DN2A 2EKSA 4MDJA 3HZYB 4XP5H 1YNLH 2VAAB 4F58H 4BKLB 1HZHH 1MCEA 2F53D 2JB6A 1D9KC 1MF2H 3QXAB 4RDQF 1T3FB 3VW3L 4MHHI 3O4OC 3O4OB 3VFTB 5C3TA 4L8DB 2FJGA 3MA7A 5JOPD 4AG4L 1YYLH 3NVQA 1OB1B 3C60D 3KPOA 1ZTXL 1NFDA 3QIUC 2NX5E 3VRJB 1IAOA 1IL1B 3MTRA 3GUTA 1P2CA 2QQNH 4O58H 4A6YB 1UG9A 1WC7A 4PJDB 2V2XB 2BY2A 4M43L 5IBTH 4RMSA 2ICWJ 3EO0A 3SOBL 4LFHG 1OSZB 4HKBA 3EO1A 5JLZA 3G5YA 2VDNL 3I6KA 4H88L 3L3IB 1E0OB 3FT4A 3MJ8B 4U1LB 4YXLH 1J1OH 1A1MB 5TQ0L 2V7HB 1XGRA 4TPRL 4K8RD 1J05A 1CLOH 3HI5L 2ZG3A 3I6LE 3RPIA 1REIA 1HCVA 1M7IB 1JUFA 5HI3C 4RRPA 2D9CA 5EPMB 3IETB 1NCCH 4Y0GA 4F2MA 3G08A 3FKUS 1P4BH 2ENSA 3CFBA 4QHLB 4WO4A 1QACA 4OIAA 3HFML 3Q1SH 1ZLSH 2APXA 4DK3A 1K2DB 4D0BB 4Q9QL 3FJTA 4HS3B 5HHVH 3KWWA 4FXLA 4X5WB 5FGCB 1KIRA 4JZJB 3LEVL 4YBLB 4KZDL 3MLXH 1I1YB 2AQ3A 2X9WA 3VFGL 1RUPH 1U3HA 4TSCL 5K59F 4LEXL 4JRXD 2AJUL 4G8FA 1NANI 3BEVB 4LLWA 4UILH 4YQXH 1BECA 4IDJH 3BZ4B 2C1OA 2XACC 4PJDF 5HVHB 4GUPB 3HR5A 2FGZA 4N8VB 4OB5L 2BOBB 3A67H 1LILA 1CL7H 3MRNB 5LWYL 1XIWA 3R4DA 1TMCB 4KTYA 4F9PC 4PGEA 4HGKC 3KYOA 2Z93A 3FO0H 4OLVL 4PG2A 1AKJB 1IGCH 1WAAF 4MXVF 1ZT7B 4U1NB 5FGRA 5DMKB 4GOSA 5KTEH 4ZFZB 3MV01 4LKXB 2VDOH 4ZO8A 4RMUA 5DMJB 2ERJB 2XA8L 2GQHA 3MNZB 1HKLL 5D1XC 1N5AA 2BNRD 5K9KA 2FWOA 3QHZL 5ICYB 2VN4A 1UM5L 5IKCA 1MLCA 2HG5A 3HRPA 1GOFA 4X6CF 3MUGB 3WL9A 4KVNL 1RZFH 3RI5K 3OKLA 5C8JB 2O5YH 4RAUB 5T3ZL 4L8SC 3ULUD 5EO0B 3WSQH 4K9EL 4NQSA 4IRZL 2QQQA 1RY7B 2FEEI 5E08L 1LDPH 5K9KB 1ZT4A 3TN0D 3FMGL 2Q1EA 3KPMA 3MCKB 5BRZB 2QKIB 5JORB 4JKMA 3CMGA 3DETD 2AK4D 1BVLA 5CP7B 2XFXA 2AJSH 2IBGA 3EGSB 5ESVB 2IAND 4KY1L 5T5NG 1KG0B 2IJ0C 1CU4L 4KJQC 5IR1A 5KANI 5GIRA 5JHDA 3S96A 3FT2A 3ARDC 2EYTA 2AEPH 3IRPX 1P4IH 4P3CL 4PGDB 2NY4D 4L8CB 2P5WE 4PJEF 1VFAA 2G2RB 4JFXA 3DHMA 3HG1D 3H7LA 1WBZA 2BVPA 3SKNB 1DQQA 3HAEG 1A7RH 3QAZB 1LK2B 3TH2T 2FNBA 5CD3A 4E9LA 1U91B 4NHUB 3CXDL 3BP5A 1C8PA 2BRQA 1ZA3A 2BNUB 2CLZB 4XAWL 5TDOB 4P2CG 1FBIH 1X44A 1FN4B 1QO3A 2X42A 4NFDA 4Y4HA 5IVNA 1A1OB 5CWSA 5D1ZB 5L7XH 2DN7A 1F45A 4WEBL 1IT9L 1DQQB 2CJUL 5F1IB 2BVQA 1RUKL 1GVIA 3KPNB 3TNMB 4AIZB 1U8MB 5AZ2L 5KW9L 1OD9A 3OAUH 2AV1A 5KN5B 2B8OT 3W9DA 4QYOB 1KACB 4RBPK 1IQWL 4AENA 1H9VA 5IR1B 4OCXL 4ONHA 5DJ0A 5IW1B 3RWGA 4JKWA 2BDNH 4NC1C 3UJIL 3OF6A 3QUZB 1OM3L 4OF7A 3CVIL 3TO4C 1X5AA 2PYFB 1IGTA 2XKUA 4CBPA 3RPIB 4PJIB 3D18A 4WUUB 4OM1H 1Y18A 3C60A 4DOHB 3O6KH 2E8YA 4OUUA 1MUJB 4HAFA 2BZDA 3GRWL 5HGAA 4L4VE 3NOIA 1MCQA 3WO3B 4MCZA 4JPKL 3STLA 5D1QD 4HGMA 2DLHA 2VZSA 5J1TC 2MMXA 1CE1L 3OKKA 4ODUA 1HILA 1ULVA 3I02A 4UBDD 5J11B 2V2XA 1I1FA 1YEHL 5CBAB 4M7LH 4XPTL 1N64L 4CDHA 2WWMC 4MQXC 5GQBA 1NGQH 4LRIC 1C5DA 1TQBC 4F9LC 2DBLH 4FMFA 1CE6A 1DR9A 1AR2A 4GW5A 4CDGC 5T33L 4FFZL 3WNPA 5MHSE 3X3GH 2JELL 4O9HH 2MSPA 1CGWA 5E5UB 3MA9H 5EOCH 4FQQA 2DLIA 5FYKE 4MAYB 1T1YA 2A6KA 4YO0A 1AGFB 3VFUB 2WIIB 3ARUA 3GB7B 4UB0H 3OJVC 1NEUA 4WFGD 4PIRF 5CJBA 2E27L 3KLHC 3MRDA 3C5ZC 2ESVD 5DF0A 4CN6A 1X6LA 2CKNA 3SE3A 2YUWA 3MXWL 1NBVH 2HN7A 5D70H 1I9IL 1WIPA 1U8NB 4LSPH 3UP1A 2BHUA 1U8JB 4J4PC 3O6FC 2ICWB 1TQCB 1UA6H 1P6FA 1P7KB 1NCDH 5JW5A 2BVQB 1MCKA 1UC6A 4IDLA 4ONFH 3FL7A 4S1RL 4UDUA 1IGML 5F89B 4HD9A 1RJYA 2XZCL 5DD5L 1U41A 1MQKH 2I9LB 1KCRL 3ZE1E 1Z5LB 2FIKA 5D70L 4TULL 5ACLA 2RQ8A 5C70A 5IBTL 5DT1L 1V7ML 2X05A 3A6CH 3I2CH 4OZIE 4CW1A 3CFBB 3MODH 3VCLB 1JVKA 5I17B 4F2MB 2D7PA 4MB3A 4X0KB 4OCSH 1HSBA 4Y4KD 5EUOE 1A9BA 4WGVB 4E41D 1F00I 3V6OE 1W0YT 1EMTL 4HUMB 4OZFA 5I1GH 2YPLE 5CMAB 2PF6A 4HGWB 4PJAF 2YD4A 2E7LC 5DI8B 5T33H 1OAXL 2NY3B 2WIIA 3GB7A 4UUJB 1J05B 1QFWI 4XWOD 4XZUA 3W2DL 3EGSA 2HKFL 3K4ZA 2RAMA 3RRQA 5EC2A 5SWZE 3FCTA 4PTTB 2N56A 4Y19B 2VWEC 4PGZA 4WFFE 2MNUA 5SWQA 2YC1B 1JPGA 3VXRB 5TJWK 1VENA 4WIQA 4E0RA 1XH3A 4XAWH 3L3HA 3H0TA 3NZHL 4G6MH 3T2NL 1E6JH 3IJSA 5I1AB 3WUWG 3MYZA 3OKLB 5I1LB 3BN9C 1UACH 2YBRB 1A6WL 2ICES 3Q2CA 1J88A 4FZ8L 2GUOA 5HY9B 3H9YA 5ID1B 3SCMA 4OGZA 5DK0A 4V1DA 1EHNA 3VGGA 5DUBA 4FABH 1YEGH 1UH2A 4MXQD 1UB6B 1JWUB 3ARSA 4KTDH 4PRAA 4M4PA 1CQYA 1H3UA 1Q8MA 5E9DE 4EIZC 2QADC 1A1NB 1AD0A 4D0DB 3B2UD 1NC2B 3SDDB 1LP9F 4G8IA 4F15B 2FX7H 2IPTH 4DFHA 4GXVL 4AM0A 3CIQA 4PJHF 2ATKA 4PJXF 4PPTA 2Y23A 2EH8L 1I8KB 2PR4L 3S5LA 2F8OA 2O5YL 3OJDB 3F7PC 3GSRA 1FV1A 3PV7A 3L7EB 2XZQH 3SN6N 1W8OA 3KHOA 3C6LB 1YEIL 3N1GC 3THML 4OCLC 4S1QH 5D1ZA 4JPIB 3M1BB 4PJBA 3L5XL 4QHMB 4TNVK 3HZKB 1BD2A 2UWEE 3V6OA 4CJ0A 2I9TA 1TCMA 1MWAA 1U3HB 3MO1B 3GJEA 1LMKA 1V05A 2OR9H 4XCEB 2G5RA 3D25A 4GQPH 5IQ9A 5BCAA 5F7EH 2Q7YB 1CLYL 2DJUA 3VD4A 4TN9A 3BT2L 1OPGL 4FTVB 3QO1B 3LSOB 4W6YB 5E6YA 1CL7L 1SQ2N 5LWYH 3IS0X 3SGEI 2YPKA 4J8RB 3ILPA 3SKOA 5JPNA 1L6ZA 2CMRH 5E5MA 2AJXH 4HAGA 2IFFL 1G1YA 4G7YH 1KCSH 3GMRB 4E5XA 3KLDA 1D6EB 3UYPA 1DUZA 4WHTB 4C55A 1LO3H 1KXVC 1XGRB 1RZJC 3V0WL 1GZQA 4GW4A 1OGTA 3VJ6A 4JFOA 1LWRA 4HEME 1SJVA 4Y5XA 4DK6A 3NIGE 3DGGA 2DM7A 3BKCL 3D2UB 3MLXL 4XNQB 2DQUH 3DOSA 1P84K 1LVEA 1H5BA 1JMZA 2A2QT 5K33A 1UB5B 1AHWA 5E9DD 3EO0B 5GZOD 3BDXA 1JFQH 3HC4H 4ZAKB 2D7NA 1XGUA 2P43B 4RGMC 3CFCL 4AEEA 1Q9WB 3HMXH 1T0MA 3OJMB 4JDVB 3IVKB 2QQKH 5E8OA 5IT2H 1PYWA 1T66C 4YDVA 1YEKH 1YEDA 3KLAB 3DHJA 3PDOA 25C8L 5DJ2B 3VXRE 3VFPA 4ZUVB 4PRBB 3U0PB 1YJDL 2QSCH 3WKNA 1WFNA 4X6DB 4TOYH 4P2QB 4UT7H 1EAJA 2AI0L 2CDGA 4U1HA 3RUGA 4Z0BL 4P4RB 5FYKL 2XN9B 4N8CL 3P0YL 1AD9B 1UEYA 2LABA 4ZSOE 3SOBH 4U49A 3EYVB 5E4IA 1LO4L 4G3YL 1Q72H 4PJAA 1MCHA 3CFEA 4LPXA 2VDLL 2QSVA 2FL5A 4KKAD 5I1KL 4TTDC 3GBML 1IAKB 5I1CH 1QFUL 4KK5D 2JK5A 3L3KA 1NCBH 2FJFA 2HT2D 1TNNA 3G5VA 4LGRB 3U0WL 3BPCA 2IH3B 2ZUXA 4R0LC 3QHFL 4LVNC 3IXAB 2O5ZH 1X5KA 3VWJC 2K1MA 3RVWD 3BQUB 4DW2L 5EBMB 3HI1B 4TUKL 1JMXA 1FAKT 3DV6A 1J8HB 4QHLA 2IADA 3BPOB 4KGJA 3MV8B 4GG6B 3BDYH 3O3DB 4XNZC 3LDBC 1G7HB 3JV6B 3QJHB 5ISZD 4F57H 1MFBH 3GIVB 3GEWB 2GCYB 4WFHE 4NUJB 3ULVD 3VRIB 4H88H 1QQDA 5DC0A 4I3RH 4Z7WE 2R1WB 1CXEA 4FQXC 3VD9A 5BW7C 3P9LB 3C87A 2XNAB 3EYSH 5DEGB 1EERB 1E4XL 1U8LB 5EU3B 1BZ9B 1J5OH 1G7HA 1GGIL 3JV6A 2VWEE 2A77H 3KYAA 4X9IA 3RDTA 3NZ8B 3VWKA 2B2XH 5IEHA 4V2BA 4HJ0C 2CR3A 4K07A 4Y4FC 2X5PA 5D5MA 3FFDA 4YXKH 4K71B 1GSMA 3JVGA 1JNLH 4LFHD 4KJWC 4JDTL 4MDIA 2A74B 4F7CA 4F7TB 3PGCA 1AGCA 4IHOA 4KDVA 3MLYL 2GTZB 2X4RB 1NGWA 3QCUL 3TM6A 3DRTB 2NTFB 3HNTL 5C0CE 3F12B 2UVFA 5DJDB 3EZ8A 2YZ8A 1MELA 4X98B 1R6VA 3CD4A 3T2OA 3EYVA 4NUGH 4M1CD 3UDWC 5KJRH 1VGKA 4OJFH 1FDLH 4EKXA 5GGSA 3MLRL 4J3SA 3SGJC 5L0QB 1F4AA 1IZKA 3TFKC 3WE6B 1JRHH 5E00B 4JANA 1I1AB 5CZXC 3LN4A 3GBLA 4LIQH 1A6ZA 2DI9A 1JGUL 4KVCH 1JYWA 5HHMD 3OXSB 2OR7A 3WS6C 3O6LL 3RTQC 1V3MA 2BJMH 3UMTA 5FAAA 2C9AA 3U4EA 1VACB 1LEIA 1HH9B 2WQRA 4PJHA 4PY8I 2AGJL 4WUUD 1U3HC 5EIIB 1MH5A 3SDDC 4IOIB 3FFCB 3LS4L 4A2MA 3U9PH 4LL9A 1GPOL 3MGTB 2OTUB 4ZAKA 1BGXH 4M7ZB 4QGTA 3HMWL 2VDRH 3CSYB 5I73C 2IMMA 2P8MA 4HIIA 4P59L 3JBG7 1VFBA 3L3JA 1FAIL 3MLSH 5C09A 2SEBB 1FIEA 3DI3B 4K3HA 5IQ7L 4K3JL 4AEHL 4YPJA 2YRLA 4O51B 1W72B 5GGTH 4ODBD 4MNGE 3SBWC 3FQNB 5E5RB 4C56E 2RB8A 5D5ME 2AXFB 4E41B 4MD0A 4RSVA 3QIBA 2HFEB 3E6FA 1VADB 1FORL 4NZTH 1LP9B 4DN3H 3FT3A 4PG9B 4N1HB 1E4XH 2ATPB 4FOMA 4TQEL 2BNQD 4XMKL 1MFEL 4HFWA 2Y9RT 4L4TD 1C12A 1U3JA 4N5ED 5F7LB 3AREA 3CLEL 3QP3A 2YPVH 2IADB 3EYFB 3UPCA 5BS0B 2PKDA 4QTIL 3MX0A 1PLGL 3C6SA 1RD6A 5L9DL 2DL2A 5CP3A 3T3PF 2OZ4H 3K80A 3CX5J 3EDKA 3QFJD 5BRZE 3I50H 4R2GD 2OBGA 4I2XE 1KPUB 2G75B 5LCVL 3RVVD 1BD2B 3GI9L 1W8NA 5IVZA 1RI8A 1A8JH 2DI7A 3O4LA 4P9HL 3VWJD 4W81A 3TBTB 1KPRA 5DJCA 4I77L 1TZHA 2VABA 1DZBA 5IEKB 1EDQA 5KVEH 4TTGA 4IEFB 4JFZH 3L1OH 1IAMA 4RDQG 4MA3A 4WW1A 3Q0HA 3WNNA 4OIIH 4O02L 1Q72L 4J4PA 4U1HB 2WLYA 4F7MB 1GC1L 3H9HA 3QDGE 1DSFH 1A6TA 2BNRB 1X4YA 1NCWH 2VC2H 2N7AA 4ERSH 2O26U 3GI9H 1NL0H 2VE6B 3BE1H 1I3GL 1MFAL 3MMEA 1HH6B 4NQEA 4D3CH 5E8OB 5JUEH 3QWQB 3OR6B 5M94B 5DUBB 2W65B 5L2KA 2XRAL 4GMTH 2ZSWA 2IBZX 4YFEA 4WNQA 3L3DA 1EFXA 3K7UA 2VLME 3P3YA 4LAJH 1Q1JH 2GJZA 4LLAA 5EBMA 4P2OB 4Z95H 2AKRB 3QXDA 4KJWD 3RWFB 2V5RA 5TPWH 3BD5A 3VFOB 4QRSA 3UTTA 5HYJE 4P5TC 3FB8B 2XQYG 2CLRB 3GMOA 2YD7A 4HLZH 4LSQL 3VFRB 1M7DB 3L3HB 4DZBB 2R29H 1A4JB 1F58L 1RHFA 3DXAD 3IU4L 1TTUA 2A38A 3TIEA 4OCWH 2A83B 4JJ5A 5SWZB 5I8EA 4LCWB 2Z9TA 2ZJSH 3LAFA 5EDXA 5T1KA 1RIUL 1D5IL 3BFOA 1RULH 4LSVH 2Q86B 5JPNB 2HKHH 3GO1H 2BOCB 2VLKA 2KQNA 5BVJB 3N1MC 1YEJL 3D0LB 4GAFB 3HUJE 1PX3A 1UVQA 3SBWA 2FB4H 2LFGA 4PBXA 3HMWH 3QIWD 2DKUA 4GG6A 1S7SB 3IDYC 2H9GB 6CGTA 4AT6B 4ODVH 1GAFL 3KNBB 2BFVH 5HHQA 4YHNB 1WTLA 1IC5L 1NFIB 3QQ9C 5DFVD 1Q9WA 1Q9LB 4PRHD 3ALPA 4QHMA 2NYYD 2WMPA 1K8DB 3FFCA 5LJYH 4WW2A 2PO6B 4NCC1 3IKKA 3QZWB 4EI6B 1JFQL 1DQTA 1U6AH 3QG7H 5C2UB 4TQEH 2X4PB 1P7KA 2GFBB 3U83A 2VLRB 3PWLA 2VDML 4JN1L 3ZYJA 5IM7A 8CGTA 3LHPL 5A3ID 3D0VA 2ITDA 2DTML 1B0RB 2EIZA 4KKBC 1MJ8H 4NBYB 1YEFL 1S7VA 5DJYA 5HHOB 4RGNC 1QG3A 2CXGA 5ITFA 3EOTH 1I8MA 4HF5L 1MVUB 4YBHA 3HB3C 2IQ9L 2OI9C 3FQXB 3WFDL 3QPXL 5AWNL 1P4LA 2ZCHH 3C8KB 5DRNA 4YHML 2HTLC 4NJAH 3PWNB 3MBXL 4OSUH 2VDPL 5I1DB 3ZSTA 3QIUB 3OSKA 3T4AA 3SY0B 4PJ5E 1CGSL 2FX8L 1T0MB 4D94A 1BOGB 3MJ9A 1EZVY 3D25B 3DSNA 4JG0H 3MO1A 1EK3A 1JGUH 4PJCB 5KANG 2H8PA 3CDGB 2H3NB 5C07E 2BHYA 3QDHA 2GSIA 4JQXA 4YDJA 3IFOA 1YPZE 1S9WA 3U48A 4PJEB 2VERN 1I3RA 5D1QA 2QADD 3MRHA 3VH8G 4ODHL 2Y25A 4M93B 2XZQL 5GZNC 3ZYZA 1XCTA 3C6LC 3IFNL 3OJDA 2YEZB 4FQLH 4E5XB 4QXGH 5I8CB 3VRIA 3K46A 2ADJB 3TT3L 5HYSB 2VXVL 3IDGB 1KV3A 2Y5TB 3QA3A 5FYLD 3VXNB 4ZSOB 4NQDA 3QUZA 4ZPTA 3OF6D 5D7JC 3CSBA 4WHCA 5I71C 3P11H 5BMFH 5KVFH 3GZKA 3CMOL 1A2YA 1ZS8A 2I25N 4JHAL 4JREC 2QSQA 2X9YA 2AJYH 3U0WH 4Q2ZB 2PW2B 5ENWB 3TGXA 1KYOJ 2NX5B 3IJHA 3SKMA 3TVMB 4LRNL 3ZHDA 3WNKA 1P5UA 2ZZUT 3GJEB 4WFHD 4LLVB 3ARFA 3RZCB 2F58L 5DFVC 4N9OB 5I1LA 2BNQA 5C08B 4ZUWB 2DOCA 2R23B 4LVHB 3DUHA 4H20H 3MV8E 3ME0A 5CEZD 2DQGL 4LARH 5IFAH 2Y36H 3KJ6L 1SJHA 3NZHH 3V52H 2OXHA 1MFBL 3U30C 3PV6B 3SDAD 2Q8AL 5LQBL 5I1JL 3W0WE 2HVJB 3MRDB 1CDHA 3VU2A 4H1LB 4UAOC 2D0HA 4AM0B 4KKBD 3LKQA 4LGSB 4BFGA 4LPWA 5FV1L 5GS2D 2J88L 1KG0A 3RZCD 2IWGA 3HMXA 1DCLA 3GSVA 5C0BD 4OT1H 5I17A 1PYWB 1UM6H 3DVIA 3QEQD 4J12A 4UINL 5HDBF 1MQ8A 4IS6A 5B21A 4HWEL 1IGFH 3VD3A 3C5ZB 1TTGA 2RJMA 3JWDL 4OQ1A 5I75B 5FYJD 5C8JA 4XC1L 4MX7A 4HUWB 3U0TA 2Y06L 1MCDA 1CDIA 4N8CH 1FFPA 1H5BC 4GS7B 3KDMA 5DO2D 3T0VA 1L4IA 1T66D 4R4BA 3UBXI 3VWKD 3JV0A 4PBVC 4OCWL 4Z0BH 1GGBL 4P5TD 4UNTA 3IDMA 4ZQKB 3H0TB 4EBQH 1Y6KR 3HS0B 3GGWB 3WXVL 2F5AL 2P49B 1AXSB 1INQA 1KIQB 4APQC 1KPVA 1JYXA 4W6WB 4WW2C 1MPAL 1FH5H 1B6UA 3BT2H 1YEKL 4Q0XL 3FOLB 4LEOB 4ZFGH 4ZD3H 5DMIL 3NIFE 1SM3H 3S36H 4TVPH 1UZ6F 1JHTA 4DQOH 4D9QD 4IIQC 4YGVB 1BJ8A 1IVLA 3GBNH 1N7MH 1KXQE 2JJTA 4XP6H 3ZHKA 2A1WH 5IB5B 4OCXH 3QULA 4YZFF 2NX5D 1MRFL 2JJTC 5FKAB 5ITBH 2UY6A 3INUH 3S3PA 3QIUD 4S1QL 3MRLA 2R23A 1FN4A 1QO3B 3BEVA 2DMKA 5IBUG 4P49A 5HVGB 1JN6A 1K6QL 1KEMH 5JHLL 2CJUH 2LAAA 1CGUA 1OW0A 3BJ91 4D9RE 1MOEA 2IAMD 4Y2OA 5L7XL 2B0SH 1N59B 4HPOH 3OKKB 4Y4FB 4M8QB 15C8H 1T20B 3ARGA 2D31B 1YZZA 2W91A 4JM2C 1K2DA 4JEGB 1HQRA 1BFVH 3H6JA 5B39G 1LE9B 4G6AD 4LMQE 4NRXA 5IMKB 2BSRA 4KH2A 1RZJL 4IRSB 4I2XB 5B38A 1ODAA 3CZFB 3IETA 3SDAC 3OKEB 3OMZA 4Y5YC 3VXNA 3S35L 1G6VK 2PYFA 2X4OA 4DN4L 4XBGB 1KCLA 5SX4I 3QWOB 1ZEAH 1P4IL 4XI5D 3EAKA 7FABL 4NN7B 4P23B 3T0AA 3VXPB 2Q76B 1T5WA 3MCKA 1M05A 5HI4C 2IH1A 5IMKA 1UWGH 4QXUH 4EDWL 3QG6A 1AQDB 3O4LD 3FB5B 1BQUA 5ID1A 4U1LA 1JGVH 1CDGA 1XGTA 3IXTA 5AAWA 5E7FA 1SEBA 2BHZA 4WCYH 3AUVA 5GRUL 3SGEH 3U1SH 1BOYA 1W72L 1FO0L 5C0DA 4ZFOL 4OZFH 3VFVB 1KN4L 3GHEH 3MJGX 2R0LL 1GOGA 3QUYC 4KRMB 3FONB 1IFHL 1UXWA 3RVXD 1ZHKB 4MJ4A 3ARFD 2EDRA 1QFWH 4X7CC 4HMCA 4RFEA 4KUCD 3VMNA 4HWUA 5DGRA 1JJUA 3R06A 3PXJA 3K2MC 2ADIA 4IMLB 5SWZD 2FJGB 3LRHA 3VFNA 4OUUB 1H0DB 4U1GB 3TN0C 1MRCL 3RDTD 1Y18B 2FD6L 1T3FA 2F15A 3SDAA 4WUUA 3VXTA 1OLZA 5FO7B 4I4WA 2CD0A 2VISB 5GISL 4EQ3A 4QHKJ 5I1EH 1MHHB 3ARDA 4DQOL 5JHDB 5D7LD 5FCUH 4FZ8H 1R5IA 3RTQD 5KSAC 2CIKA 1EFXD 2HFFA 4YE4L 3MLUH 4AENB 5FDYA 4HPYH 4ZD3L 4KDWA 5BVPL 4MJ2A 2V7NA 5I9QC 3AREC 4P57B 5I74C 4HJJL 3TJEL 1T1XB 3KVQA 1HHJA 3UYRL 3LKRA 2BNQB 5C08A 4NNYB 4KVCL 3DIFA 3IFPA 4FQIH 4S1DC 3TZVA 4ONFL 4LIQL 4IRJB 1B4JL 3DGCR 3JXAA 4RISL 5HTSA 2YS4A 2C3GA 4CAGA 4LSDA 3VRLF 4Q97A 1A1OA 2IPUG 5J1AB 2PO6A 3V4UL 1I1YA 5CKAA 3SEPA 3WXWH 4GKNB 3T1WA 4MX7B 3DIFB 4AYFA 2HMID 1OSPL 4OQTH 3GIZL 1UCTA 3PWVA 5F6HJ 3BO8A 4J3OC 3ZKXC 5MENA 2KZ1B 3GJFA 5E6IC 3PWUA 1WBZB 4JQXC 3VXMD 3KR3H 4OLEA 3CXHK 3TYGH 1BF8A 5ELIA 3L5WA 3MRRB 4HMDA 4Z0XB 2VISA 4RGMB 5KAQG 3QCTH 4LCUA 4N0RA 4XC3H 5A2FA 1E28A 3BW9A 5FK9B 3T0DA 1IM9A 1CFSB 1BQLL 2V9RA 5TE7L 5C9KA 1DBAL 3Q6GH 1NGQL 3P4LA 2R0WH 2VLLB 1NGZB 3O8XB 1NGYA 3I3DA 2W9DL 3MREA 5D1ZD 4GW1A 3ZL4L 2F5AH 2WBJD 1RFDL 2F19H 2H3NA 3L5HA 5TQ0H 4FNLH 3U6RB 1FYHB 2AXGA 4P5MB 3TJEH 5K9OB 2CLRA 2XKNB 1GGBH 3LB6D 4OZGB 3LEYH 3H3PL 4DEPC 3ULVL 3ARFB 1P2CB 4PLJC 2EXWC 1T1ZA 2HG5B 3PL6D 3Q48A 2EO9A 5GS1A 1DEEA 1FNGA 1D5ZB 3LV3B 1JHKL 1QRND 2E27H 5FFLA 2XTJE 3S36X 2FATL 3L9RB 1P4LB 3MMEB 2FSEB 2VZOA 4WWKA 1U92B 1RU9H 3DETC 5IG7A 1WZ1L 3GSNA 1IGTB 4JHBA 2IANB 2P8LA 3MC0A 3IDIA 5AZ2H 2D7OA 2Z91B 3BD4A 4X8XA 4H5SA 3HE6B 5I6XB 2DYPB 1MWAL 2R1YA 4U4BA 3P73B 4P3DA 3TJHD 3MV8D 5F7FA 4F58L 5HDQL 4WHYH 4MA3B 1CXFA 2VDQH 3HR5B 5E2TL 3EOBB 5F93C 3K8KA 4LCWE 2C1OB 5FYKH 4Z7VE 4U05A 1BQSA 2EEAA 1RK1A 2PYED 4EEEA 5DD6B 4WW2B 4DJMA 5C6WH 4Z7QE 2AI0H 1IGJB 4QHKI 1CFVL 5IVZB 4Z6AT 1JN6B 4UV4H 4OCRH 1GGCL 2W0FA 3OZ9L 3LEXA 4MQ7B 3VFSA 2VIRA 4FQJH 5IMMA 3TBWA 4CN4A 3DXAA 5GISH 2K3TA 5DJ6B 5AUMA 1OP5K 3QULB 4WUUE 5DZOA 1FRGL 1G6RL 5GJTH 4KK9C 1DQDH 2ICWI 2V2TA 2BVOA 4P5TA 4HJGA 1NMAL 3IDYB 4YGVA 2ZCKL 1ZVSB 3DUSB 2VL4A 2HJLA 2FYYA 2P42B 4HFWB 1AR1D 4NHCL 4D9LL 1KBGL 3BZEB 4HPOL 4LCYA 5H35A 4MQTB 2HRPH 4OCYL 1KIQA 3AC0A 1EHAA 1KF9B 4QGYA 3MGOA 3BKMH 1XF4B 4OIBA 4PLKC 1KN4H 3GHEL 2B4CC 3G6JA 4PP2A 3VE0A 4NNXA 2HFEA 3E6FB 5JXAH 3GMLB 4XVSL 3Q5YA 2NZIA 3TBVA 3DX9A 5D2NC 4JO3L 1UM5H 3PWLB 4L8SA 3U2SB 1FFPB 4NBXB 1WFTA 1F4XL 4NHCH 4D9LH 2DDQL 1I4FB 5HHMB 4XP6L 2YD1A 4WV1C 1G7JB 5IV2B 2DLTA 2NXZD 3EOYG 4MJIB 3VFWA 5SX4H 1IL1A 3KYNB 4JE4B 2J8OA 3F8UB 3GSVB 3O41A 5E6ID 4JO2H 3QNXA 5H94B 3MRJA 4ODVL 4BUHA 4M00A 1JI2A 3IAQA 4JFFB 4MSWB 4BELD 3ULUL 4FXKA 3QXAA 4F7MA 5IMLA 5ALBL 3T0XA 5F96H 3RKDC 4JLRB 4MD5B 5HHME 4FQCH 3UJJL 1R3JA 5CCKH 5FB8B 1XGQA 3MRCA 1HOCB 1XCQA 1HHIB 2D4DA 3ARED 3BKML 4Q6IB 3DX6A 2J8UE 3GKWL 2VLJE 5CS7A 4J6RL 1QTYT 1KBGH 1RJLA 3W81A 3CX5K 3KPQA 1FE8L 4ALAH 3S9DB 3OB8A 3FB8A 3T1FA 3MBEA 5AZEL 1KPUA 3N1PC 4HSQA 3SDDD 1Z0NA 4KJYB 1C5BL 2R8SL 1RVFH 4UU9B 2DWEA 3SDCC 2AXJA 1PZUB 4JQIL 1MJUH 1WZMA 5A2KH 2A6JB 3BGFB 4LPVA 4YK4C 1EPFA 3H3KA 5I71B 4J7RA 2EH7H 1WQVT 2XG4A 3ROOA 3S97C 3ZKNC 1X6NA 4GRLB 4X6DF 4R3SB 4TPRH 4JO4H 2Y5TA 3WFBL 1JPTH 3FQRA 3MZGB 3PGDB 4M9PA 4P4KA 4KXZH 1OAUL 3UJTL 1DSFL 4YQXL 5CSBA 4LSUH 4PJHE 5E4EB 4HQQH 4YPGA 4R4FL 3RZCC 3NCYS 1YN7B 1ZHLA 3GSWA 3JWDH 4O51A 5SV4A 5T1LA 3I6KB 3RTQA 1DLHA 2VITA 1OP3H 4BH8B 4RIRA 4JFZL 1LNUB 4G6JH 3V2AR 5CEZL 5T3ZE 1T4KB 2Z8VC 2Q3AA 1ZLSL 3QCTL 5JMRA 4Q58C 5KOVC 2XN9D 5AAMA 5CINH 1MRDH 4MNQA 1J1PL 3MBEB 4EDXA 4HKXB 3VRJA 4OZIB 1YECL 4Y5VA 4JB9H 3QIWB 2NXZC 3EFDL 4OGXL 4RWYL 5GRWA 2GYSA 5DRZA 3GMQA 5HHOD 5ADPH 3IJYB 3C09C 3WXWL 1KIPA 2DQGH 4X4XA 4R90L 5E70A 4MD5A 5AG8A 4HG4J 4OAWA 2FBJL 1KIPB 4J3UA 5C0RL 1WWAX 3ZDXE 2V2WB 2VLKD 2FYYB 3OKMA 1LK3H 3O8XD 4EI5A 1MFCL 3S3SA 3S98A 1YN6B 4DN3L 1J87A 1NPUA 5IVXB 5EUOF 3K74B 5DC4B 1QRNB 5E7BA 4G42B 3MRJB 2JKXA 2WBWB 5BVPH 4YDVB 1ED3A 4LVEA 2H6PA 3QUXA 1DVFB 4KDTA 3KPSA 5F70A 5FGCE 4ZG1A 3MBXH 4OSUL 5GGQH 1MCSA 3ECBA 2X9XA 1ZGLP 1AGEA 1RIHL 4O2CA 5DRXB 1XF2B 2JCCF 2C4FT 2WNGA 4ZS6D 3WIHA 4QHNA 2W0FB 5BZDB 4G5ZL 5IGXH 1QSFA 3U4BH 3D69B 4CN1A 4MMZC 3UTOA 3LRGA 1AGBB 4PJAE 3T0EE 3DVGB 3V5DB 4MHHG 3WUZA 5JDJA 2FEDC 3MOBH 3VXOA 5D6CA 1OWRM 2VSCA 1J8HE 5GGUB 4MXVE 1WCQA 1T04B 4JFHD 5I8KL 3ZKND 1UCBH 3RY6C 1LGVA 4NYLA 2V2WA 3T0EA 3C9NB 2LU4A 2MKWA 1AE6L 3DV4A 1FO0B 1DBML 4PJ9B 5D72L 1G9ML 3OKDB 3V7AE 2A0LD 3CFJA 4MNHB 1T83C 2IG2H 2RBLA 3SE9H 1LDSA 4EN3B 4MA1B 4LAQL 2B4CL 1CXLA 1LD9B 3PQYA 1WT5C 1FL3A 3AFLA 3IXAA 1S8DB 5TE6L 3TLRA 4TSBH 3S35H 1SY6H 2GTZA 2X4RA 3BYTA 4XCEA 5DMYA 3KPQB 3P4NB 1D5MB 4NKMB 3UC0H 1BZQK 1Q38A 3NIGF 2ED7A 4XCNB 2HKHL 3OAUL 5DD6A 3ZDYE 4DVRL 1D5XB 4TYUA 4ELMB 3CFEB 3WS6A 4AY0A 1J0YA 4JVWA 2F53A 3ILQC 1LNUA 3BPLB 5GS0D 5IJVA 5DRWA 4ODSL 1JGDA 3O81A 4BK5A 5H37G 1OT2A 2YD5A 3V8CA 3NZ8A 1MFNA 3DMMA 3S5LB 2OZ4A 1TJGL 1FZJA 6FABL 5CGYC 2VLLA 2R29L 3D48R 4JRYE 1AHWC 3HE6A 4POUB 4RBPH 4U0RB 4GAYA 1J0ZA 4MJ5A 4P4KD 4U6HA 4JY5H 5IMOB 5CEZE 3MJ7A 1YY8B 3LMJH 4K7PX 1QHOA 3WS3A 3C60C 4F57L 2Z0BA 3O3DA 4P2OD 5F9OL 1AO7D 3VXME 1N7ML 5DD0L 2E7CA 2HTLD 4MJIA 2VQTA 4DN4H 4OGXH 3NCYP 4V1DB 5EB9A 4GMSH 2ILLA 4PJGF 3KPSE 3N85H 1CU4H 4LSRL 3MROB 1JNLL 4NNPL 3BKYL 3O6FB 1QA9A 2D7TL 1BD2D 3F7YA 4JFEE 4NM4H 2FEDD 1U42A 3DGGB 2AXGB 4LVOB 3WNMA 5EN2B 5TE4H 1JV5B 1YY9C 4WRLA 2R1XB 3VXRA 5DTFB 5EBLB 4KI5F 4HXAL 3NGBB 5BJTA 4KI5C 1HNFA 5DJ8A 3WSQL 4JCMA 2A6DA 1AD9A 5HI3D 2ATPA 3V4VL 4ODWA 1RMFH 1NCTA 1KLGB 2CIKB 1FVDA 2D7TH 4FG6D 3BKYH 1ZV5A 4K8RL 3ZKXB 4UT6L 5IMLB 5ITBL 5C0ND 5C1MB 2OX5A 5HPOA 2W60B 5D7KD 1QSEE 2NZ9C 4J3XA 2R2HA 3HZMA 4FFYH 4ZFFA 1AFVL 5BS0E 2I60L 3E6HB 1RK0B 3DJ9A 1O7VA 3TBWB 1QR1A 1MHCB 5FF6A 5J4MA 4OZIA 4N9GB 4I18B 5IT2L 3ZE2E 4XPFL 5D96B 4K8RH 4ZYKA 4YLQT 5C09D 3MV9A 5LQBH 5MERB 2F8VA 3MRKB 5C07D 3W5MA 4XMKH 4OB5H 4CMHB 4RNRB 1QSFD 3C09B 1TJHH 4BH8A 4O02H 4JFYA 3PQYD 3NFNB 1M71B 3RGVC 1E4JA 4DKDC 1FC2D 4X6FB 5C6PB 5KS9E 2WWKO 2CO7B 5FV2A 2VDLH 1TPXB 1UYWH 2XYCA 3TBVB 1UM4L 3ARBC 1DBAH 3GMLA 2HFTA 2EDBA 3ZKSD 5E8PB 3LN4B 1BVZA 4CUCA 4LLYB 5F7DB 1LO3L 1Z9MA 3TESA 3H9ZA 1R5IB 4JAMA 1UKTA 4P4KB 4XBGA 3B9KB 3B9KC 2NW2B 1NC2A 1F3DJ 4I4WB 5I1IL 1WAAE 1OHQA 4X7SL 3V8OA 3FN9A 3KR3L 3MRIA 3MRPB 1JWUA 1KENH 3GI8L 1NGPH 3HC3H 3P11L 3QIWA 5DD0H 2ICEA 5BMFL 3U7WH 1NGWB 2PXYD 5F7KC 2YOCA 1KOAA 1KYOK 4RWHA 5GS1C 3SCMD 1NUNB 3WIIH 1PLGH 3RWEB 3OAYH 3HE6C 4RFEB 1JNNH 5ESAB 3T8XA 4ONGH 4D9QE 3OR7A 1FL5A 3LEXB 1T4KA 2OR9L 4PJ9D 2R2EB 4J1UB 1BAFL 4NQUA 4QF1A 3GNMH 3L3OA 1RZIB 3O11B 2YC1A 4H20L 4YFLI 1U8LA 3X3FH 4PJCE 1AQDA 1YY9D 3P9LA 5DEGA 1F6FB 4KJQD 3HG1E 4PUBL 4AEHH 4JM4L 1BFOB 3G6DL 1MNUL 2X40A 2EH8H 4OI9A 2EKJA 4O58L 5E9DB 3K0WA 1EUUA 1HIMH 1U3ZA 5L8JB 1B3JA 1HKFA 1RZKH 4MJ6A 1SY6L 5EU5B 2FHBA 2VDPH 5TE6H 3LY6A 3GSNB 4P48A 5KVFL 1I9EA 5EO1B 1WF5A 5B3JE 5BXFA 5CILH 1U92A 1NMBH 5IHUL 1UJTA 1U8PA 4ZUUB 3BQUA 3NN8A 4G9FE 3QEGH 2VLMD 4AIOA 3MRMB 1KC5H 4U1JB 4M8QA 5KS9A 1OGAE 4QRRD 4ZO7A 4P23D 2QR0B 4QOKA 2BCKA 4J3VA 1DE4B 5I66B 1YEFH 4GG6F 1DBMH 2W9EL 2M8XA 2X70B 3EYSL 3MRQB 4JY6A 4Z18A 3BH9B 2DTMH 1I8LA 3V5KB 3PWJA 5GS0H 1PQZB 1UJ3A 4ODHH 2ORBH 4YHZL 3QNZB 1S7UA 5KJRL 3X13A 2W0LA 1T7VA 4WI5A 3ILQD 3TT1H 2OJEA 2F9BT 3VMPA 2VR5A 4XVJH 2VXSL 5BQ7A 5T1LD 5FUOL 2J7LA 4H26A 1FFOA 4M7JL 5EA0L 4XTRD 5EUOB 3S37L 2VNCA 5DGQA 1JTPA 4ZUTA 4JN2B 1HI6B 4HFUL 3LKQB 1FJ1A 4JDTH 3U7WL 5JHDE 1A02N 4R8WH 1ADQA 5J7CC 3E0GA 1T1WB 3BIBX 3DYPA 4OGYL 2Z35B 32C2A 4CU8A 3HB3D 3S4SG 2JB5L 4GRLD 4MZ2A 3HAEA 1HIML 3ZSSA 3DSFL 5DFWH 1DJSA 3BO8B 1XGUB 2PXYC 5IFHL 3OG4B 1J5OL 2XIDA 12E8L 4HS6A 1AY1H 2IALA 5FDWB 5CZKA 3P0YH 1HHKB 5CGMA 2XZCH 5DD5H 5EUKB 3NGBC 3ESUF 4M3JA 1KTLA 4GO6B 1DBJH 4MA8H 3T2NH 1T22B 1TQCC 3TBSA 5F3BB 5BO1H 1JPTL 3QG6B 5DUML 1GZQB 5EZJB 5TDPB 5C6TH 4KUCF 4QRUB 3VXMA 5EO1A 4M6OL 4TVPL 3ZKMC 1BIHA 2R0WL 4JR9H 4KJPC 5EU5A 1A5FH 2EC9T 2K9UA 2GHWB 1GRWA 3ARWA 4G7VL 4H5SB 2HFFB 4GRMA 1VGEH 2HJLB 2WUCH 3QUZC 3UTPD 2OQJB 3BHBA 1UXSA 3GI8H 4M6MH 3BP4A 5KSBE 5EZIH 3HUJB 1OAKH 5HVWA 4POZC 1JPSL 3TNMA 4AIZA 1CGTA 4HV8A 3NTCL 4PV9A 1ZMYA 4MA8L 1JNJA 1JIBA 4JFHE 3VXUA 4LKCB 3K2UL 3TIDA 3K8LA 4YDJB 4OLZH 2MQCA 4G6KL 5EBGA 3T77B 3AU1A 1UM4H 4EI5D 2IBZY 2C3VA 1XR9B 4HC1H 4NHUA 4CKVX 2YA1A 3TA3C 1G7IA 1W2KT 4KQ4H 3NA9H 3WFBH 4UAOB 3MQIA 1QLRB 4HV8B 4X5WA 3WJJC 3UYRH 1PVHA 4P3DB 4FHBD 1MUJA 1JF5A 3ARPA 3C6LD 1NJ9A 1JHTB 1PJ9A 4MAYC 5JIIA 4XHQA 3JV5A 1INDL 3MRIB 1MCJA 5EPMA 5IWLA 2X7LB 1NBVL 4L3EA 1CFNB 3V0VA 1YUHA 1JUFB 3UCRA 3F5WB 1F3RB 2XRAH 3I6LD 5D71L 2OZ4L 4EOWH 3HC4L 2ZCLL 3S88H 1MFAH 2HA1A 3KPMB 1HNGA 3RHWK 4OI8A 3HS0A 3KXFA 2GIYA 3LMJL 1FNGB 4LASL 1U8HB 4QLRA 4EIGB 1BPVA 1R24A 3MACH 5CGTA 5JZ7C 2H8PB 3CDGA 12E8H 1EH9A 4KPHH 4OIIL 1TIUA 1DQML 5GGRA 4G80A 3MXVH 1FL6B 2EDYA 5EORL 1I7ZA 4FN0A 2H26A 5DWUL 2WUBL 4P3WA 5D2LB 4U3CA 4X4YA 4G8EA 3P77B 5SWSB 1WZKA 3BUTA 4GLRH 3I3BA 1NGZA 3BUYA 5BS0D 2D9QB 5D2NE 3UZEA 2YRPA 3QIBC 4NQCD 5DVMA 2R4RH 5AYQA 1JPFB 4R6UA 5JXEA 2W60A 1ZT7A 1HI6A 2FECI 4LPCA 4X5LA 4JM2F 1BQHG 4I0CC 1MHHA 3ARDB 5F7EL 3T0BA 5JA9A 1AKJA 1I8MB 2Y1VA 5H8DA 1UXSB 2H2PD 1VPOL 5F97E 1R5WB 1RJCA 2YD8A 1ZLWK 3UJIH 3OZ9H 5D2NA 2Q86A 4YGAB 1IEAB 5ESVA 4QTIH 5EOCJ 3U46A 3BUYB 2PXYB 5TDPA 3GSOA 4Y4KB 1YEIH 2OP4L 5ESQA 5A40E 4KFZC 4XWGH 3PNWA 3MV11 5GGRB 3REWB 4LOUC 3RY6A 3BN9D 1CD1B 5IROA 5CIPA 4EVNA 2X10A 1TJIH 2YMXL 4RFNC 1RZFL 3QEGL 1YA5A 1NFIA 3B9AA 1CG9B 5BZWB 3W0WA 1PW3A 2ZUQB 5CILL 4D0BA 3NAAL 3RVTD 2W65A 4ZO9A 3FOMA 4LF3B 4FQ1L 3BIAX 4J23A 5EOQL 2W9LA 4HF5H 3X11A 2VDOL 4NIKB 3QRFM 4ZSOA 1OY3B 4ACPA 1URLA 3KPPB 1CXIA 2PTUA 3MJ7B 1U0QA 1N26A 1KTRL 4FG6C 1DQJA 3X12B 5HYSG 5IB3B 3H8NA 1TNMA 4L8BB 1HHHB 5EFIA 4UIKH 2D2OA 2R4SH 5JNYA 2NNAA 2AJ3B 4AQ1B 1NC4D 4P2RA 4KHXH 1E4XI 2NTSP 3A67L 3WFHA 3QXTA 5DD3L 1R0AH 4WU7B 4B41A 1OSZA 2VDQL 3IB4A 4J1UA 1A7PL 3FONA 1IKNA 1MCCA 3CLFH 3H9SB 2W9DH 1JRHL 3VXSD 1LEGB 1X5JA 4OJFL 3VFVA 2HT4C 3HZVA 1GHFL 3I6GB 4D8PB 2X70A 3SKJL 1ORSA 3STLB 4XC1H 3VXUB 1DE4A 4HCRH 3HG1B 2B7DT 3WHXB 3QIBD 1FL3B 3IF1B 5C86A 2NQCA 3CU1A 4KZDH 2C7UB 2ID5A 3TYGL 3WLWC 1CDYA 1QBLH 2EE2A 1HINL 4M5ZL 1NFDE 2XA8H 4L4VB 5IP4A 5MP6H 2X4OB 3F6LA 5TGBB 3EYFA 1UT9A 2FLBT 5DURD 3VGDA 5C92A 2BNQE 2OJZH 1RHHA 4TVSa 1KCRH 4WI8A 3C08H 5HJ3B 5DQJA 1HQRB 5C0NC 2GITA 1LP9A 1MFCH 2D31A 5EZJA 3BRFA 3QFJA 1CFBA 4G3YH 1JGLL 4FNLL 2JCCB 5DMGC 3HPJA 1A1MA 3GGWA 1BX2A 5TE4L 3P4MA 4Z7UB 3MYJA 1T22A 4Y7MA 4EI6A 5DJCB 3GK8L 5D1QC 4UMGA 3FHQA 3IAGC 4PJEA 3V6ZA 2WSKA 1JZ7A 1OOAA 5B4MD 3AGVA 2R56H 4PJGE 1S9KC 3QFDA 4L4TE 4UIKL 2NY2C 2QHRL 4HS6B 4XXDA 1J0JA 2BRRH 4OFKA 1YJDH 3QUYD 1CI5A 3DVNA 1NAKH 2D4FA 4PGJA 4PYGA 4PFEA 4MNQD 1D7FA 4JFQA 3EDDA 1Z6JT 4FFYL 2BVPB 1SBBA 3DNKA 1OM3H 1DVFA 1WZLA 5GPRA 3UZQA 5IB5A 2NY6C 1WAAA 2BVYA 3GM0A 4NC0B 1NCWL 2GT9A 3LIZH 3U4EB 3LD8C 4JHAH 3MA9L 5EOCL 1DVFD 2PO6C 3D39D 3QQNA 1KN2L 1CGXA 1ZVYA 4FFWC 1FVDB 5E8NB 1X9QA 3JSSA 1NCCL 1R5VA 2V5TA 3B9EA 4LQ1A 4ZUTB 1IM3A 1P7QA 5H2BB 1BJMA 4HUNB 3B4NA 4HG4K 2ICCA 2X6MA 4EQ2A 4HH9B 4HHAA 5HHPA 4HXAH 1T0PB 5AD0A 3TPUA 3KG5A 4TSAL 5FUZH 4DZBA 3ZDXF 3X13B 5GS2H 2RR3A 3G5ZA 4LSUL 4U7KA 4X6FA 3MR9A 4G7YL 1FGNH 3ORJA 1KB5L 1UWGL 4QXUL 4EDWH 3MLUL 3IAPA 3AS1A 4M43H 1U2CA 3GJFH 3PABA 4JKPH 1RZGB 3D2UD 4YHKH 3STBA 2UZYB 4FP8H 2I27N 4GKSA 1KB5B 3PL6A 3WKML 3O3AB 4LDOB 1VACA 1LEIB 4HKJA 3CXHJ 1AKJD 2X4SB 5CEXA 5HHNB 4GAYB 1RAMA 1RUKH 4KMQA 1DP0A 3O9WC 4P46C 5ERWA 1SBSL 5J6HA 5JOEA 3UO1H 1DUYB 2OM5A 2NY4B 3MRNA 1UEMA 4BQBA 4BJLA 1TVHB 2EYRA 4KPHL 2YEZA 1SJXA 1IKFH 2K7PA 1OQXA 4MD4B 1X4ZA 3BD3A 1YPZA 2Y07L 5GRUH 2OMNA 5JXAL 2WBJA 3SE4A 1KPRB 5C07A 1QVOA 4LHUA 5D1ZC 5E2VL 1MLBA 1OAYH 4KROB 1YC7A 5DQDH 4YAQB 3UZVB 3ZT5A 1SBSH 4M93C 2HJFB 4QRTA 2XPGA 4X9FA 2ESVA 3F7YB 4QRPD 4UU9A 2ZUQC 4H25A 3RWHA 3LOWA 3QR2A 4NC1E 4UNVA 3NACH 2AJVL 2ZCKH 3QXDB 4NKIL 3RBSA 1HEZB 1NSNL 5IK3B 3G5VB 3UTZA 1UKQA 2HJFA 4QRTB 2IBBA 4MJID 4YR6B 2F53E 4ZTPL 35C8H 2P4AB 1QPPA 3M17A 3R0NA 4Q6IA 3M45A 2FGWL 4LGPB 4HWBL 4K94L 1HXMA 4ZPTB 3LH2L 3ZKMD 3CH1A 5EZOH 3T2QA 3S34L 4K2UL 3D6GA 5IMOA 3RP1A 1KTDA 2OTWA 5JHLH 2J6EH 2Z31B 2V7HA 5C3LD 1OTTD 5ERWB 3KYMA 3U9UA 5IM7B 4YEEA 5KAQF 1IC7H 3QJHA 3JTTA 3FB6A 1Q0XL 4Z7VB 2AERT 3S4SB 5IBLC 2GSIB 1B0GB 4MJIE 2BVTA 3MLYH 4KI5E 1A7NH 2X4NB 1TXKA 3MSPA 5CEYB 1U3HD 4GKSB 3CSYA 4P99A 3O2VH 4Z77A 1YMMA 2MOVA 1MAML 4ZTOH 3BOVA 4IOFD 4NWUL 4ZYKB 4IMKA 1EMTH 3OPZL 1SM3L 4BZ1H 1G7JA 2X1XR 3WKMH 3ZE1F 5CJXA 5ANMB 4XNMB 1QEWA 4WDIB 3M8OL 2DIJA 1KCUL 2YSSB 5KSVA 1LO2L 4X8JA 3PWPB 4PJAB 2E9WA 1TVDA 4X6BA 3VXSA 1UVQB 4OCRL 2PO6D 5FM8A 3D0LA 1JF6A 2XWBA 4OAWB 4EXPX 3GHBH 1S7VB 4R90H 3SGJA 1QYGH 3F58H 1E6JL 4GAGL 4MDJB 4PY8J 5IIEB 1GC1H 5J9PA 5HDOA 1CWVA 2A6DB 2MCG1 3CH1B 5IBUB 4X6DA 1P7QB 3AY4A 4MXWL 3BDYL 3DX7A 4FFVD 1V8HA 4KRPD 4P4KC 1F02I 4NQXB 4X7EC 1CDCA 3B43A 4PB9H 1QPXA 2EE6A 4JO1H 2B1AL 1M7DA 4BQ9A 3BSZL 4UINH 5EN2A 1ZTXH 5EU4B 3PGCB 4WO4C 1XGPA 3QXVA 3LPWA 3OQ3B 4MS8D 4P9HH 3ULUF 3MLTA 4X7TB 1C16B 5H37H 3S7GA 3BZFB 3MLVH 5D6DA 3SDCA 4YHIA 1A7NL 1A7QL 4HT1L 4NQTA 3BX7C 2WZPD 1PBYA 1Q9OA 1BFTA 5J57B 2EYSB 2G5BB 3PQYE 4PGBB 5T1LB 4MXWH 5C07B 1BZ9A 2VAJA 1QFPA 1TZGL 4R4FH 2WAHA 4WHDA 1PY9A 3KYMB 4Z7UA 3ARVA 1J1OL 4G42A 1GHFH 2JLLA 4FQXA 4JQVC 3LKNA 1DFBH 3GMPB 1JTOA 1B4JH 2AEIT 1A6ZB 2EXYC 1AP2B 2ATKB 3GIVA 5C08E 3ZL4H 2PCPB 4J8RA 4JPKH 4U3XA 3DMMB 3QDME 5E94B 4N5EC 4X4XB 4W6XB 4F7EA 4WI2A 2R0ZL 4QRRB 5KZCD 4YHLH 5IG7B 5IVXE 1NBYA 3AS2A 3IJYA 4HH8A 2OJZL 1FPTH 4L29A 3QIWC 3QQ9D 1X7QA 5L6YL 5KSAA 1OF2B 5IB2B 4HWZA 1RZGA 3VI4E 4NWUH 4V2CB 3T3MF 1CGYA 1M4KA 3KPSD 5ANMA 5JW4M 2XPGB 5D7SH 3QJFB 1HN1A 2VR9A 1NDMA 2DJ4A 5F44A 2Y72A 1YNLL 5C2BH 1JGEA 3GSUA 2VE6A 1QFWL 1S7TA 3PIQA 1VCAA 4DGYH 1BBDL 3PGFH 3WFHB 4PREA 4HUVA 1PKQB 3RDTC 3MGAA 4QHUA 4WTZA 1DUYA 1GGYA 3WUWA 5J6HB 5DJXB 3C5JA 4Y19D 2X1WL 4GLRI 1C5CL 4ORGB 5DI8A 1TTFA 1FCGA 5E8NA 1MCLA 3QQ3B 4DCQB 1MAJA 3BESR 1YYML 1D6VH 1ZA6A 2PTTA 3RFZC 4MD0B 2R4SL 3PDOB 1KB5A 3MV8A 4WO4D 4RA3A 1ZEAL 3OG6B 3T09A 3VDBA 1CF8L 4HK0B 3W39B 4JFQB 4CJ1A 4YHMH 4BFIA 1QSFB 1RZ8A 4JFEB 1JK8B 4M7ZC 4UV4L 5DLMH 3RVXC 1F4XH 2HT4D 2BSED 3VA2C 1AGEB 1N3NB 1F6AB 1TITA 5E2VH 5DVNA 3T1FB 1NC4B 2WIMA 3NAAH 2WANA 4WI9A 3AM8A 3A6BL 5E8EA 4JM2A 3CVHH 1RIUH 4PJHB 1FNHA 2JK5B 4EUPA 1NC2D 1XR8A 3RWJA 4IRJA 1EBPA 3FMGH 4JFOB 2XKSA 4NT6A 4NNYA 5E8DL 2JCCA 5EU6A 5I9QB 1QVOB 3DARA 4K9EH 5EORH 1J1XH 1DQMH 5HHPB 2WBJB 4ENEC 3ZT7A 2H2PC 1EHLH 1XGQB 3T3ME 5J9PB 4XP1H 4MYWB 2C3HA 4PRIA 4YXHH 1H8SA 1MCRA 1KN2H 1NQBA 4ODXB 4Z7WF 3IDNA 1JYVA 2VL5B 3FRPG 4P2QA 1WZ1H 2VOTA 4WTXA 3MUJA 3FQNA 5KZCB 5GJTL 1HKLH 2J4WH 4FP8L 2WM0A 2X1QA 3TNNA 3S88L 2YZ1A 4PLOB 1JPFA 3DMMD 3ZTNL 4OZGF 2I60H 1IAIH 4L4VD 4DWHA 3DXAB 4EJ1C 4WWKC 4G8GD 4X6CB 3S36L 1YEDB 3P9MA 3KLAA 5FYKU 3C5SA 3KYNA 3GSXA 4IRSD 3T4YB 4EDXB 4BQ6A 1NL0L 3G6JF 1RZJH 2VC2L 4ERSL 5CD5D 3UTQA 3HZVB 4HUXB 5EIVA 1UGNA 2CO6B 3QYCA 3RBGA 3BAEH 3V4VH 3NFPA 3B6SA 1SHMA 2FO4B 3KS0H 1B4RA 2EDEA 5DWUH 5JW5B 1L6XA 1T03H 2HWZH 4PR5A 4NO5B 1XGTB 5FO9A 3KXFB 3EYUL 5HJ3A 9CGTA 2VUYA 1RHHB 3SJVA 4G8GE 4OZHE 3WEXA 3MZTA 5JMOC 4LCCC 1XAUA 4UOW0 3P0VL 3K3QA 4KMTH 5E5MB 4XNUL 2R9HD 1MI5B 5HYIA 3RIAF 2Z4QA 3E3QC 5DJDA 2MJWA 3ROOB 5FOJA 1U8KB 3L9RA 4MAYA 1NJ9B 1AC6A 4Y4FD 2W0PA 1ORQB 2BVOB 4A6YH 3GIZH 3HG1A 2FH8A 4PJXA 1CD9B 2XV6B 3BQUC 1FIGL 4GW5B 4S2SB 3ULVH 1I7TA 4EVNB 1OAQH 2VLJD 3CFCH 4M6OH 4RX4D 5D7LB 4YDKL 5I1JH 2P24A 3KAAA 3AU1B 4NP4H 2WK2A 3F7VB 4YH6A 5I6XC 1IEBB 1NUDA 4KTEL 5HI5D 3V52L 4E0RB 4EBQL 5HVFB 4NZTL 2LVCA 3VWKC 3NCEB 3VWKB 4LNRA 3RAJL 3AAZB 3DUUA 1JRHI 3Q6GL 3U46B 4ZS7H 2EDXA 3HPJB 5FB8A 4OLZL 1QBML 3V0WH 2RFXB 4HIHA 4XNYH 5GZND 5F8QC 5CJQL 2E7LA 1U95B 3KPPA 4QRPE 4XVUD 3WV0A 3ES6A 2FD6H 4ONHB 1N0XH 5D5MF 5C0EA 1OWWA 4KRPB 2FEEL 2X4SA 1YYLL 1YMHA 2E6JA 2CK0H 3DV6B 3O41B 2IAMA 4NZRL 1ZGLM 2FSEA 5L9DH 4KDTC 5BZWA 4A2LA 1W0WB 2EDTA 4NQDE 3KPNA 1A9EA 4F3FB 3S37H 2YHGA 4HZLB