1E4XL

Crossreactive binding of a circularized peptide to an anti-tgfalpha antibody fab-fragment
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
214
structure length
214
Chain Sequence
DIQMTQTPSSLSASLGDRVTISCRASQDISHYLNWFQQKPDGTVKLLIYYTSTLHSGVPSRFSGSGSGTDYSLTISNLEEEDIAFYFCQQGGALPFTFGSGTKLAIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLDSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cross-Reactive Binding of Cyclic Peptides to an Anti-Tgf Alpha Antibody Fab Fragment: An X-Ray Structural and Thermodynamic Analysis
pubmed doi rcsb
molecule tags Immune system
molecule keywords TAB2
total genus 54
structure length 214
sequence length 214
chains with identical sequence M
ec nomenclature
pdb deposition date 2000-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1e4xL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1e4xL01
1HSBA 3LSOB 1AGEA 2G9HA 5ESAB 3MRHB 1M71A 1SY6A 5GJSH 1HIML 3QXDA 4IHOA 1UZ6E 3FT4A 4PLJD 5ENWB 3I50H 1HHIB 2AJZB 3VCLA 3QQ9D 1GL4B 2Q3ZA 4FTVA 4ZUUB 3TN0D 3MODH 3B9AA 2NX5A 3RTQB 5HI5C 3X12A 2I5YH 2NX5D 1EHXA 3VXPA 2Y6SC 4Y2DD 3NTCH 3F12B 1AY1L 1FHGA 2AGJL 5T33L 4MA1B 4PJ5B 1WK0A 3B43A 3QDGD 4X6FA 3X3GH 2LTQB 2YK1H 4Z7WF 1KULA 4PS4H 4WVRA 1D9KC 3CDCA 3CLFL 2PKDA 2B1HL 1MCJA 2COQA 1YJDH 2D7NA 3P0VL 2CMRL 2Z92A 3V5HB 3U9PL 43CAA 1T03H 1NAMH 5DGRA 4ZD3L 3QUYD 1QBLL 3GMOB 2HVJA 4GRWB 5DZNA 1WEJH 1B3JA 4YDKL 4LLWA 1L6ZA 1F6LL 4PJBB 4DFIA 4KI5E 1IGMH 5L7XL 3THML 4NO5A 1Q1JH 4PJ8D 2ESVB 2YUZA 4HPYH 1UGNA 3VRLE 3DGGB 3LZFL 5GSVA 4L9LA 1LVEA 3RVUC 3ZDYF 1ZA6B 5CD5C 1BWWA 4MS8D 5B8CC 3QIBB 3UO1H 2VXSL 5H94A 2ATKA 1N3NA 5F8RC 4L3EE 2D9QB 2NZ9C 1MFDL 4LDOB 2DYPD 4MB5A 3PWVA 1VFAA 4TPRH 3BRFA 4WY7L 1JFQL 1YEJL 3MRDB 4KHXH 2UVEA 3CSYA 4JFQB 4JY5L 5DJ0A 3T08A 4YXLL 3QCTL 5GZOD 2NZIA 3F7VA 4MSWB 3CFCH 4AZ8A 3IXAB 4HQQL 2WWMD 1XGQA 1U42A 2Y36H 4LVNC 2R0WL 5J12C 1A4KA 4ODVL 4OM0L 2GW5A 3T1FB 1L7TH 2EDWA 4PREB 4G6ML 1Q0XL 4EXKA 1LEGA 3CVHL 1I1RA 1PEZA 2IAMD 4L3EB 4OI8A 3CFEB 3L5XH 4AL8L 5B39B 1ND0A 3WFBH 4OLUL 4WU5B 3P77A 2OXHA 4W6YB 1K3IA 3E8UL 5IFJA 4K3EH 5L6YH 3TVMB 3BPNB 3RZCB 2HT2C 4TN9A 4TRPH 4I2XE 4GKSB 5C0ND 1YEHL 4K7PX 3M8OH 4ZAKA 3QHTC 3EO0B 1A22B 3X3FH 1CFQA 7FABL 3FN0L 3GJFH 3NIGF 3ZZ1A 3HI6L 4E41D 3PHQA 3BPLC 3IRPX 1T04B 4LFHD 1NANH 3D3VE 5J06A 3W9DA 4PGEA 3DUSA 3P9MB 5KSBF 4PB0L 1WBXA 1MCHA 2BJMH 4D0DB 3FO0H 3GMPA 5DRXB 2ARJQ 3HI1A 4HULB 5LKNA 5CCKL 3BN9D 5J3HD 2M8XA 4XP9L 3IJYB 2AKRB 3LKRA 5DUBB 2YD6A 1KPVA 1KIRA 5KANI 3ULSA 5L8LB 4CU6A 4EOWL 2AJYH 1GXEA 3TF7C 3QJHB 1IGIL 5F96L 2A77H 4MNQB 3QDJE 3LS4L 3IDJA 5FGCE 1FH5L 3BVNA 3STBA 4XNQA 1ORQB 5FO7A 3VXSA 2WBJC 1CYGA 4MHHI 4BSWA 2VABB 4ORGB 3ARUA 4APQB 1RZ7H 1IBGL 1J11A 3ZE2F 1IGYA 1U2CA 1PDKA 1LDPL 4MDJA 3K1DA 3GNML 2XZQH 3C5ZC 4HSQA 3SJVD 3WIIH 4WJ5A 2C26A 1VEOA 3KLAB 5EZOL 2ZNWA 5T5FH 3PP4H 3TBSB 3WBDA 3ULUD 3O3UN 4ERSH 1Q94B 4W6WB 3QB7C 4NQSB 1JF6A 3B9VA 2CSPA 3K4ZA 2VXTL 2VLME 2WWKT 3S97C 2KZ1B 4ONFL 4OLZL 3SJVB 2V7NA 4PLJC 3QZWB 2Z92B 1MHEA 4NKQB 2XNAB 3CPLB 5E8NA 3WNPA 3CVIH 2B8OT 3QISA 3L95A 3CH1B 1A14L 2A6JA 2NW3A 5DJ8A 2XY2A 4LLWB 3WE6A 4OCRL 3C6LD 4KJQD 4IM8A 2K3TA 3EJJX 4TTGA 3VWKD 2DS4A 4AEEA 1FN4A 2D3VA 2M1KA 1GPOL 4R4ND 4G8GB 1QP1A 1PJ9A 3L3JA 4QTHB 2ZP0T 3D48R 1CZ8L 1MI5A 2LAGB 2VDKL 3VXOA 3P9LA 4WFGE 1QFUL 4Z0XA 1IQWL 3TO2A 3BFOA 4PBVC 4GRLD 3BIAX 4ZNCD 1EGJH 1T1ZB 4YXKL 2Q6WA 5C08B 1JFQH 3JTSA 4NKMA 4XCCL 1TNMA 1NCCL 4KTYA 4BFIB 4DKDC 4YFLI 4P2RB 1AQKH 1CD9B 4OCYL 1DTUA 3NZHH 3O2WL 3UTSD 2JCCF 5SV3A 1QA9A 5GZNC 1BEYH 1NAML 4F3FA 5AG9A 1BFOB 3AREA 5IMMA 4ELMA 3OJDA 1OOAA 2VR5A 3RNQA 1G9NL 2PYFB 3HKFA 4JN1H 3WD5H 5KTEH 5I0ZA 4KK5D 3GKWH 5K59E 4LCYB 4M6MH 5EU3A 5KSBB 1XH3B 4I9WD 1RHHB 3B8YA 3MXVH 1CGUA 3PHQB 3U4BL 4PJAB 5MI0B 4OD1H 3RY5A 1CE6A 4QOKD 1T04A 4WUUD 3FO2B 1J0HA 5CS7A 1UB6A 3X11A 1U92A 3GB7B 4FQJH 5KVEH 4KHXL 5GIRA 1VFBA 5CBAB 1GSMA 1JE6A 2R0ZH 1I3GH 4NQCE 5T1LA 3ZKSD 5J13B 2AKRA 3LKRB 2Y5EA 3C08H 5BW7A 1KPVB 3TJHD 3BRDA 5J0BA 4ISVA 4JRYB 5EU6A 2VIRB 1LO0H 43CAB 4Y2DB 1CS6A 4F7MA 1KN2H 2F58H 2NX5E 2R2HA 3NAAH 4KJYB 3BVNB 3KR3H 3VXMD 4XNQB 2BX5A 5DD0L 2JLLA 1HE7A 3VRIA 5ABDE 3UJJL 1R3IH 1PG7W 5FYKU 1CK0H 3FKUS 5D1XC 1TJGH 1ZLWH 4MZ2A 5HHVL 5I15H 5FYKE 3REVB 1MCCA 3SDXB 1MCSA 2AQ1A 4KTDH 1WT5C 5JW3L 1U3YA 1J88A 4HBQA 1BAFL 1KLGA 4F80A 3I2CH 3VXMB 4YHLH 3KLAA 5HGHA 3KLHD 2JIXD 3MRDA 3VFVA 5L2JB 1S7QA 2NCMA 4KPHH 2EDFA 3DGCR 1Q94A 2GIYA 4PJHB 43C9B 1FQ9C 3EDEA 3LEVL 1FVEA 1RZJC 3NCEB 1LD9B 3BKYH 3KXFA 3MV9D 3KWWA 2P5WA 5T3XL 1H3GA 3IB4A 3GZKA 4G7YL 1A4KB 4PRID 3S96A 4WWKD 2YN3A 1Z0MA 5B38G 3QZWA 4WI3A 3PWPA 1HYSD 3HZMA 4M61B 4RMTA 2XI9A 5CP3H 1HOCA 4PYGA 1PKOA 5L8JB 1VESA 5I1DB 4WU5A 1KIPB 1KJ2B 4G9FE 5D71L 3DVIA 5GRJL 4WW2B 1A02N 5TF1L 2MPAL 3MJ7A 3RIFF 3FT2A 2DQTL 2X4PA 2CGRH 4QXUH 4L4TB 2VDQL 1CQYA 5I1HL 4IRJD 3T3ME 5ALCH 1EJOL 3ILPB 1XCQA 1AIFA 4QKXB 3UTPD 3AB0C 1RZFL 1FZMA 3FB7A 1IC5L 1KLFA 3KAAA 2GJ6A 5FO9B 3DUSB 3O3DB 3ZT7A 2AJUL 2FBJH 1T1ZA 4OZGF 4TSBL 5CILH 5A16A 2VISB 3RUGF 2ADJA 2IH3A 2P8PA 4HDIB 4HXAH 4NKIH 3WS3B 2XT1B 3WO3B 4B5EA 3TA3A 3WV0A 3SKJL 3HCVB 3IJSA 4KMTH 4KK8C 5HGBA 1P6FA 2K7QA 1GOGA 5IB2A 4N0CC 3IKKA 1PG7X 5E70A 3I2CL 1YMMB 4G42A 5JQ6L 3QDJD 4IS6A 1TIUA 1JZ6A 1OTTD 5JHDB 2ICCA 3DSFL 2WINB 1ZLVK 4NBXB 3IS1X 2BMKA 3BI9X 3P30H 1DBJL 2IAMB 5FYJE 4YAQA 2J8UB 1OM3L 5D1XA 1KC5L 5AZ2L 2A0LC 5T1DH 2FO4B 3OJ2C 4YHZL 3EZ8A 1UM5L 1YPZE 4PRPA 3DI3B 5E6YA 1QVOA 4K8RC 5I8OL 1KN2L 2F58L 3QDJB 4Q58C 5FYJH 3NPSC 3N9GL 3KYOA 5TDOA 4M5YH 4TUKL 4HC1L 1Q0XH 1A6ZA 2X4QA 1KTRL 1UB6B 4YNYB 1G7PB 2X4TA 5D5MF 3HB3D 4NRXA 1NC2B 5JOEA 4DGYL 1BIIB 3U7YL 4S1QH 2R0ZL 4U0RB 5GIRB 3DV6A 4LLVA 2EE3A 1KGCD 3FCTB 1T0MB 2BVTA 2P46B 1G6RA 2ZCHH 1V05A 1H3VA 4HMCA 4P4KD 3DYOA 1CXFA 3BP7A 4UIMA 3DPBA 4XWGL 2J7LA 1FAKT 1FDLL 3QQ3B 2ERJC 4P3DB 2XNAA 3CPLA 5C09D 1MHCA 1U8JA 3L95B 2MHAB 4KJYA 1G1YA 4PGZA 4Q0XL 4D0BB 5FDWA 1EMTL 1PZ5B 5ID0B 3MLPA 1DBBL 1I8KB 1PG7L 3HNVL 3WSQL 3DHJA 2BVOB 3UTZA 3ULUE 3GSVA 5I71C 2XG4A 2Q20A 2NY3B 4TUOA 4N8VB 4IRJC 1FGVH 5ISZA 4MJ4A 5E1AA 3ZE1F 4ZS7H 3WL9A 1LEKB 4QTHA 2AK4A 3F6LA 2H8PB 4M02A 2UY6A 4GT7A 3EGSB 3WFZA 3RI5K 4RAVA 3OG4B 5C0BE 1X5KA 5HGHB 3VJ6A 1R3JB 1NUGA 1PX4A 2XACC 1WSST 4UV4L 1TDQA 3GJFK 4LPTA 4EI6A 1GZPA 5I6XB 4LMQE 3GMQA 3DIFB 2CDFB 1J7VR 4AM0B 1NAKH 3UTQB 2R2BB 4M61A 3LHPL 5EPMA 3QZWG 1GAFL 3DVGA 5KSUA 2DLFH 4NQCB 1EEYB 2HKHL 3O45A 1JTOA 4OQ1A 3FQUA 3OJDB 4ZUWA 1CXIA 5IHUH 3VI4E 3G6AA 1WAAA 2P5EA 2AXFA 4R2GD 4Z7OF 4Z7VE 3EO9L 2CJUH 1MEXH 2MKLC 1WEJL 3PWUA 1NQBA 4NHCH 1NBVH 2QR0B 5KSBA 4NNXA 3MRCA 3PNWA 4MA3A 4NKOA 1IAIL 4JGMA 2P43B 3VXTB 5L8KB 1I8IA 4NC1C 1R0AL 4PP1C 1GC1H 1OVZA 5ACMA 1R5WA 2P8LA 3NFSL 4MXWL 5FGCB 5JOPE 5J57B 4GW5A 4LFHG 1M7IA 3WNOA 4S0TD 1PX3A 1W2KT 1QRND 2VISA 1NUFA 5TE7L 2JJWA 3CMOH 5ICYA 3DECA 3BP6B 3ARGD 5EBMA 4KRPC 3QDGB 1KCRL 3RJDA 2A6DA 3IJSB 4KVNH 1S3KL 5D5ME 2CDGA 4KAQH 3A6BH 1LK2A 5TDPB 2D0GA 2YPLD 3HI5H 5F1NB 4JRYA 1I75A 3SPVA 4BQ9A 4FXGA 1DVFB 3MV9B 5I8CA 1LO2H 4GG6E 3MSPA 4QXTB 5E8PA 1C5CL 3G04A 3VW3H 2Z8SA 4LPUA 3AREC 4BQ8A 2BMKB 1INDH 4YR6B 4C56A 2IADB 2XN9D 5I1AA 3VRIB 3EYOB 1ULVA 4XBEH 3W82A 4XAKE 4ORZC 4LF3B 1U91A 3O4OB 3RDTB 2A77L 2FBJL 1DVFD 5DLML 4M3KB 3OB0K 1NCDH 1T21A 4YHLL 5T3ZH 1UQSB 4OCWH 1ZS8B 3EYFA 3VFSA 1I1CA 2VC2H 4IOFD 4L8BB 2N56A 4LNRB 4EN3C 3SDXE 2WQ8A 2ADGA 3QUKB 4HFUH 4UAOC 3WO4B 5C0CD 1T89C 4OFIA 1F4XH 5F9WB 4I5BB 3GI8L 2HA1A 3QG6A 4LMQI 1G6RB 4NHCL 3O6FD 4D94A 5C6WH 1KEML 3L3KA 2BJML 3HRPA 1NC4B 5I74B 5DD0H 3RGVB 2P5WB 3L7EA 2EZ0C 3QUXB 1JGEA 2RB8A 1XGTA 4ONHA 5D6CB 5E8EA 5FOBA 3D9AH 4ODBD 5FECB 3AGVA 2YWZA 4F7PA 1ZOXA 1CD0A 3OX8B 4R3SA 4YFDB 5IVZB 5DR5L 3CXHK 3RTQD 5ID0A 1I8KA 3RNKA 2XRAL 1QFOA 1KCRH 3CJJA 3CSBA 4XXCA 4HPOH 2YZ1A 3L5WB 4YDLC 4YQXH 3V95A 2FCBA 2YA1A 4DVRL 1OTUD 1V3KA 4NPYB 2EE9A 2YD5A 1R3LB 2I07B 4ZFOB 3BIBX 1R5VA 4MB3A 1MFNA 3HUJA 3C6LC 2IQ9L 1QRNE 5EU4A 3FOLB 1A7BA 1T7ZA 2A1WL 4E9LA 1Q0YH 2XTLA 2GFBB 1IAIH 3FFDA 2EH7L 1C16A 5A3IC 4ODXB 3CIQA 4MJ2A 5FGBA 1R3IL 3HUJF 4BUGA 2YKLH 4OZHE 2FGZA 1ZHBB 1XMWA 5IB2B 2H26B 3W11D 3VRLF 5B38B 5C3TA 1JN6A 2HKHH 4RFNB 1BZQK 1RPQA 1PKQA 3LHPH 1EX0A 3MV7B 5I8KH 3ETBF 8FABA 2GCYA 2AXFB 1IT9L 3ROOA 3JBG7 4X5WA 3H7BB 3U36B 1DQLH 1FVDB 4U4BA 1QEWB 3VFRB 3FAWA 1TETH 3EJYC 5ESQA 5JW4N 2ZSVA 1KJVB 1SMAA 3E1F1 4M1GL 4Y4HC 1S7RB 4P2RE 1MQ8A 2KQMA 4X4XA 3W0WA 3RFZC 1EFXB 1G7PA 2AXHA 1YPZB 2X4TB 4JKPH 4OJFL 3EYVA 1U3JA 1S9VB 1C08A 4PPTA 5F7DB 4D9LL 4MJIB 1I1FB 3BW9B 3WHE0 2BZDA 5ICYB 1OTSD 4ETQB 1WWBX 5TH2B 3VXRB 5AD0A 1BGXH 1RJCA 4HWNA 1F58L 3WXVL 5FHAL 4U1HB 2ZZUT 4G8FA 1BFTA 1UENA 5TDPA 1AGBA 3PUCA 4YXHL 1ITCA 5C0FA 3QUZB 1A1MA 2PXYA 4G8GE 3NZHL 2KZWA 1B0RA 1AQDB 5GRUH 4NC2B 3CZFB 3SDYL 3GSRA 3TBYA 3MZTA 4OKVB 4HCRA 3QI9B 2CLZB 4TNVK 2ZCHL 1WZLA 3IRZA 1TJIL 4LF3A 2OR9H 4FZEL 1P7QB 2G5RA 4HXAL 1YMHB 3QEHA 3ARBA 5F89A 2KQNA 5DJCA 1ZKAA 1ACZA 4GUPB 4HJGA 4OM1L 3BGMA 5BVPH 5IWLC 4ODTL 2HT3D 4J8RA 3WHXB 1U58A 4M8QB 4ZPTB 4EN3A 3BZ4A 2NLJA 2ADGB 2OR7A 1D5IH 1JHTB 1Q38A 2WMPA 3BIKA 5C2BL 5GISH 1BD2B 4LLMB 2K7PA 1AGFA 1ZV5A 3Q6GL 4CVZB 3QRGL 5CJ5A 3QEQA 1UM5H 5F6IC 1NSNL 3L3KB 1A4JB 4I3GA 1OSZB 1AFVL 3NCFB 4Q6IB 2CXGA 4F33A 4L8CA 4NQEE 4GXUN 4PRBA 3W81A 3D85B 1X5XA 5FUZH 2H1PL 1JV5A 4LSUH 1ZLWK 2DDQL 2FD6L 3MCKB 3O3BA 4XCEA 1EEYA 3PGCB 4ZUWB 1OPGH 2FZ3A 3TESA 4D8PA 4E42B 1NKOA 1MUJB 3B83A 4Y5YA 5BS0E 3PWUB 3E6FA 2HWZL 4MVBD 2DQGL 2BFVL 3OPZH 3T2OA 2X10A 5JA9A 1UWGL 3SGJC 5CJBA 5CEZD 2FATL 15C8L 1KCSL 3MJ9A 4JKKA 2C3VA 1NCBL 4Z7UE 1KCVH 2PR4L 1U3ZA 5JW3H 3UROR 2GFBA 3FFDB 4YIQB 1XF2A 3SOBL 3STLB 5JW5B 1A7OH 1M7DB 5F9JA 3S8WA 3N0PB 2EDKA 5T3XE 4HK0B 2CIKB 1IGTB 2XXMB 1I1AD 3O3AA 3P0YL 1KJ2H 4NJ9L 5D1QD 1RZJL 4UDTA 3SPVB 1I9EA 1QFWL 5A2KH 5MHSD 1WZ1L 3BDYH 1RY7B 3VI3F 3B3IA 1UWEL 4XVSL 4Z8FH 4PY8I 2BOCA 5E56A 5D7SH 1XGPB 4G9FB 2R39A 4RQQB 4XP9H 5AYUL 3OKNB 4OCXH 4XNUH 1EBPA 1MCDA 2IQAB 1NFDA 3D3VA 1RURH 3VU2A 4JFYB 4YO0B 4OZHA 4WUUB 1FVDA 4Y1AB 4JO2L 1N0XL 1QFPA 2IG2L 2UZIH 1ZAGA 3AXLA 5IW3A 4F58L 3MFFB 1JNJA 2APWA 4XZUA 3V5KA 3TYFA 3LEYL 3HI5L 4Y4HA 2NYYD 3W0WB 5DYOA 4XX1G 3F58H 4XHQA 1AE6L 5IVNA 3I9GL 5JHDE 3VGGA 4RAUA 3ARDC 3GSNB 5TH2A 4JFFD 5KSAC 4Y8AA 3V7AG 5F1IA 3FT3B 3HPJB 2FX7H 2YHGA 1V7ML 1FFQA 5J1AB 1HHKB 4ZD3H 1ZGLA 5T3ZL 3FRUB 3HMXH 1BZ9A 4FQ1H 4KK6D 4V2BA 4X9BA 2BCKA 3P0VH 4RFEB 5MEQB 1I7TA 5GRZA 1KACB 1W8NA 3HE6C 4KHTL 5E2WL 3IFLH 2OYPA 3WS6A 4HGKC 1S7WA 4NOBA 3LKQA 4CMHB 1KN4H 4S1DC 2D4DA 2H2SC 2F53A 1OGAB 1PD6A 1VFOA 3L5WA 4EVNB 3RUGE 3ARBC 5F89B 2P8MB 4PJ5D 1K9TA 1JZ2A 1JBJA 4J4PC 1U6AL 3KYMB 3P4NB 4ODTH 5HDOA 4CN1A 1MFDH 1SJHA 3QQ4B 5DF0A 4KAQL 4JRYD 4ZPTA 1I3GL 1NCNA 3ARFB 4M48L 3OKLB 5ILTL 4MA7H 1VKXB 4YHML 4Y16B 1RIVH 4NRZB 1MVUB 1RK0B 1I8LC 4ZFFA 3DO3A 2PW1A 3DV4B 4NC0B 4JKMA 2HP4A 2BVYA 1T6WA 2APXA 2J8OA 4UTAL 3DI2B 4Q9RL 4R7DA 4X7SH 1UB5A 2X4NB 5FA3B 5FKPB 5BXFA 3MLTB 1CXKA 1GC1L 1LK3H 4IRSD 1HKLL 1JV5B 1Q9KA 2BNUA 1JF1B 2YBRB 1VGKA 1TJGL 2CRZA 4QHNA 3VH8A 4PP2B 4HWUA 4K94C 2FZ3B 2GCYB 3MLZH 2VDPL 3WFCL 3TA3D 4LIQL 1MUJA 1MJJB 3BMWA 4MGXA 4XCCH 2HTLD 2BNRA 2XA8H 3GMNA 3MACH 1DBKH 4FFZH 4WI5A 4YBLB 4CL7A 4PR5B 3WXWL 4P5TB 1BVKB 2V5RA 3RX5A 3NBNA 5DA0B 1JNNH 1U8KB 2C7UA 5HYIA 4LKCA 4FQHB 5F7FA 3U6RA 5IIEB 1EFXA 4X8XA 2UZYB 1J0ZA 5D1XD 1UWXK 1HEZB 1CBVL 3F7QA 4PJDE 2YA2A 4RIRA 3UAJD 2ITCA 1HHHB 2XKNA 4YPGB 3VXRA 4LLUB 5DHVA 3VE0A 2EYSA 1HH6A 4HWBA 1G84A 2V7HA 1WAAE 2BNQB 4JZNA 2Q87A 1A1MB 4LRIC 5CFHA 5C09B 2OCFD 2JJTC 5E9DB 1XGPA 4RQQA 1CG9B 5T1DL 1Y0LB 4J3OC 3NOIA 3VDCA 3TBYB 3SKMB 1L0YA 4ENEC 3QI9A 4F7TB 2A1WH 1V8HA 4NJAH 5DMYA 3MLRL 2CPCA 1MLCB 4WGVB 4WFHD 4HIEB 1AQKL 4W4NA 3I02A 4GUPA 5BVJB 3DBXB 2X09A 15C8H 1KCSH 3GIZH 5C09E 5DYOB 1H3XA 5I9QB 1KF9B 5DC4B 4PJ8A 3G5ZB 2HJLA 3HN3A 2WUBH 1XR8A 4P5MB 1EHLL 1CU4H 4NQUA 3BKCH 1EIBA 4M7ZC 4PJFB 3R0NA 4NNYB 4QRRD 1CFVL 5ISZE 1DQMH 4WTWA 4MCZB 3V7MA 4MJ5B 1I9JL 3M1BA 2I60H 3D39E 4PRBB 2FH8A 4Z8FL 4XPAH 3DX7B 3BWAA 1WZ1H 4B41A 3U46A 2APVA 4FFWD 4G3YL 5BO1H 3U7WH 3IFOB 1KJ3L 4ZS6D 3RVTC 4DQOH 3OKDA 5HHOE 4JFOB 3MV11 2ZCLL 4NBYB 1T4KB 5E8DH 1CFBA 5MERB 4LARL 5D7IE 4N0YH 1MQKL 4Y5YB 2BSRB 4JDVB 2PTVA 4Y7MA 2MCPL 3QDGE 4K2UH 5FYLH 5HYSA 3OAUL 1MRCL 3NIDF 3FZUC 3E3QC 3PHOA 2XWBB 4DN4H 4PGJA 4S2SA 2GKIA 3OKLA 5F72S 3MRQA 2AV1A 1JTPA 4RWYH 4NRZA 4D9RE 5IGXH 2QSQA 3SO3C 1TVHB 4TSCH 4WI9A 4S0SD 2GAZA 1CDCA 5IMKA 5E8OA 3TZVD 1QTYT 2LVEA 2X4NA 5FA3A 4HCRL 4TYUA 3BT2H 3FTGA 1ZT4A 4UDTB 4FNLL 4ODHL 3OMZA 1DFBL 4JFPA 5IG7B 5IF0A 5GJTH 1FFNB 2BERA 3C6SA 3TBWA 1SYSA 2RR3A 2X9WA 2RJMA 4L1HA 1EZVY 2XYCA 3RWFB 2FHBA 4S11A 1NFDB 3N1PC 2B2XL 5C0AE 2YRZA 1FFPB 4P4KC 5DJZB 5DJAA 5B8CA 4KJWC 4X7EC 3AXLB 5IQ9A 5D6DA 1YEEL 4NN6B 4TNWF 1UCBH 3QULB 3BGFB 5ICXA 4Q2ZA 5IFHH 4ZFGL 4WENB 3GIVB 2JJUA 1U8OB 4XPFL 5AUMB 1X6LA 3CLEH 5FUOL 4RIRB 2YSSB 1R3KA 2YR3A 4FXLA 5JA8B 3TA3C 5TGBA 4XVUD 1FLRH 2AJVL 4O5LL 1JPSH 1I3RB 2PF6A 3BQUA 5HHQB 3WN5A 2DLFL 1AKJA 3BQUD 2BK8A 1UWGH 3QWOA 1JWSB 3QXWA 4L29B 2VDNL 5J6GB 4E0RA 1S7SB 3ET9F 1OTTC 2VITA 1FPTH 2EO9A 2VUYA 4UDUB 1XR9B 3AU1A 5CJXA 1YJDL 5IOPA 1J05B 5FHAH 2XY1A 3TBTB 3PL6C 5DFVC 1S9XA 3WD5L 4R97B 3QUYB 1MWAH 5E24E 3ZKQD 4HW6A 3HC4H 2B20A 4XNYL 5DDHB 1MLCA 2OZ4H 3D0VB 1NGPL 5IJVB 1T7VA 4S1SL 3KVQA 3BP4A 3I6LD 2BC4A 1RZGA 1F02I 1KB5L 2VDNH 4PJFF 4AIXA 5ICZA 2BY3A 4U7SA 1SEBA 2EICA 1QPXA 5DQJB 1KTDA 4LSRH 3DUUA 3I50L 4KZEH 3B2UC 4Y16A 3ZE2E 3NTCL 2Q7YB 4OB5H 4P46D 4HGWB 5MENA 3ECBA 4PJEF 4NNYA 2CK0H 3CVHA 3QCUL 3DSNA 1FSKC 3K2UH 4FQIH 3IDGB 1LWRA 3P73B 2E7MA 4N9GA 1SJEB 5DEFB 1SM3H 4Z7UB 1OSPL 1AGDA 4ELKB 1XF1A 2FDBP 2NR6D 1FE8L 4XRCA 5DEGA 3UYPA 4MYWB 1BX2A 4YHYB 4XTRC 1N5AA 4F8QA 5DO2C 1BZ7A 4H26B 3DYPA 1EXUB 2R1YB 4WEMB 2QHRL 4X7TA 5DUPH 5E9DD 3IFNH 1VACB 5LXGH 4NCC1 1O7SA 2BNRB 1BJ1H 2H45A 3K2MC 4N5EC 3JV4B 3AVEA 3SGDI 1T5XA 4PR5A 4PJGE 2BSTB 4X0KA 1YUHB 2XWBA 3BEWA 1BLNA 4KU1A 3ZHKA 35C8H 3VFGL 4NHUB 3JV5A 3U6RB 4P5KA 1YQVL 5FF6A 5J6HB 2JIXA 3AS2A 4KKLC 4UINH 4AENB 4F57H 4WI8A 3VFNB 4MA1C 3MBED 3TCLB 2YN5A 1MJ7L 4QYOA 2ITCB 2XKNB 4WDIA 2HFFB 2R1WA 5EU7C 3ILQC 4HIJA 1JHLH 2KUTA 1WJ3A 2BHZA 2Q76B 3D25B 3M07A 2DICA 4H1LH 3VGDA 4CJ1A 1BF8A 3FB5A 1HQ4B 3MRLA 4HK3N 5IJKC 4MAYB 1ADQL 4YDJB 1QBML 1I7RA 1FBIL 1RZJH 1SYSB 2XWJB 4I77L 5BQ7A 3B9KA 3B6SA 1DEEB 2FLRT 3DX6B 4KRLB 4P2OC 3C8HA 5LAXB 2HMIC 3WUWB 3LS4H 4U6HB 1Z3GL 1U8IB 4L3CB 4J3XA 1P7QD 3NGBC 1OP5K 4I0PA 3TJEL 4I0PD 4LEXL 5IEKA 1HQRB 2XZCL 4U6VH 4OSUH 4XAWL 4PYHA 2VQ1B 5ICXB 5E94A 1DDHA 4OZHF 5D7IB 2FATH 2V2TA 4JPVH 3T0BA 3IFNL 1G7LB 2NXYB 4CUCA 4JDZA 1FC1A 1WBYB 3I9GH 1R3KB 1HH9A 1KCVL 1NEZB 2DJSA 1JK8A 1FFOB 2DD8H 2FX8L 4QT5B 4P9HL 5I0DA 1YA5A 1WQVT 4F15B 3DURB 2DQUH 2Z31D 3KPQA 5HI5D 1B9ZA 4PTTA 1I9IH 4XNMA 1EERB 5KOMC 1S7SA 3MV8A 2IPUK 1ZANH 2CKBA 4O02L 2B5IC 2V2WA 2CD0A 1D6VL 2EIZB 3WLWD 5KW9L 3RZCC 4P23D 2BNQD 1KENH 5CEYB 2VLLB 1UYWL 5CINH 5HGDA 1I7UA 3PIQA 4U6XA 2O5ZH 3X14B 2B1AH 5TFSL 5SWSD 3MRJB 2ZWLT 1RZGB 3TYGH 5SV4A 1ZLUH 3I3DA 5IVXB 4WHYH 4JVPA 3MCLH 3PHOB 1X5YA 5IWLA 3GUTA 4HJJL 2W91A 1I9JH 2VKXA 4R6UA 1N64H 4YHNA 4PJ8C 4KRNA 2F5AL 1VHPA 4X99A 1ZVSA 2UYLA 2PYEB 1LE5A 1S78D 3VFOB 3ES6A 4R4BA 1XGUA 4X4YB 4FQCH 4CDGC 3TPUA 3ILQD 5E0QA 5D93C 1FORL 5LBSH 1E28A 3UTSE 4J3WA 1I8MB 3U1SH 5H2BA 4E5XA 2E7CA 5IJKA 5GS2H 5GRUL 4CN6A 5KBNC 4ELKA 4JY4A 3QFJA 1A6TA 3U9UA 3HLAA 3X3FL 4V1DE 2IALB 4C58B 3C9NA 3PP3H 4F9LA 3LZFH 2D7PA 4YC2B 4JG0H 2W9EH 3EFFB 1XAUA 5C0CB 4KROC 3LH2L 1EXUA 2R1YA 2XZAH 4XMLH 3BHBA 3OKYA 2D7MA 5K93A 2DRUA 3KJ4C 2YMXL 3NIDE 2Y23A 4DKFL 3S35X 1XIWD 1INQA 4HLJA 3M45A 3NA4A 3P4MB 1KT2B 1WVZA 1A6AB 4OQTA 3U4BH 3TWCL 4XX1E 3GBNL 4H0HB 5HD8D 3OL2A 1NSNH 3FQWA 5LCVL 1DUZA 1YNKH 3SDDA 1AHWA 4MJ6A 4YQXL 3MLXH 1ZHKB 1KC5H 5AZ2H 3RQ3A 3MLWH 5GGVY 5T1KB 1VGEH 1MCIA 3W11C 1QPPA 3ZT5A 4FMKA 3UCRA 4R7NB 2WUCH 4LGPB 2VITB 1JRHL 3CDYA 1CIUA 4ONOA 3SDXF 4LVOC 5JXEC 4JQXA 1A6WH 1F90H 1WICA 4YHKL 4H8WH 4QRQB 1G6RL 5EULV 4U1GC 1WCBA 1G9MH 1HSBB 3LSOA 3MLZL 4N8PA 3HPLA 3TLRA 4FQLL 4NQDA 3RBSA 4J4PA 2FX9L 4GW1B 4UQ2B 4IMKA 1KFAH 3ZDYE 2W59A 4CU8A 5F7WC 3EOBB 4UZGA 5BV7B 4ZUVA 1JHKH 3GSUB 1DN0B 1IAMA 4Z7QF 4MD0A 3WNNA 2ZUYA 3CX2A 3DUUB 4PJ9C 4D9QD 4P46B 2NY0B 2R8SL 5E8DL 4YHZH 1QLRA 1NEZA 3Q1SH 5HY9B 3DX8A 5LWYL 5EOCJ 2K1MA 3VWKA 1W0WB 3IDNA 3HG1A 3G6DL 3MRPB 3IDGA 5I17B 4ZS7L 1UM4H 3O9WA 5GS1C 3P73A 3C5SB 4BZ1H 5K9KB 1SJEA 3L5HA 1ADQH 2G75B 4P59L 4JANB 2IC2A 2IG2H 2HVJB 3HE6A 1HHJB 2XRAH 5C2UB 5E9DE 4JFHE 3T0WA 5IVXF 5KW9H 3INUH 4YDIH 1NMBL 5EIIA 1LHZA 5SWZA 1DE4A 1Y6MR 3GMLA 1DSFL 1K4CA 3PP4L 2GY5A 4OLWL 1QKZL 3EDFA 3JV4A 4CRPA 5HI4C 1V7NL 3SDAB 4U1SB 5IVXA 3CFKA 2P48B 1KG0B 1UZ6F 3PWVB 1AXSA 3QUXD 3NFNA 4JZOB 3VWJA 3CFJA 5J11C 2ZSWB 2BNRE 2FX7L 5DJXB 3BO8A 3PGFL 3TNNB 1ZVSB 5LG1A 3LQZA 3F7VB 5FYLE 5KANG 1X4YA 3UTTE 5HDBE 4B7LA 4KDTA 1MNUH 3IXAA 1MLBB 4FQLH 2JB6B 2X05A 2FYYA 1MEXL 5CD3A 4LCUA 4GAGL 2HFFA 2NXZB 2R1WB 25C8H 1I8MA 5GGRB 5LQBH 1ZK9A 3MUZ1 4PREA 4E5XB 1FNGA 4JQVC 4QHKJ 1LEGB 3MUY1 5E5MA 4XGZB 5JW4M 3H9ZA 4O58L 3B2VH 1FYTE 1FBIH 2DM4A 4GRLC 4HT1L 4RDQF 4X83A 3HLAB 1MHPH 1MIMH 4EZMA 3TVMA 1PFCA 4FG6D 4WRLA 5EA0L 1T3FB 1CFTB 3ARFD 1BQSA 3S4SB 4CGTA 2OJEB 5L9DH 3TZVC 1JGVL 2F53E 1FO0B 4Q9QL 2P42B 4ALAH 2N7BA 4LCWD 2XICA 4PRHD 1UEYA 3ZSTA 5GS2D 4NO0B 4NSKB 3HZKB 1QSEE 3OG6B 3G6JF 5DMGD 5IT2H 1BOGB 2N4IA 3K4AA 3O8XC 3B2VL 3VMOA 4F7CA 4Z5RB 5IEKB 2J8UE 2WIIB 2AERT 3P9MA 1MY5A 5F7KC 1S8DA 1ODAA 2X9XA 4I48B 1GGCL 1QLFB 2GK0A 3QI9D 4XXDA 2FB4L 5DVMA 5FO8A 3V6OA 3QQ9C 3TN0C 4TULL 1KEGH 1AHWB 2CKBH 4MJ6B 3JWOC 4P2QD 5DI8A 1MCPH 3K0WA 2L7UA 4J4PD 4LQ1A 5EFIA 5I8EB 2XQYK 4KK9C 3SBWC 4WWID 3KR3L 2CRIA 4APQD 2H6PA 4JG0L 3QBTB 2PO6A 3OKMB 5F3BB 3OJVC 1ED3A 3L3GB 2O5YL 4IOIB 4HH9B 4ODVH 1N4XL 2EIZA 3T0EA 4WW2C 2SEBB 1NAKL 1BD2E 4OD3H 2VR9A 4FQ2H 4HGMA 2J8HA 5JUEL 4EIZC 4YHOL 4ORGA 2NTFB 3PIQB 2IBZX 5KZCB 3BJLA 3MRKA 4P59H 5E2TH 3BKMH 2R9HC 4YZFF 2HTKD 1BMGA 1FO0L 3P11H 2NTSP 1GZQA 3OKEB 3BKYL 5HTSA 2VDMH 5ACLA 3U79A 1FJ1B 4MQXC 1ZA3B 1B90A 3N9GH 2BY0A 5GSRB 2XA3A 2UYLB 2EZ0D 5GGRY 5D2LA 4MXVE 4RCAA 5D2NB 5JDSB 3A67L 5EZLA 5HYJE 3BUTA 1U8PB 4JFED 5H2BB 3V9FA 1G9MC 5IROC 1ZGLP 1TZIB 3O0RL 3QIWB 5D2LF 3OAZH 4KK6C 3ULUL 5DQ9A 4XC1H 3ULVE 3OV6A 3CDFA 5C0DA 1R5IA 1VCAA 4Y19E 2A74B 4Y4KC 2HLAB 1WIUA 3H3PL 1V5JA 3TZVA 4NM4H 1NDMB 1T5WB 3GSQA 5ESVA 1S7TA 4U1IB 4HJ0D 5SWZB 2XTJD 2FX8H 5KAQF 4WWKC 4D9QE 4JFFA 1MFEL 1TQBC 1EAPA 2I5YL 1UA6H 3SDAA 1CDYA 4OGXH 4OZIE 1ZGLM 4KKBD 2NY6B 3P9LB 2MOVA 5EU5A 5LBSL 3KLDA 1RU9H 1WITA 4UU9B 3H9SE 3ZYJA 3E2HB 3TN0A 1Z0NA 2ZUSA 2I24N 3LQZB 4U0RC 5DQDH 5E6ZA 4P48A 3M17B 4LSRL 3G5VB 2A83A 5CUSH 3OXRB 1NEUA 1ACYL 2DQHL 2H2PC 2J3SA 3NCJL 3LPFA 5JIPA 3P30L 2VL5B 4FN0A 2AJYL 3BDBA 1QBBA 3TIEB 3QJHA 4GMTH 5AWNL 3PL6A 1R3HA 1FGNH 5EOCL 1RUKH 2KH2B 4CNIB 1SJXA 3EJYD 5CJOH 3S3SA 1OAXL 3KJ6L 4KK8D 5TDNA 1IGCH 1X4XA 4ZQKA 4IRJB 4AG4H 4NO0A 1GOHA 2R23B 5KS9F 3HZKA 5GQBA 4APQA 2OM5A 1DANT 1LNUA 3V52L 1I9IL 3KPNA 3ALWA 3MUJA 4Y0GA 3WFHA 3U4EA 1I1AB 35C8L 3AMLA 4FQXB 5C6TH 4LHUB 3TIDB 4GAGH 3VFUB 1SHMA 3HNTH 2YPVH 3GBMH 5I6XC 2QKIB 2HYMA 3DX9A 5DI8B 4K8RL 3MRBA 4NQSA 4TRPL 2MSPA 5CIPB 3U83A 2ESVD 3FZUD 4LCWE 4L4VD 4K7FB 2ZKHL 3O9WB 5CKAA 4U7KA 3AAZA 3MLSH 3KPSD 4OBRA 1KPRA 1CE1H 4PD4K 1EEZB 1RZIB 4OAWB 4S1RH 5I1LB 2R2HB 4RNRB 3QO0B 4JQIH 4PJCE 3UC0L 3EOTL 3MA9L 1S5HA 4KI5C 5T3XH 1CDGA 2DMBA 1Y18B 2VERN 4I77H 5DJ2B 4PJXF 3FO0L 4HLZG 4L4TE 5D7JD 3RWIB 5EIVA 2I60L 2Z9TA 4PB0H 1A3QA 3S35L 3S34L 3LRHA 4PRHB 5DUMH 1QG3A 4U3XA 3VXMA 3MGOB 2BRRL 1EFQA 2R1XA 1FNSH 4JZOA 3VWJB 2BHYA 4QCIA 2Y06L 3KYKH 1S7QB 1G9EA 4R96B 4QHMB 1CLYL 1MLBA 3WFEL 3BZDA 3EDDA 4XI5C 5GRWA 1NAMB 1T7XA 4HFUL 1INEH 1U8PA 3MOBL 2VLMD 5J1TC 3OAUH 1XF3B 1X7QB 1S7XB 1NDGA 1C5BH 1OARL 4FFYL 5HHMD 1BEYL 1GVIA 1QA9B 4WGWB 2EDQA 4W68A 2DQJL 1VERA 5C0DB 1ZWIB 1HXMA 4F7EB 3KPRA 1T3FA 2CJUL 2E6QA 3MJ7B 1NCAL 3NZ8B 4I3RH 2IGFH 1NFKA 3GGWA 3F5WA 4WWKA 4RA3A 3OBAA 3QCTH 3SDCB 12E8H 2OS7A 1TPXC 3C60C 3SE9H 2ICES 3HG1D 4Z5RA 3MJ9H 1P6AB 1DQJA 4NQED 1OP3H 2YUVA 3FO2A 3JVGA 3X11B 5EU5B 4AQOA 2VE6A 3O3DA 1Q9LB 2Z8VC 3FQTA 4PGBA 4LPWA 3WO4C 5KS9E 3DETC 3DVNB 1S3KH 1PLGH 3LRGA 1CICC 1MJ7H 1F11A 12E8L 3M17A 5C0AB 1IEAB 2A83B 3IXTA 4MNQD 3HC3H 4NN7B 4FQJL 4Y4KD 4HBCH 1YECL 1A2YB 1YNKL 3VXUE 3GO1H 4OLVH 3HCVA 2NY4C 5DWUH 4ZTPL 4RRPG 1A9EB 4HKXA 4M7KH 4IS6B 4RGNE 2ZOKA 4HF5L 1HKLH 5EU7E 2MKWA 5KS9B 5C0JA 1DLHB 1MCWW 3CLFH 4HH9A 3T0AA 3MOBH 1CK0L 1WC7B 4CNIA 4IMLB 1UH3A 4NZJA 4OZFH 1ZT7A 3MRHA 3NAAL 4QRTA 2VLRA 3SDXA 1P7KA 2WM0A 3MBXL 5HHNA 3KYOB 5EC2A 3C8KB 5SWQA 4LLYA 3HAEA 4XWGH 3N1FC 5HGAB 1T83C 2MTPA 4U1MB 3TFKD 5DXWA 1FNAA 3MRMB 3V4PH 1MRFL 4LLDA 1T0PB 3TIDA 3GMMA 3PWNA 4XT1C 1BIIA 1YQ2A 3IDIB 5GHWL 5HHOB 4MJID 2V5MA 1T2QH 2P45B 4JM2B 4QRPA 5DHYB 1H8NA 1LD9A 2KPNA 1HCVA 4OZGE 4AQ1B 4ZFGH 5CIPA 4OCXL 4XI5D 2X70B 4GRWF 1A3RL 3WKML 4Q97A 3BQUC 1XT5A 4WIQA 1M05B 5EOQH 3AAZB 4RFNC 3EZJB 1KJ3H 4LSVL 1EEZA 1RZIA 3MRFB 4OAWA 5I1LA 5C0RL 4PJIA 4M1CC 1GOFA 2MHAA 5FDWB 5TE6H 3WNLA 2OJZL 1PZ5A 5CD5D 1R5IB 3SGDH 1INEL 1K8DB 1P53A 5FM5O 3PGDB 1OM3H 1MNUL 4TUOB 4ZNEA 4OZFB 2IANA 1PYWB 3CFDA 5K33A 4WNQA 3LQAH 5BOZG 1C5BL 4FFYH 1T20B 4LP5A 5ISZB 2AQ3A 4N90D 4ERSL 4OD2B 4BH7A 4M7KL 5C6TL 4NNPH 1JP5A 2CK2A 3H2WA 5E6IB 2VXTH 4Q9RH 4G80B 3RWHA 5IM7B 3T8XB 3HTLX 1U95B 4UU9A 3L3IA 4GG6B 2XN9E 1CICD 4Z7VA 1TITA 7FABH 1UXSB 4Y5XC 1OTUC 4OIIL 2B7DT 5CILL 1ORSA 5TQ2H 5I1GH 2OTUB 2V5TA 3T1FA 5IR1A 3MGTA 4M93B 1LDPH 1QFWM 5T1KD 4FRWA 4Z7VF 5FCUL 2OMBA 2J1KA 4Z7NE 4CMMB 1H5BB 1FAIL 5ALBH 5I1EL 2C5DC 3QNZB 4S1RL 1H3WM 5C0NC 4QY8B 3UC0H 4AEIL 5L2KA 1OF2B 4RRPA 2EIEA 2Y5TB 2WV3A 3NCJH 2FO4A 4ZAKB 4M5ZL 3DRQA 3PNWB 4L3ED 4MA3B 4MMZC 4NKOB 5DQDL 1KELH 1HHIA 4DN3H 1QO3A 1U8LB 5DK0B 3JSSA 3MXWH 2X4QB 3JVGC 3P9WB 1G7HB 4PGBB 1JGDA 3TO4A 5F6HJ 3VXPB 5GGSY 1VADB 3REWA 5E7FA 1RSFA 3KS0J 2XWTB 1FV1A 1GGIH 3BH9A 3KYKL 3FFCD 4JPIB 1A2YA 2VNCA 5EDXA 4AG4L 4XB8A 1QSFB 3WFCH 4OT1L 4NFCA 3GDBA 4XP5H 5D1QB 4YDKH 1A9EA 4HKXB 2QQLL 3BP7B 5EC1A 4K3EL 5L6YL 5M94B 1LO4H 3KXFD 3MV9A 5HYFA 3RVXD 2W65A 1XF4B 4LPXA 1NGXB 1DR9A 4RNRA 2FR4A 1YEHH 3EJZC 3MV7D 1GIGH 1F4AA 1WC7A 5FO7B 3LDBB 4NZDA 5BS0B 4MNGA 1Y18A 4G6JH 5LCVH 1IGIH 3C5ZD 5GSVB 1G7IB 4HZAA 2BSSB 3KNBB 5CUSL 4XC3H 2AEQH 3BDXA 3ARPA 4QTIH 2ZKHH 1FAIH 5ALBL 5I1EH 1B4JL 2GSGA 4XPAL 1N3NB 1BVLA 3UYOD 1UH4A 3VFSB 4PJCF 1FO0H 2R1XB 4G7YH 1A7OL 5CCKH 3CFCL 4M4PA 4GS7B 2CK0L 3PABB 3AUVA 4JHZA 2FH6A 4U1JA 5JLZB 3DWTA 4PRHE 1VEPA 5GJSL 1MCKA 4F9PA 1JZ8A 1F13A 2QADC 3T77B 4PV8B 3L7EB 2A73A 1K4DA 1UA6L 5MEPA 1XGTB 4ONHB 3GSXB 1WZMA 1MHEB 1U93A 1AR1C 4WFHE 5ITBL 4MQXD 5IQ7H 3QUML 2JJTA 5IVZA 1TVBA 3QEUA 4OGAC 1RVFL 2H9GA 3Q6FB 5JIHA 3SGKA 4R4NC 4M62H 3SCMB 1FL6B 2VXVL 3N1GC 1CGTA 3EW3B 5I18H 3TM6A 4GJTB 3CFDB 1N5YH 4RGOH 4ETYA 3PXHA 3SDCA 4KQ3L 2CMRH 3L3JB 4M6NH 4OFYD 4R2GC 1I8IB 4MLSA 4OFPA 3CD4A 4LSSL 4UILL 2P8LB 4PGEB 3W9DB 2ZUQC 4YX2L 5JPNA 1DL7L 4XP1H 1Q9OA 2X4UB 5CMAA 4Z7VB 4OIBA 5C08A 3L3OA 4ZPVA 4Y5XA 3QDMD 1JPFA 3LMJL 1LO3H 4OKDA 1XF5B 2Q86B 1EH9A 1OAQH 3MGTB 3MODL 4OM1H 4XNUL 4DZBA 2X6MA 1MJUL 4EDWL 2IPTH 1T66D 1K6QH 2ZPKL 1LEIA 3S5LA 2ZOKB 1KYOJ 1OD7A 4WV1C 4R90L 4BZ2H 5I2IA 5H35A 5IMMB 4QOKE 5KS9A 4I1NB 1DLHA 5IB4B 1W72A 5L2KB 2CRMA 3ULVF 1EHNA 2AVGA 4ZOCA 3WCYA 4CMHC 2EEBA 3VXSB 1S7VA 1MCBA 4W70A 3AY4C 1Z5LB 5E4EB 1LP9E 4LSDA 3D2UA 4WHYG 3SOBH 4TULH 3I6LE 5SX5H 1T03L 1BOYA 3RWEB 4FXKA 4M9OA 3NIFF 2VWEC 1F2XK 2PR4H 3HAEB 5E4IA 2VWEE 1CGWA 2VC2L 1OWWA 5HGAA 4JKWA 2ITDA 2I9TB 3QNXA 1BM3L 3TO4B 3TH2T 1S9VA 4H20L 1J10A 4LAQH 3CCHB 4GBXB 4RGMB 1ZTXH 1HCFX 5JXAL 1J0IA 3A0OA 3VG9B 1TCMA 4NDMB 1VFBB 4QRPB 2VXQL 5MP6H 4N1EA 4K23H 3ARTA 2DI9A 3V6ZB 2NY2C 5HJ3B 4FOMA 5ID1B 1DBJH 3DRTB 4YHPA 5DURB 3ALPA 5L9DL 3LY6A 4U1HA 2NY3D 3CU1A 3GHEH 5C0AD 5EA0H 2DQDH 5EU6E 3H8NA 4GKOA 3S35H 1M05A 1H9VA 3KG5A 3RAJH 4O02H 2D7QA 1MFCH 3GSOA 3DNKA 1XF4A 1QYGL 2AP2A 3ZDXE 2OQJB 5LGJA 5FYLD 3OKOB 2FO1A 2NW3B 1GPOH 4N0UB 2VMFA 1CFNB 1IM3A 3NABH 4NZRL 4C83B 1DLFH 2DTML 4MNGB 3UPRA 3K3QA 3MO1A 2DQFA 2ZCLH 1I1YA 3G5YB 5DC0A 3ZL4L 4P5TC 4OD2A 2JELH 2Z35A 1IC1A 1SVZA 3MV9E 2G60L 2JJSC 4ZAKD 4JREB 3B5TA 5MENE 1G0DA 4Z0XB 4G80A 1X5HA 1Q72L 1BWMA 5EU4B 1PZUB 3ZL4H 3ZYIA 3PABA 5JLZA 4TQEL 1V3MA 5L0QC 4OZ4A 4M4RA 1EHLH 3EO9H 1TJIH 4NKMB 2CUMA 4NQXA 2V5SA 2OTUA 2UUDK 1X5GA 3O4LD 1M4KA 3WN5C 3FFCB 1ZHBA 3V6FB 1P5VA 3VD7A 2DMKA 4O2EB 1T2XA 4EUPB 3NIFE 4IDJH 2PXYC 3GRWH 4J3TA 1NFIB 1QSFD 3SKOA 2D03L 3OWEA 1D5ZB 2YOCA 4M6OL 4YZFE 4NJAL 1T1YA 2W0LA 2FSEB 4OQTL 4FQQA 1D3CA 3MOAH 4DAGL 4I13B 2WBJB 3UDWC 4UT9L 3BEVA 1P2CA 4APQC 3ZHLA 3VG0L 1RHHA 3LRSA 3MR9B 4BZ1L 4XCNB 3BN9C 2BRQA 3A6BL 4HUUA 4MXVF 4BFEA 5JZ7C 2X1WL 3GBNH 3CZJA 1U8LA 4LCIL 3P0YH 2NY5L 5KVFL 2J4WH 3O2VH 4M1GH 3SY0B 2OR8A 1U92B 2WZPD 1ACYH 2DQHH 3EHBC 3REWB 3NVQA 4DGVH 3VI3E 4X6FB 2G2RA 5CJ8A 2XN9A 1A6VL 5I1JL 1RVFH 1DQQB 3QUMH 2F74B 5ITBH 4AYFA 2F54D 4LSPL 1A7RL 3MV7E 2W65B 5INDB 2NY0D 4F7MB 4FQIL 3B9KC 4FG6C 1ADQA 4HS6B 2C4FU 3R0MA 2R0LL 1H3PH 1T2JA 5DD3H 4KV5F 1F3DH 1RMFL 4OZHB 3OXSB 4WUUA 4XNZB 2NY5C 1J1OH 4UV7L 2Y7QA 3MV8D 3D2UB 1G7IA 3EYUH 1EO7A 3LD8B 1FZKB 2H32H 3QDJA 3VXUB 3WEXB 2GUOB 4FXKB 4XZUB 3S3JA 4Z77A 3C2SA 1EVUA 3FN9A 1BVLB 3EKCA 5ACZA 3EYSL 1OLZA 1VFAB 1KB5H 1G6VK 3NCYP 4WHTA 4OV5A 2QSTA 3BZ4B 4BH8A 4RAUB 1TCRB 3V6OC 3I6GB 5L2JA 4BJLA 4XVTH 4Z7UF 5GISL 1A4JA 3EYSH 2ORBL 1WWCA 1R0AH 1HHKA 4J3UA 5MEPB 4IOSD 4NM8L 2EXYC 4P3DA 1ZSDA 2D31B 4H0GA 1HZHH 1U36A 4KMQA 1KIPA 4KY1H 3WDHA 3Q6FA 3SCMD 1L9MA 4GXUM 1L7IL 3SCMA 4GH7B 5I1JH 2C3HA 2DQFB 4WFFD 4JO4H 4EVNA 4YBQD 2DYPB 1HZHL 2P8MA 1A7RH 2VJXA 5F9DC 4LDEB 4OZGB 4N8CL 3WL9B 5MI0C 4LASH 3HMXL 3JWDH 2NY1C 4Z7OE 3RGHA 1ETZA 3PWJA 1EEQA 3RWGA 1Z9MA 3VRJA 5JPNB 4XPHH 3FHQA 4LEOB 3TJEH 4D0DA 5EORL 3D0LB 4J1UA 3AS0A 1FFRA 3QAZB 1FG2A 3EO1B 3O3EA 5C6PB 3BISA 4PJFE 5J13C 5DUBA 4C55A 4PJ7F 1EV2E 4OZIF 1IGTA 4EUPA 3MLTA 2J8UF 4X5XB 4ZOBA 1FZOB 5E5RB 4WO4A 1YMMA 4G42B 3QT2A 3V4VH 3HR6A 1AH1A 1IC7L 4X4MA 1AC0A 4MNQA 1D5ZA 5H35B 3B3IB 2FJGA 4ALAL 1NLDL 2UZXB 2ZOLA 4Y4KA 2J8UA 4OLXH 2XTJC 2AJXL 4HMDA 5HBBA 1BJMA 2IBBA 1KJMB 4Y1AA 4NNXB 5IGXL 4KRPD 2UY7A 4QHLB 1UJ3B 3MR9A 1M1SA 4U1LB 2ZCKL 5BV7L 3RWEA 1G1CA 5DZLA 4I18C 3ME0A 1R5WB 3LCYA 1SJVA 3FO1A 1ZHNB 8CGTA 1E27A 2VB5A 1IBGH 1II4E 5HHMB 1Y6NR 4PJEE 3VMPA 2JB5H 1HEZA 5ANME 3U7YH 2E9WA 2Z31A 1KB9J 1C8PA 4LARH 4NDMA 5BCAA 4JPVL 2V2XB 4LLUA 4N1CA 5DJ6A 3QIUD 4JPKH 2VN4A 4JRYE 4BFBD 1J87A 5F1NA 5J1AA 5E8NB 3LS5H 5J9PA 3O4LB 4FTVE 4NGHL 1NGQL 3VFTB 5ADOL 1U8JB 1P9MC 4Y89A 1IFHL 4UT9H 4RGND 5EWIH 3LKQB 2VR4A 4PJCA 4NYLB 5DR5H 3R06B 4PJGF 3LMJH 2W92A 1IMHC 4X7DC 1DN2A 5AAMA 3G5YA 4PGDB 2GUOA 4TPRL 1IC7H 2F19H 4N0UE 2J5LB 3KYMA 2XIDA 2H1PH 2AK4B 3VGAB 3T09A 5JDJA 1MAMH 2H8PA 4YBHA 4Z95H 4MDIB 3EGSA 1DCLA 4KRMB 4QRUB 3CFBB 4I5BA 3I6GA 1OGAE 3UTTD 3QHFH 2NZ9D 2W9DL 1YNLH 1J8KA 3HG1E 2C3WA 2WANA 1T7YA 3RUGA 1RZFH 3C5JA 3IYLW 1OAKL 4BA8A 5KZCD 5D7LD 5FECA 5LXGL 2QEJA 5DURD 5DUPL 4ELMB 1DZBA 4JQXC 2XOTA 2IAMC 3T0XA 1XGYL 4HIHB 4FQQB 3DXAA 3R1GH 1NC4D 2XQBL 5C0GA 1MH5A 4LCYA 1LDSA 1XH3A 2DWEB 3LKNB 4POUB 5EUOE 4XP6L 1G7MB 2CDEA 1LQSR 5SX4H 3LRSB 5HYSB 4GSDH 1CE6B 1RJLB 4QOKB 1NGYA 3HFML 2C7UB 1GCFA 2J6EH 3KPSA 2LU4A 1B4JH 5FV1L 3PE9A 4HPYL 4KDTC 2XQBH 5CBAA 5TPWL 3O3EB 2GAZB 1SYVB 1OP5H 5EORH 2B2XH 3LKPB 3QG7L 3JUYA 2EECA 2A6DB 3H9SA 5JR1H 3VD9A 5IB3A 1IILE 2VDOH 4ZO7A 3QIBD 1MCRA 4IRZH 2R69H 2IFGA 4FXGB 1L0XA 5JOPD 5CAYB 5DK2A 4F2MB 2A6KB 5INDA 5B3JF 4LKXB 1EUTA 3OKKA 4JO4L 4O2FA 1RMFH 1JPSL 1YNLL 5DMGC 3LPGA 5IMLA 2P24A 4YHKH 1UJ3A 1JRHH 3MREA 1FDLH 1DQDH 1SVCP 3P4OB 2A9MH 2YPLE 5IKCB 3EYQD 1UQSA 4ODSL 4JPWL 1ZS8A 3WJJA 3MJ8A 5ACZB 4GFTB 4DN4L 4G9FD 1IE5A 4PRPE 1YPZA 1KB9K 1U8HA 2YUWA 4EUPH 3LB6C 3QFJE 2OXGA 4KK9D 1TCRA 2MJWA 2APFA 4ODUA 1KV3A 2YPLA 1M7XA 3WMSA 1KXTB 3KXFB 3S4SG 5AYUH 3VXUD 4EI5C 1X5JA 1NMAL 5B22A 3ARWA 3IFLL 4DTGH 2ICEA 4KTEL 4PRIB 5GS3A 4LCIH 4GQ9H 2E8YA 3A6CH 3OAYH 1J5OL 5I1DA 5TFSH 4PGCB 3FRPG 2GJ6D 4NQEB 4M1DL 3K8MA 4BM7A 3BPOB 5IOPB 1JPTH 2OL3A 3A6OA 4XPTL 4FA8A 1RI8A 3FT2B 4KROB 2X4PB 1T4KA 5E1HB 5D8JL 5DS8A 4XWOD 4LHUD 5I71B 4NYLA 2NY3C 5DRNA 3DSFH 4U7MA 1OW0A 4JN2B 4ZO8A 1CLZL 3FB7B 4CADA 3MLYH 4R26H 4Z95L 4JHWH 2GJ6B 4ODWB 1CR9L 4HK3J 5D1ZA 4YPJA 3VRJB 4G9DB 1MWAA 3HI6H 4BELD 2DQGH 2ADJB 3WS3A 1FNFA 4S1QL 3QWRA 4Y4FB 1DUYA 1C16B 2OTWB 1EPFA 1VENA 4Q6IA 2MCG1 4HKZB 4HKBA 3UJJH 5C92A 4JG1L 4K07A 1NGQH 5ADOH 5CIPH 4LHQB 4XAWH 3V4VL 2Q8AL 1T1WA 4HUVA 1BP3B 2PCPB 4WO4B 3B4NA 2ARJB 3MA7A 4RMRA 5DLMH 1BD2D 3ORJA 4G6AD 4LVOB 2EH8L 4XCEB 5IG7A 1A6UL 2DQCL 3GJEB 3PGCA 2ADFL 4JEGB 3T0EC 3WKMH 1NLBH 3IDUA 5BMFH 1L0QA 4F8TA 2VYRE 3W5NA 4BSVB 5GJTL 1S9KC 2DLTA 1G7MA 2CDEB 5DJZA 1WISA 5JOFB 5EU6D 2BSTA 3DYMA 5AAWA 1LO2L 2ZSVB 4X5LA 2QQNH 1NGYB 4P3CL 5IP4A 3O41A 4PLKD 3BKCL 3S37L 4MD4B 3HNSH 3EYVB 2X1OA 4NWUH 3F12A 3UYRL 4YIQA 5F7DA 2O93L 1T0MA 1A47A 3W0WE 4P3WA 1IGCL 3LQAL 4YE4L 1HINH 1TTGA 4BYHA 4LGSB 1UCTA 3QDME 4OV6F 2B4CH 1KCUL 1EZVX 4MQSB 4ZFZB 4NQTA 2P44B 4DN3L 3HE7B 5J6GA 1E4WL 1DVFC 1HI6A 4HS3B 3PQYA 5DTFB 5HVHB 2R29L 2VLJA 4HG4J 5DMJB 3QCVL 4DTGL 2C1PB 1PKQE 2P24B 3GSVB 5LAXA 2FECL 2Q3AA 1A6UH 3DGGA 3BZEA 3TEUA 4EQ3A 3RVUD 4GRWE 3O4OC 4JLRA 3WNMA 3ZYZA 5E1AB 4P49A 4WY7H 1LEKA 3BP4B 4GAJL 2VSDA 3V4PL 4WCYL 1DDHB 5D1ZC 4MX7B 5H37H 2VDRH 2AW2A 3HHRB 3ZMRA 5DQJA 5T1LD 5J11B 1U6AH 1J8HB 1A1NA 1TZHA 4YXLH 4Y5VB 5GHWH 4NUGH 2NQCA 3DIFA 1G6RH 3FT3A 3MRIB 3RL1A 4MZ3A 2ED8A 2CDFA 4KGJA 1FNHA 2V5YA 4FZ8H 4KVCL 3C5JB 5B39A 1HYSC 3DVGB 5FUCE 4JFDB 3RVXC 5KSUB 2BCKB 4RFEA 4HX1B 2NPLX 2OBGA 2FEEI 1CDJA 3VA6A 4F37F 5DEGB 4KZDH 4LGRB 4NQDE 2ORBH 5FGRA 3RZCA 2VZSA 2FWOA 4P2CG 2BHUA 3DXAB 3RA7L 4URTB 2NNAB 3FQXB 4U6YA 3VA2C 4X7TB 3WFEH 4HD9A 3ARGA 1LK3L 1ZLSL 3RHWK 1N2RB 1G7QB 1YUHA 2ESVE 1BF2A 2C3VB 4WU7B 2HT4D 4KKAC 4YHNB 3QPQD 3HMWH 1IZKA 4JAMB 4U6TA 2PW1B 2NY6D 1MY7A 4UUJB 1HIMH 2RFXB 1OP9A 4ZUSA 3PWPD 5C0IA 4U49A 1M7DA 4UT7L 3TPUB 4F9PC 2QADD 3EOTH 3MA9H 5BRZB 2O5YH 3MBEC 4PJDB 3FB5B 2DQCH 1IKFL 2L0DA 4LSTL 4U2YA 3U9UB 4DGIH 3BE1H 3RWDA 1MREH 2A9NL 5E6ID 3VH8B 2LFGA 2VAJA 4C56E 1U2HA 4O4YH 5C0CA 5F9OH 2XPGA 4BSWB 4JVUA 3DMMD 5JHLH 1T22B 2BXZA 1C5DA 4L3CA 1J1XH 2FRGP 2JJVA 3DROB 4L5FH 1HSAA 3NN8B 2ARWA 5IW6B 3L9RB 1KT2A 3I75A 4MCYA 3RKDC 4OCWL 4Y4HB 1U3HA 2HMID 6FABH 5HYEA 3MJ8B 4DEPC 2IANE 3QUKA 5C71A 4X4ZA 4J2XA 4Z7WB 2GT9A 1MIEH 1RJYA 3VXSE 3SDDC 3WUWG 2J2ZA 3W2DH 1YEDA 5HDLA 1RJZB 1RUAL 2YPLB 1WBYA 4QRRE 2WP3T 1RD6A 3O6FB 5CEZH 3B5HA 3IU3B 3C09B 4YFEA 3H9YA 3ARRA 4YK4C 3PHSA 1URLA 1MIML 2FIRT 2BNQA 1W72L 5D6CA 5E8EB 3T2NL 2OP4H 4XP6H 4F7PB 2DQUL 1FYTB 4JFZH 4ZUTB 4JY6A 3U7AA 1I7TB 4J6RH 4WV1A 4DKAA 1KN4L 4QRPE 1CG9A 3VDBA 4PFEA 1NLBL 3SKMA 1JMXA 3BZEB 3ARYA 5CZVH 4DQOL 2DQJH 3GRWA 4L9LC 5IEHB 3NCMA 4G3YH 4J6RL 4ZFOA 3I02B 1FYTD 5BVJA 2CLRA 3CAFA 2XZCH 5A40E 1QNZH 1SJHB 3QQ4A 5D7JB 1DN0A 3FOLA 4UB0H 1HINL 1A1NB 1TZHB 3EOAA 3S9DB 3QUMB 1GGBH 2GJZB 2RBLA 3LEVH 3FQNA 2Y06H 1DUYB 3DX8B 5F6IB 1RZKH 4CW1B 4PLOB 3INUL 1MIEL 1CDIA 3V0VB 2WP3O 5F6HI 4EI5A 3M1BB 4M1CD 1QBMH 3FO9A 3LEYH 3C5SA 5K9KA 3FB8B 3HS0A 4Y88A 3PDOB 1GYAA 5BXFB 3O2DH 1F4WL 1R24B 2FL5A 2UZIL 4XMKH 3RVVC 1MCNA 3RIAK 3EIFA 3MA7B 5JNYA 3S36H 1A6TB 2XFXA 1CT8B 2ZJSL 1SMOA 3G6DH 3MYJA 5DMIH 5MERA 1JPST 3WJLA 4DZ8B 4GBXD 1WUNT 4X5WB 1KTKE 3RVWD 2NNAA 3FQXA 3H7BA 4U6YB 3U36A 1BHGA 3E8UH 3DHMA 3RI5F 3U7WL 5HPMB 2AS5M 1BVZA 3A6CL 1J5OH 4P5TA 5DVOA 1KJ2L 1P4LA 2P5WD 1QSEB 4LSSH 4MAUH 1RU9L 1KCKA 4KTEH 5FCUH 4M6NL 2Z4QB 4O2CB 4PRDA 4QRSB 3CFJB 3UJTL 4Z76B 3VXSD 3BUYA 4KQ4H 3BYYA 4UUJA 5C2BH 3CNKA 1TVHA 3ZKXC 2F8OA 1YEJH 5T1LB 4OCSH 1RULL 2WLZA 4YPGA 3ZHDA 4RX4A 1N59B 3H42L 4CVXA 3MYZA 1KB5A 3VXRE 4ZXBA 3VE0B 4KKBC 5IQ7L 4ZFZA 1GRWA 2NY7H 5C0FB 4PJDA 4E41E 3V0AC 2PXYD 4DWHA 2WUCL 1J1PH 1IGJB 1U9KA 1TQCB 1RIHL 4R0LA 1E4KC 3QCUH 5CEXA 3KJ6H 1I7ZB 3HAEH 2ATPB 1CD1B 5JHLL 2MQ3A 5BZWB 3RA7H 2XPGB 3ROLA 4PY7A 4F37K 3A67H 1S5IH 4X9GA 5KOVC 3IU4H 5B8CB 3ARBB 1VPOL 4JLRB 5IFAL 1HSAB 3NN8A 3N1MC 5IW6A 4YX2H 3J8F7 3L9RA 3T04D 3VFMB 4I18A 5GGSB 4LRNL 1A7QH 3AS1A 3VGBA 5GGQL 2NLJB 3HZVB 3MGAA 3RHWF 4S1SH 4IEFB 5CJQL 4Z7WA 4MD0B 1YDPA 4NT6A 2GT9B 1BD2A 2FEDD 2JF1A 4LLMA 3IF1A 5F8QC 4XVUC 3KLHC 4EJ1C 4CVWA 4QEGA 1FVEB 2QJDA 5FM4A 1NH6A 5KSAB 1OSZA 2D0HA 1GHFL 1N6UA 5TGBB 4F33B 4L8CB 1U8MB 5D2NE 5JUEH 2R0KL 5LGHH 2ZUVA 2R56L 5SX5K 1MI5D 2M26A 3L5IA 5EWIL 1D6VH 4MJ5A 3S96B 2X7LB 5FYKD 3CK0H 5A43C 2PO6B 3OKMA 1NCWH 1HHGA 3D85D 5I76A 1QSVA 2DM7A 5IBUG 1WLHA 1R6VA 3OGCA 3IFOA 1IM9D 3OKDB 5EO9B 2HFGH 3L3HB 5L7XH 5F44A 4D8PB 4E42A 4OTXL 3MRGA 1OQXA 4X6DE 3JV6A 3MUGA 4HUWB 1VFMA 3ARGB 4HXBH 1MRDL 3SQOH 1N64L 4GW4B 2GQHA 1N2RA 3FQRB 1MJ8L 1G7QA 1E4WH 4GRWH 2CLRB 2JK5A 5BZDA 4MXQD 3KDMA 4PS4L 3ESUF 1FJ1A 4IRSC 1DJSA 5HHOD 3GO1L 3TNNA 5F9AC 3KYNB 5D2NA 2IBZY 1AP2A 2GTWB 2NW2B 4XBEL 1KNOB 2AJSL 5JDSA 3F58L 2CIKA 5T5FL 4JR9H 3WIIL 3FB8A 3HS0B 3RDTD 4XTRD 1XIWA 3BZFA 5DT1L 3R8BB 5JHDA 3RAJL 2R2EB 4X98A 3LN4A 2BOCB 2DJ4A 2VDLH 2MNUA 1C7SA 5D7LE 2BY2A 3UBXB 4HWBH 4OLYH 2PYEE 4XBGA 1T22A 1FH5H 4X6CA 4YBLC 2F54B 2EH8H 1CXLA 1YY9C 3LN9A 1X6NA 5F7MC 1A6ZB 4FHBD 3BPLB 1QNZL 4HHAA 4NNPL 4NHUA 1KELL 4PRDB 3MLUL 3S88L 3UP1A 1S8DB 5MEOB 2DQIH 1NC2A 4I48A 4UT6L 4DGVL 2A6IB 3BOVA 2DKSA 2BVPB 1CIDA 2CKBL 4Y19A 5HHVH 3VFNA 3TCLA 2FB4H 4TVPE 5IHLB 4QYOB 5F1IB 1GGCH 1N59A 5GPRA 1RUML 1K2DA 1BQUA 2WBJD 4YDIL 3EDJA 4U1NA 1I3RA 5HHQA 4OCMC 1P84K 5BOPA 3V52H 1IGJA 3TIEA 2VLJD 4NC1E 3MLVH 2BFVH 5IB5A 2VZ3A 1MPAH 1XR9A 1ZVHA 3AU1B 4K3HA 5D2LE 4P23A 2SEBA 1CU4L 4PRNB 1XCTA 4X6CE 2F53D 4IRJA 4H88L 1TXKA 2WBWB 1A9BA 1CI5A 3QH3B 4M00A 4X6EA 1T0NA 1MCFA 3U4EB 2V17H 2HT3C 3O9WD 1BREA 4RAVB 3D39A 3C5ZB 4QGYA 3TT3L 5EBLB 3SO5A 1AFVH 4NT6B 3UZEA 1VKXA 2C9AA 4FQXD 3IF1B 4LVHB 1OQOA 1MVUA 1RK0A 1ZA3A 4HXBL 4TTDC 1LO5B 3T0EE 1T1XA 2Z31C 3OZ9L 2DQIL 3W5MA 2P5ED 3MLUH 1FFOA 3S88H 4CW1A 1UB5B 4NKDA 5CEZE 3O6KL 4Y1AD 4K7FA 3UPAA 2YC1B 3QPXH 5D1ZD 1I4FB 4N9GB 1FE8H 3GSNH 2VKWA 1J1PL 1VA9A 3OF6D 1JF1A 2YBRA 3HMXA 3OGCB 4PIRF 1RZ8B 5GRVK 2BVQB 1DSFH 4I4WB 4RGNC 3QO0A 2ILLA 4HKJA 1VGEL 3IETB 2P5EB 1L7IH 3MYJB 4LQFH 2YS4A 4HBCL 3V4UH 2FEDC 4U1IA 4U6XB 3QJFA 2DL9A 5I75C 4HUWA 4JFFB 3SKUD 1GGTA 1N8ZA 2GSIA 4Y2OA 3IFPB 1O0VA 4L4JA 2WWKO 1YEKL 3JWNC 4NN6C 3BRGC 1QSEA 1YYMH 4LKCB 2YPKB 4N9OB 3T4AB 3PXJA 1KSRA 1KBGH 2I26N 2EDJA 4PBXA 5DHXB 5J6HA 2JIXB 2ED7A 4V1DD 1MCEA 3G5VA 3BPCA 3KPLA 4I3RL 4MD5A 5FHBH 1HHHA 1HWHB 5DD5H 1KNOA 4OJFH 4WDIB 4WEUD 4HIJB 2OSLA 4KK5C 1KB5B 4ZXBB 1DBBH 1K3ZA 2V7HB 5D1QC 4NWTH 1JYWA 2HLFC 4NUJA 1S7UA 1DVFA 5I8CB 5EBGA 3TNMB 4Z7WE 3CMGA 5C07D 1CLCA 5GS0L 2FIKB 1QZ1A 4R0LB 3KLSA 3UBXA 2EDXA 4Z78B 3EYOA 5CWSB 3QHZH 4K7PL 2FHFA 4R97C 4QWWC 4P2OA 3QP3A 4NM4L 4ZG1A 4BZ2L 4I0KA 1Z9SA 3CLEL 2YXMA 1M71B 5DMKA 1FIGH 5EZOH 2C1OB 1X9QA 5F70A 2NY7L 1T21B 2R2CA 1RZKC 1HQRA 3EYFB 3QFDB 4OF6A 5E99H 5FYKH 5MEOA 3G5ZA 2A6IA 5FGSA 4G43A 3PWLA 5H8DA 1F11B 5HHPB 2IMMA 1I8LA 5HVGB 5FB8B 4W4OC 5KSAD 4PJ5A 1B0GB 5F7NC 4UNUA 4JRXE 5KSAA 4A6YH 1FSKB 3TT3H 4MLIA 4LBEA 5T3XD 4P57A 4BKLA 1YYML 3DURA 4PTTB 3U46B 4LHUG 3VG0H 3I3BA 3WIHH 5IB5B 4DKEH 2O5ZL 4MHHG 1NMCC 1UYWH 4O9HH 3ISWA 5E2UH 4EUPG 4S1DD 2UV3A 3P0GB 3ESVF 3X14A 3UYRH 4X8JA 3MUGB 5D7LB 1P4IH 3C60A 3ZT6A 2A38A 3GUTB 2G5BA 3IVKB 4U1MA 1Q8MA 5C1MB 2Y25A 2MQ0A 1FZJB 3CSYB 4JFQA 1LO5A 1RURL 2EH7H 5GRYA 4ODXA 1FL5B 2E6PA 1Z3GH 1JPGA 2QHRH 1XGUB 4JFDD 3B8SA 3VWKB 1XGQB 1NAMA 3MBEA 1CF8H 4LLAA 4RISL 2QSVA 3W39B 2HLFD 1JN6B 5E00A 1E6JH 3CXHJ 1D6EA 1X4ZA 5EO1A 2ICWJ 2R2EA 4RFOL 3C6SB 3W0WD 2DQEH 1HXMB 3IETA 8FABB 1BBDL 1K8DA 4K3JH 4M7LL 3PGDA 3ROOB 1JZ7A 4GKSA 4PG9B 5J3HC 1DE4B 3GMLB 4NQCD 4OIIH 1F97A 4JFZL 5E4EC 4XBGB 4Z18A 2XKUA 5E03A 2VXUL 2GSIB 5ESQB 2DLGA 3T4YA 5HYJB 4NQVA 5ITFB 3MUHL 1KJVA 2IH1A 4YHIA 3P4MA 4WEBL 4B53A 3MPCA 2YD4A 3QULA 3PQYE 1KG0A 5F97E 1BJ8A 3NFNB 4DUXA 4WI4A 2VE6B 2UWEB 5I66B 3BAEH 5EB9A 3MBXH 4L8SB 4GBXC 4GG6A 4RGMC 2FEEL 3FQWB 2NXYC 4YGAB 4Y19B 2O26U 3GMPB 5DRXA 4MD5B 3ARZA 5CJOL 2JB6A 2X4OA 1RUKL 2MQCA 4JHAH 4UBDD 5F1OB 5D5MA 2A0LD 1QRNB 5IVOA 5I19H 3IKCB 4G8FB 1WTLA 4U1NB 3L6FB 4M43H 1FIEA 1JWSA 4NUJB 4KZDL 3WFBL 2R69L 4QNPF 5KVMC 3UTSA 2W60A 2ERJB 2IF7A 1MRDH 2B5IB 3CDGB 1FPTL 2PW2B 3PP3K 5D72H 5B21A 5ALCL 4QY8A 3IDYB 2VDQH 1CGSL 4K71C 3FJTA 2OJEA 4P2OB 2Y5TA 2PNDA 1RFDH 3L3DB 2DIBA 4JB9L 4KY1L 5CZKA 2DIAA 1CLOL 5JORA 1MFAH 3PV6B 5HVFB 2HG5A 1P7KB 2J6EL 5GS0C 1IAKA 3B9EA 1NCWL 1ES0A 3SGEH 2WBKA 3RWCB 1U3HC 1NJ9B 3MOQA 4JREC 4EEEA 2VRAA 1JGUL 2E6JA 4LLDB 5EZJA 5F1SA 4M8VA 2W1NA 3V5DA 2R4RL 1FV1B 3BH9B 2AEQL 3ULUC 3MXVL 4CN4A 5L0QB 5DD5L 4P46A 2R8SH 2ZG1A 3SN6N 4DCQB 1MFBL 3SDYH 3F7RA 5DRZA 2W38A 1CL7L 3FOMB 3UTPE 1CGXA 3MV8E 1JF5A 1MOEA 4OD1L 3D85A 3MFGB 3D69B 2AJ3A 1A7NL 1J0KA 1J1XL 1OAZH 4M7LT 3MRFA 4UIKL 1CWVA 1HHJA 1QBAA 5KVGH 3I85A 3K4DA 2R0LH 2AGJH 5T33H 3KPPB 2IANB 4ZS6C 3RVTD 5M7QA 4WNQB 2BSSA 1LO0L 2PTTB 4P2QE 4XPFH 4G8GA 1WAAF 3BEWB 2WSKA 4QNPE 3IVKA 1OY3B 1QFUH 2DAVA 1D5XA 1FL3A 5JO5B 3C6LA 2CUIA 1HXYB 5HVWA 3BO8B 1Y6KR 1QR1A 4JB9H 1CD8A 2CO7B 3VFWB 2E9BA 5FDYA 2OL3L 5F9JB 4KRPB 1YJDC 4H8WC 4P5TD 5HYQA 5I1IL 1YC8A 4UBDC 5CJQH 4DVBB 4OFDA 1MHPL 4BFIA 4GAJH 3D25A 4PD4J 4MXQC 1HQ4A 3MRLB 4P2RA 1D7FA 1LP9F 1FNLA 4GRLA 1K85A 4XCYA 5ADPL 4NN5C 4PP1D 1IZJA 4F3FB 5FK9B 2E27L 3AREB 1CFSB 3B9KB 1MWAL 2FIKA 1PQZA 3DX6A 4YC2C 3MNVB 4K8RH 1KENL 1EBAA 5EU3B 3LD8C 3CXDL 2AABL 3T4YB 5HYJA 5CSZA 1AO7D 1AE6H 4G5ZH 3TYFB 3OSKA 2WIIA 3ARED 2YXFA 2HKFL 2V9TA 4P3CH 5BV7C 5D7IA 2XZQL 2HJKA 2V2TB 3QFDA 4WEBH 5I66A 1G7HA 3QDAA 2EDTA 4OIAA 4X6CF 2GI7A 4L8SA 4JZJB 5CMAB 1P1ZA 4OUOA 4XXDB 4BSJA 4K2UL 5FYLL 3GSNA 2Z93A 5I16B 1U8QA 1HH9B 4HLZH 5FB8A 1MQKH 5D7IF 4QT5A 5CP7B 4DW2H 5D5MB 5I74C 1QRNA 4S10A 3RGVC 4HIIB 4ZO6A 5EFIB 1D9KA 1D9KD 4P57B 3G5XB 2VL5A 3WIHL 3MRNB 2OJZH 4ISVB 1QQDA 4IIQB 1IC5H 2W60B 1TLKA 3KPSE 5DA4A 3VXRD 4EDXB 4EN3D 1AXTL 5EU6B 1E6JL 4TVPH 3TPKA 1TNNA 1ED3B 3MNZB 5FKAA 3H3KA 2FJHB 4NRYB 1W72B 1R3HB 5D70H 5KJRL 5CEYA 4OCRH 3BP5B 2VLLA 5DGQA 3HRZA 5CINL 4AEIH 5HGDB 4DUVA 1GJIA 1AR2A 4PJ7E 3D18A 1P7HL 3MCG1 3MRKB 3BWUC 5DK3A 3BT2L 1KLUB 3KPNB 1W72H 3I84A 2EO1A 1NJ9A 5DJYB 3UX9B 2EDDA 1GC1C 2DWDA 5D9SB 3OKEA 1JHLL 4PJXE 4UOW0 3U0TB 4LHUA 1ZT1A 4ZTOH 3H6JA 3GI9L 5FIEA 4PJ9B 2EIBA 5D2LB 3SE8L 3C87A 4A2LA 2P5WE 5IV2A 1NGZA 3MLYL 4R26L 2A73B 3UZVB 2GTZA 4YDVA 2VAAA 5ERWB 3TGXA 4NM8H 4PJ5E 5E00B 4U3HA 1KPRB 2NR6C 5INCA 4ZOAA 1GH7A 1H8SA 2Y1VA 4MA8H 4OUUA 2J88H 4TTDD 5IK3B 3GK8H 2D9CA 3CVHH 4N0UA 2EDLA 3GM8A 5F7EH 2DQTH 4C83A 3K81A 5ESVB 5FHBL 1CE1L 1DBML 1KUMA 5D71H 3P4LA 1A0QH 1UXWA 2HTLC 4HZLB 2D0FA 5A3ID 1C12A 1F00I 3L5XL 4AL8H 5FFLA 1CL7I 3QIWD 5C8JA 4JFEE 4NQVB 2OP4L 4BK4A 4DOHE 3SDAC 2IH1B 4PRHA 1JGUH 3LN5A 5F93C 4XHJD 2APTA 1EAJA 1FL3B 1TETL 5EUOB 5LGHL 4KWUA 1F6FB 1DQDL 3DMMB 1GHFH 4R96A 3UXFA 5B4MD 2EYTA 1P5UA 3S7GA 3VFWA 3L3OB 5AZEL 3VXQB 4G6FB 4PV9B 2YD8A 3MMEB 2VZVA 2A2QT 4H20H 1AO7A 3RGVD 1HH6B 5ANMA 3MJGX 4N0CD 5J89A 4R7NA 1KYOK 3PJSB 4GRLB 3HB3C 3GSNL 4E41A 3SKOB 1HDMA 5IBLD 3IDMA 1OAZL 5E9DA 3O2DA 4AIZA 2DBLL 1IQDA 1FGNL 5EOCH 2M2DA 5K9JH 1A6VH 1M6OB 5F88A 5KVGL 3ZDXF 2WBJA 4POZC 1UKTA 5FA4B 2P4AB 3QI9C 2P5EE 4M62L 3WJLC 4ENED 1P2CB 1WWAX 1JYNA 5J7CC 1RIVL 4HV8B 5AYQA 2NY4D 3BD4A 3DBXA 2EKSA 4LCCB 3VGHA 3VGAC 3LIZH 4IJ3C 1JWMA 1KIQA 1E4XL 3EUUA 2CR3A 1T89A 5FOJA 4TUJA 1P1ZB 4GMSH 4KI1A 3CCHA 2DB8A 3F7YB 5I1CH 5FUOH 2RHEA 3ARDA 5KN5A 4PJFA 4C59B 2X4RA 1EK3A 1MRFH 3VD3A 5HJ3A 3MROB 3RL2B 4MQ7B 5ID1A 3IDNB 1EO8L 3HZYA 4UQ3B 4HWZB 5CKGA 3JXAA 2W07A 1K5NB 5EO0B 2F74A 4QF1B 3D69A 3MLVL 3DX7A 3GSOB 4QTIL 2BSED 5L2KE 4JANA 4NO2A 4OF7A 5FKAB 3RY6A 4JFOA 2F54E 2CH8A 1E4KA 2DKUA 4OCLC 1AI1H 1RUQL 5EIIB 1IM3B 3QIUC 4LU5H 1N6VA 3UPRB 2DBLH 4JDVA 1A7PL 1ZA6A 1FZKA 3O0RH 3OF6A 3C8KA 4U1SA 2GEEA 3CC5B 1E0OB 4JM2F 3CFKB 3LV3B 1CDUA 3OR6A 3KS0H 1O5DT 2B4CL 5IHZB 4OV5B 2X2YA 4Q74A 4OF0A 3PWNB 4M9PA 3SE8H 5FYJU 1AD0B 1RZKL 4JM2A 5B4MC 1SEQH 3WNKA 3GI9H 1XGRB 3JWOL 1GGBL 2IMNA 3LKSA 5F71A 1QSED 4CU7A 4L4TD 3K80A 1FNGB 5E5MB 4ZFOL 2GTZB 4YDVB 1OHQA 5ERWA 2B0SL 5JQ6H 3GRWL 3OR7A 2DDQH 3SKNB 3BDYL 4WUKL 4BFGA 5K9QG 5FK9A 4PBWD 1CFTA 4V1DA 4F9LC 2Z8WC 2DD8L 4BUHA 3RWFA 3MRRA 3N50A 1Z6JT 2AXGA 2OX5A 3GGWB 1UWEH 32C2B 1AO7E 1H15B 1ZTXL 2J6EA 1FRGH 5JXAH 2QR0A 3QXUA 1UVQA 4OZGA 5IQ9B 5D6DC 1BQLL 3G08A 1OT1A 3P40A 4PB9L 4KJPD 2NY6C 1D5BA 1YY8B 1I1AC 4B7IA 1NCBH 3BX7C 3RWHB 1SY6H 4GW5B 2N1KA 1AJ7L 1I85C 4LEOA 1U8OA 2NXZD 3DVNA 5JZ7D 1WBXB 1KXVC 3K8KA 4AIOA 3FRPA 1UXSA 1IM9B 1CN4A 1EHAA 2Z93B 1OLLA 4AEHL 4AT6B 2LTQC 1PAMA 5GRJH 1JIBA 2H41A 2VLKB 4UNTA 3ZSSA 1F6AB 3EHBD 1D9KB 5I1KL 4GKZB 1A6WL 3GIZL 4NFDA 1VSCA 1K8IB 1V3LA 1OSPH 3G5XA 3O9WC 5GS1A 1YEGH 3MRNA 1S9WB 3QNZA 3OPZL 3SDAD 4B50A 3IDMB 4OGYL 2MCPH 3CXDH 4L5FL 5CJXC 4HUXA 2OTPA 4EQ2A 5F88B 1BBDH 2W0KA 3JWDC 2HVKB 5KSVB 5DZOA 4RA0C 4Y1AE 1NGWA 2EEAA 4NBZB 3ULVL 3D18B 3FFCE 5IJVA 3QIBC 4HV8A 3VXUA 3WEXA 5J1SC 1OAYH 1NEZG 1KBGL 2BDNH 4PRAA 4JPKL 1QFWI 3OHXA 3FONA 5CGTA 3RTQC 1E27B 4PJXA 3LQAC 3VWJC 3V8CA 3U0TA 2HJFB 4BH8B 1VADA 5C07B 4WHCA 5I1GL 2D2OA 4ONGL <