1E5JA

Endoglucanase cel5a from bacillus agaradhaerens in the tetragonal crystal form in complex with methyl-4ii-s-alpha-cellobiosyl-4ii-thio-beta-cellobioside
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
302
structure length
302
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRESAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE 5A
publication title Mixed-Linkage Cellooligosaccharides: A New Class of Glycoside Hydrolase Inhibitors
pubmed doi rcsb
source organism Bacillus agaradhaerens
molecule tags Hydrolase
total genus 121
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2000-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1e5jA00
2CBVA 3GXIA 3AMDA 3UETA 3CZ8A 4UCFA 5HDRA 1GVIA 4J3WA 8A3HA 5BRQA 3RILA 1XSJA 1TMQA 3WDHA 4W8LA 1IV8A 1ISYA 1EIBA 2QPSA 1MYRA 2CIPA 1HX0A 4WJXA 1PIGA 4J7RA 2G3MA 1HJQA 2CKRA 2UY4A 1PX3A 3BXWA 4PMDA 3GXMA 2CHOA 4PMQA 4UOJA 4W7UA 4B3LA 2A3HA 2HVMA 3L2LA 4NRRA 3WFZA 1HNYA 4F66A 4AIEA 1HT6A 1A47A 5LA1A 1J18A 4FK9A 3BSGA 4C7DA 3WDIA 1PEZA 2BVYA 4GXPA 3K1DA 2DSZA 5A6AA 3T0DA 2VR5A 1SYTA 1GQLA 4GZJA 2WBGA 1ITCA 5D9OA 4JFVA 3WBEA 4MADA 2GJXB 3IANA 5A8OA 5HXMA 1UR2A 4JFTA 1JZ2A 1B3VA 3I3DA 4H04A 4H8UA 4H8VA 4D6FA 1HJWA 4NI3A 2VZTA 4PN2A 1QW9A 5JBEA 1JDCA 2OWXA 4MNMA 1B31A 2WVVA 4AY1A 3WH6A 4AD1A 4M82A 3QOMA 1NP0A 3CLWA 3ZT6A 2OWCA 1UZ4A 3ZSSA 4OBRA 3JUGA 2WVSA 2NSXA 1UD6A 3TA9A 1KXTA 1FH9A 2IXUA 1UZ1A 1UD2A 5D9NA 3CUGA 1B3XA 2XSAA 4DWSB 5DT7A 1G9HA 2XWDA 3S6TA 1QI0A 1MQRA 1MFUA 2WYSA 2D3LA 4LXFA 3OGVA 2VCBA 1HIZA 2YA1A 5FL0A 3W82A 4KMQA 4UZUA 1EA9C 1UWRA 3GYCA 4WLCA 3VIJA 4YPJA 5BROA 2C8NA 1J01A 4ATLA 1QW8A 2V3FA 3NCOA 2UY5A 2XGIA 3AZTA 1GHRA 2VCAA 3MSGA 4PMZA 4JFSA 2NT0A 2VX4A 1UD8A 3ZJ7A 3WEOA 4CD7A 1H09A 2WC3A 2E9MA 3WD0A 4LYQA 1NOFA 1UA3A 3SUWA 4HZ6A 1DWJM 3QHOA 1PPIA 3SCQA 3T09A 1E1FA 1C7TA 2X05A 2DEPA 2WSKA 1L0PA 2Z1SA 3WL1A 2WVUA 3BC9A 1W2VA 5HOSA 2O9OA 5EMYA 1UOKA 4WSKA 3GH5A 3ARVA 2VVNA 4Z2GA 4ML4A 1Q6EA 2IUZA 4BQ4A 5JIPA 5I78A 1GQJA 3AMKA 1H1NA 1R86A 2EEXA 5BYWA 3WUEA 1BGGA 4QCEA 2CEQA 3VKKA 2FHFA 3UG5A 2YJQA 3BMWA 1NQ6A 1UYQA 1MXGA 1G01A 3GDBA 3QOKA 1VEOA 3VUPA 4AW7A 3WF4A 3SUUA 1C3FA 4AZBA 4UQ9A 2VX6A 2CXGA 4U31A 3AIRA 1M53A 3CHCA 5CLTA 3WNKA 1W9DM 2Z1KA 1E5JA 4AZHA 1C90A 4NSBA 4D6GA 3A3HA 3DYOA 2ZXAA 4A3HA 4JFUA 1WZKA 1H5VA 2XUCA 3L4YA 3MANA 4BQ3A 1JAKA 1FHDA 1CECA 1DWIM 3TTQA 3L4ZA 2BY1A 2BS9A 1OGGA 3ARSA 1V6YA 1G5AA 3PZGA 1HJUA 3N18A 1J0HA 4AD4A 3NYDA 3AI0A 4UFLA 3VPLA 1E43A 3SUTA 2W92A 1US3A 4JL1A 4J3VA 2V3DA 2WNWA 4ZXOA 1TR1A 5CPTA 1UR9A 1VFFA 2WKGA 1KB3A 4UFHA 2E8ZA 9CGTA 5E6ZA 4YHEA 1E6QM 3AHZA 3U5UA 3VIPA 4AZCA 3WY1A 1V3LA 4WK9A 4HZ8A 2WZHA 1JGIA 3WENA 2J7CA 4L4PA 3VU2A 1V0LA 1WAWA 4AWEA 3AICA 3UEQA 3WFLA 1LWJA 4Z2KA 1H11A 1IT0A 4MB4A 4N42A 3VX0A 3VGGA 1JZ4A 5FIPA 3BCDA 1KWKA 4UQCA 5BWFA 4MJ2A 2QMJA 2VVSA 1JZ3A 4XX6A 4E8CA 3AIQA 3WMBA 3CIVA 2BVDA 3B9DA 3ZIZA 1OBAA 4R27A 1JZ5A 4TX8A 5I79A 2WM0A 2JF7A 4HA1A 3ZT7A 3AIBA 3CZJA 3OBAA 3ZJKA 3WNLA 4PMXA 3NIYA 1TUXA 1J11A 4N0RA 3LPGA 1PJ9A 1UD3A 3W38A 4U5KA 4TXEA 1JF5A 2Y5EA 2YOCA 3WDJA 1QHPA 4JIEA 3W37A 3AHTA 2VCCA 3ARTA 1CWYA 4EANA 2VT0A 4M24A 3WEMA 3DHPA 1QBAA 2C0HA 1ZL1A 1BF2A 1LQ0A 1LL6A 1QOXA 4W7WA 3AOFA 3T08A 3EDFA 5AY7A 2VZVA 5I3DA 2AOSA 1W9VA 2BXZA 2V5CA 2WZIA 1BTCA 1GQKA 3GM8A 4CCCA 3AMCA 4TOQA 4JKLA 3ARWA 3KL5A 3VIOA 1NOWA 3ALGA 3TONA 3QHNA 4JKMA 5A8QA 4X0VA 3FNDA 2D1ZA 1SMDA 1EO7A 2J75A 2GJPA 3VIHA 2ZWYA 3OLGA 1QI3A 2VRJA 3GNOA 3WF1A 4WKAA 5A2BA 2D23A 1HP4A 4P7RA 2WWCA 3L4TA 4P7OA 2GDVA 1CNVA 1I1WA 1WDPA 3UR7A 3MUY1 2DSWA 5A6LA 1J12A 1E6NA 2J78A 1UWTA 1LLOA 1K9EA 2Y8VA 4WF7A 3I3BA 2ZUNA 2XVLA 2OSWA 4ATDA 3W6MA 1ECEA 2JEPA 3RJXA 4P8UA 3CZKA 1HKIA 4TTGA 2DH3A 2VQUA 1OGSA 1OD8A 1S46A 3CMJA 2V38A 1P6WA 2BXYA 1JFXA 2YLAA 2FHCA 1OGBA 4QLLA 2WKLA 1FH8A 4MAZA 3II1A 1UWSA 6A3HA 3PTQA 1E5NA 4RE4A 1QI5A 4P8WA 2WCAA 4L4OA 4MDPA 2J7HA 4FF5A 1MFVA 1GOOA 1MQPA 2EPKX 3FAWA 1X1NA 1BAGA 4CVUA 3TTOA 2CBUA 4E4PA 2BFGA 1SMAA 1C92A 2GK1A 4U5IA 5E6YA 1K9FA 1EXPA 1E3XA 1LJYA 5A8NA 3VDBA 5GNZA 5A6MA 2CETA 3TTYA 1HP5A 2J7DA 3VOCA 4HOZA 1W9XA 5E0FA 4D6HA 1OSEA 2DT2A 2PB1A 1KBBA 1MWOA 4W84A 2PWDA 3DHUA 5FD0A 2FH8A 3EBVA 1CTNA 5D9PA 4FLSA 3O2LA 4ACZA 5ABFA 4PTWA 2XGBA 4M81A 5DEZA 1VJZA 1ISZA 3DC0A 1LF1A 3CHDA 4UQBA 4NZCA 1MW3A 3MV01 3L4XA 1HJSA 4MJ4A 1JNDA 4AIUA 1CZ1A 2WMIA 2ZXBA 1EDGA 3D5HA 4W93A 1WZLA 1FOBA 3KEHA 3WQVA 3ZSTA 3KE0A 1IZKA 3WMCA 3VMNA 4F79A 5CG0A 1W3HA 2F61A 3VM7A 2EBNA 4E2OA 2G3JA 2WCSA 4GKLA 3MV11 2VUYA 2DSUA 5A8MA 3EMQA 1J0IA 2WW5A 3N17A 4D6CA 5AC5A 5KEZA 4CCDA 2D24A 5E0CA 2OSYA 4GO9A 5BXRA 4CU6A 2XIIA 4P7NA 4OUEA 1VJSA 5DFAA 1H0GA 1W2PA 3ZQ9A 4HMDA 2WVVB 2YBUA 2OWWA 1QNQA 1HL9A 4UFJA 4UOZA 1BG4A 4PTMA 3MUIA 2YBTA 4ZE5A 3WL0A 3SCOA 1WE5A 1WP6A 2WHKA 1W3KA 2Y2WA 3FN9A 4MTVA 3NUKA 4AZIA 1V0MA 3U7VA 2UY3A 1WNOA 1HN1A 1XC6A 1OIFA 4PUDA 1I75A 2W67A 4BQ2A 3ARYA 2D20A 3VINA 3N13A 1GJWA 3VD7A 3WD1A 2BV9A 4UTFA 4PTXA 1E71M 2HISA 3RJYA 1UHVA 1KGUA 4W89A 1WCGA 1KXVA 3CO4A 3EDKA 3BAXA 3ARZA 1BYCA 4HA3A 1KXQA 1PX8A 4LYPA 1UH3A 2VJXA 3CH9A 1X6NA 1NARA 1VEPA 3ZT5A 1E6XM 4AC1X 4FLRA 2JALA 2A3EA 3POCA 1EDQA 1UR1A 4QFUA 3WH5A 4D6IA 2XWEA 1JD9A 2ZXQA 4D72A 1Y7VA 2AAAA 3NSXA 1FFQA 4UFKA 1ZB5A 4U2YA 2VZSA 3WSUA 4TX6A 3OLDA 1J9YA 2BHUA 2W62A 4ZXLA 4LGXA 1JNEA 2FGZA 1GZJA 1J0KA 2XM2A 2WC4A 4MB3A 3U7BA 5I6SA 1WDSA 5D4YA 3WKZA 4KRUA 3L2MA 4ZFMA 3ZO9A 2UWFA 3UG4A 2BY2A 1ODZA 1BYBA 1C91A 1CBGA 1UKPA 2WAGA 3RIKA 7TAAA 3KWXA 3LMYA 2ZUSA 3G6LA 1JL8A 1UD4A 2VNCA 3BMVA 2X8RA 5A95A 5JBDA 1GNXA 1XGZA 2X09A 2W91A 3OGRA 5A6KA 4F9DA 1V08A 4C7FA 4W86A 1UKTA 4JL2A 3CZLA 1VF8A 3CUHA 2J47A 1UH2A 2WZEA 4AYSA 1FA2A 1ZJBA 4MDOA 3F5KA 1PBGA 3VDAA 4M80A 4CU8A 1XV8A 5DF0A 3K4DA 2WMHA 1VBUA 4TUFA 1UD5A 1V6WA 2F8QA 3WH8A 2D0FA 1E4IA 3AHVA 4OBSA 2YDQA 1AMYA 2BY3A 1C8XA 2QLYA 3WUFA 2PWEA 4Q22A 2D22A 1G0CA 1AQHA 1V02A 4FLOA 4HTYA 1RP9A 2QMKA 4H41A 4Z2HA 2QHAA 2ZX6A 1WPCA 4WIWA 1GCYA 1JZ8A 1PZ2A 1LWHA 3QGVA 1PIFA 3RDKA 5BCAA 3CMGA 1J0YA 3VTRA 1V3MA 3AZRA 5M03A 1QI4A 2FDMA 2J7GA 4W88A 2WMJA 3T0AA 1GOMA 2X2YA 1UG6A 3PZNA 3BAJA 1DHKA 4PBGA 2GJXA 3ARRA 3PTKA 1RPKA 1V6UA 3WQWA 2CITA 1BSIA 1F4HA 5JUVA 1W9PA 3VD4A 4OJYA 2ZOXA 1CGTA 4QLKA 1MW0A 1MW1A 3U57A 2DSKA 3RMEA 3GH4A 2CBIA 4Y7EA 5CJ5A 1DWAM 1JXJA 3WUBA 1W3LA 4P7QA 1QNOA 1OWQA 1EOMA 2VRKA 1J0ZA 3B9EA 3EDJA 4J27A 1VFOA 2VMFA 4TVCA 4JKKA 1Q6DA 2WLYA 2FHBA 4B9YA 1BQCA 5M17A 2OYMA 1KR0A 3QHMA 2VZUA 3FHAA 5I77A 2ZIDA 4DWSA 4H8HA 3T2PA 1OT1A 2XHYA 1JD7A 3AZSA 4QLJA 3PZ9A 1ZBCA 3VIMA 2J7EA 3NDZA 2VL4A 4BS0A 1J10A 4M8UA 3WUGA 1QI2A 4UOQA 4K68A 5I0DA 1JYNA 3ZM8A 3K46A 4EKJA 2PBGA 2VZOA 4GZEA 4PSRA 2E9BA 5ABGA 6TAAA 1R85A 1GORA 4WKFA 5DMYA 2DSVA 4LPCA 3VGEA 1B30A 4AZGA 1E0XA 7A3HA 4OOZA 3RCNA 1IZJA 4UQEA 1DTUA 2GUYA 1CENA 2WCGA 1AQMA 3OG2A 3IJ8A 2OLHA 3W28A 1B1YA 2DDXA 2Q8XA 1CLXA 2J7FA 5GPRA 1KFWA 3M6DA 1JAEA 1BG9A 3S2CA 4DM2A 1OCQA 1LL7A 1US2A 4TTUA 1XRVA 3A4XA 3KZSA 2YDSA 2WVTA 4PMYA 1CDGA 1XCWA 5A6BA 5IHRA 5A6SA 2Y4SA 1U30A 2G41A 5EB8A 2WBKA 3BLPX 2CESA 3VGDA 2VI0A 1TA3A 1G94A 3GXDA 1GVYA 1CYGA 3N15A 3E1F1 1WB0A 4J3SA 3CPUA 1UA7A 4IPNB 3W29A 3TP4A 3IJ9A 1GW1A 1M7XA 4ZENA 5IFTA 2XPKA 1CGXA 1CLVA 1R7AA 5HPCA 1JFHA 3W26A 1NWSA 5CGTA 1LG1A 3ZJ8A 2W63A 3SCPA 1YQ2A 2YIHA 4D1IA 4WSJA 5GNYA 4UNIA 1JYVA 4CGTA 4KGLA 3CGTA 1H2JA 1W1VA 3MUAA 3RM4A 4D6DA 2XVPA 3AMLA 5JIWA 3WQ4A 3OLIA 3GZAA 1RD6A 4D71A 4OOUA 3VX1A 4W87A 3ZR5A 1UR4A 4W7VA 4D6EA 3UR8A 1KCLA 5A8PA 1E6ZA 1OIMA 3N9KA 4MPKA 1C7SA 3DYMA 1CEOA 2V3EA 1KGWA 1VAHA 2BHYA 2BVTA 2ESCA 2PC8A 4JAWA 1D2KA 1AVAA 3ARQA 2VRQA 2DT1A 1KXHA 1BLIA 2DT0A 3U5YA 2J4GA 3M7SA 3SEPA 3WNPA 3N04A 4A4AA 4U2ZA 1ITXA 2WHJA 5CSUA 2BY0A 1JF6A 4DM1A 4HOWA 1ISVA 4PTVA 1XSIA 1CGWA 5A2AA 3GTNA 3RPMA 3RO8A 4P8VA 1E70M 2CKSA 3K8MA 2GDUA 3B9AA 2J25A 2OYKA 3SCVA 2MANA 3AROA 1G1YA 5BRPA 3WMSA 2EO7A 5IFPA 5D8ZA 1HVQA 3MS8A 1U33A 2XFFA 1I1XA 4GPNA 1GOIA 3BH4A 3BAKA 1H49A 1W9BM 4BF7A 2AMGA 1GOKA 4PMNA 1E1EA 1OINA 5I24A 4FMVA 4KWUA 4RL3A 2DIJA 3N12A 1VENA 1WDRA 5KZ6A 4ACYA 3VD9A 2ZX5A 3CUIA 4CU7A 5C8BB 4BZYA 1UUQA 3AXXA 4X0NA 1ZU8A 2D0HA 2CPUA 2XFYA 1AQ0A 2BNJA 1JG9A 1TZ7A 3FY1A 3MMWA 3SUVA 1CPUA 3LPPA 4CKQA 1W32A 2RGLA 3AS3A 5EBAA 4YN5A 3PTMA 3VGHA 2TAAA 2WLZA 3L4VA 4RE3A 2G3NA 3CUJA 3BLKA 4HZ7A 3B8SA 1VFMA 1TG7A 1E55A 3NDYA 4D6JA 3UG3A 3UERA 2V3GA 2XTKA 1KQZA 2VR4A 4DWSC 1GONA 4CD4A 1R8LA 1KBKA 2D2OA 4IUGA 2ZUMA 3BAIA 1BGAA 3T0BA 1DWHM 3BCFA 3EDEA 4CN4A 4S3KA 2YL8A 1KCKA 2CYGA 1DEDA 4UZSA 1BVNP 2O9RA 4ZE4A 2ZUTA 1TVNA 1Q6GA 5AYIA 1XHGA 3CHEA 1DP0A 2ZX8A 3K4AA 4DWSD 3M46A 3IK2A 1O6IA 4Z2IA 4GQRA 1WKYA 4AXNA 3THDA 4J28A 1FP9A 1QHOA 1NOUA 4JZ5A 1H0IA 3WDPP 4PEEA 3SCRA 1H3GA 4NRSA 4BA0A 4B16A 1M03A 4OKDA 1M04A 4HMEA 3OIHA 2QF8A 2VO5A 1UWIA 3BAYA 4U33A 4M56A 1JDDA 3RM8A 1C8YA 4M1RA 3VNZA 2VTFA 3GNPA 3W0KA 3VDHA 2W61A 5BXSA 1MXDA 4MB1A 1W91A 3AIEA 3MUZ1 1TCMA 4RE2A 3G6MA 1E4LA 2J7BA 3CZGA 1V6XA 2A3BA 4DUVA 2J77A 3W25A 2UY2A 3VD3A 3I3EA 4CVWA 3AYSA 3VIKA 4HP5A 1CIUA 1F4AA 3W53A 5I5RA 3SCSA 3WH7A 3VVGA 3N11A 2WC7A 3CHFA 1JIBA 1JXKA 3GBEA 3A6OA 4Z2LA 1E6RA 1K9DA 3VIGA 1XYZA 2FGLA 5A6BD 1BHGA 1CXHA 5HNNA 5CGMA 3SCUA 1H41A 4PSPA 4TVUA 2WMKA 1M01A 4W85A 4X9YA 3O6AA 3PHAA 4MAVA 4QCFA 3WDQA 2OSXA 1ESWA 4P7LA 3SCTA 3GH7A 3K8LA 1LL4A 2EPMX 3VGBA 3DYPA 1XH0A 1CGVA 3MO4A 1VFUA 2GFTA 3PZTA 5GNXA 1GQIA 4V2XA 4S3JA 3TTSA 5AYBA 2X0HA 4MNKA 1Q6FA 3AS1A 2YA2A 1QNSA 3N1AA 3WD4A 1OB0A 3SURA 1JYWA 4FLQA 4WKHA 4AZ6A 2EJ1A 2XM1A 3PZIA 1W1PA 4OIFA 2JFEX 3KL0A 1EQCA 2J62A 3L4WA 5D8WA 3W4RA 3NJ3A 3HJEA 1EHNA 1EH9A 3WEZA 1E0WA 3BGAA 3A4AA 4MNJA 4ZEPA 4GZIA 4CN6A 4QDMA 4AD0A 2GVYA 4J3XA 4PMOA 2WMGA 1HJXA 1TE1A 1B3ZA 1U2YA 1EO5A 2XIBA 4GO8A 2YKKA 5CSYA 1UKQA 1V3JA 3WH9A 2WPGA 1EOKA 1V3HA 4CN1A 1V3IA 1ZS2A 1MQQA 1JI1A 4J3TA 3GXFA 1L8NA 3WELA 3WF0A 4EK7A 3VGFA 3VNYA 2DIEA 3WIJA 2ZICA 1UR0A 1KWGA 1NWTA 3AHXA 2B31A 3FW6A 4EE9A 2E8YA 4HPGA 3PBGA 3WF2A 2X1IA 1FH7A 4AZ5A 3HN3A 4KH2A 4AIOA 2G8ZA 3VDCA 4R5EA 2VOTA 3WNMA 1UKSA 3J7HA 4J3UA 2D0GA 1B3YA 3PN8A 3W6LA 3ZR6A 4GINA 4HA4A 3RM9A 5A2CA 2YL6A 4AZCB 3W24A 2X0YA 1D7FA 3F4VA 4JCMA 4YHGA 2D3NA 4UFIA 2E0PA 1XH2A 3GBDA 1OT2A 4TVDA 3THCA 1UH4A 4JCLA 2O92A 3VIIA 3WNNA 1V6VA 1TFVA 1KQYA 1ZBVA 1EGZA 4IISA 4UFMA 4P8XA 3ZOAA 1TA3B 3VIFA 3AHYA 2DT3A 3WF3A 4HU0A 2EQDA 4U3AA 5DO8A 2JE8A 2ZUWA 4H2CA 4HPHA 1CGUA 1HVXA 1WDQA 5A3HA 1EQPA 1KR1A 4HU8A 4GQQA 1R87A 5A6JA 4MB5A 3WDRA 1PX4A 2EPOA 4AISA 2VX5A 2ZXDA 5FL1A 4E8DA 3OZPA 3A47A 4B15A 1ODUA 1SR0A 2V5DA 2WWDA 4EAMA 1FP8A 2XVGA 1UWQA 1V3KA 3SCNA 3BAWA 4XB3A 4Q7NA 3W81A 4AEFA 1QPKA 3PZVA 2GJRA 4CD8A 4NF7A 5A94A 2WHMA 1E4MM 4JHZA 1QVBA 3AXHA 1H4PA 2NT1A 3CBWA 3IAQA 4AMCA 1XSKA 1HL8A 2Y24A 1X6LA 1QNPA 3UESA 2JIWA 4CD6A 3PZQA 5HPOA 6CGTA 2VQTA 5JBFA 1BYAA 3MMDA 1JYXA 3AIUA 5A69A 1JI2A 1UQZA 5M5DA 1V03A 4IM4A 2EPLX 2WSPA 3ECQA 3VO0A 1V0NA 4GI8A 3WQ6A 1V0KA 1GJUA 3SUSA 4DUXA 5BXPA 2WANA 2WHLA 3MMUA 1W1TA 2RGMA 1NH6A 4GI9A 1VBRA 1YHTA 1FHLA 2VC9A 1NM9A 2DPEA 3QR3A 1JZ6A 3AIWA 1HKMA 2PWGA 4LYRA 1CXEA 1XD0A 4QP0A 5IDIA 1FFRA 4URIA 1E40A 1LG2A 1SFSA 2F2HA 3AS0A 3ZMRA 3WD2A 2W5FA 2PF0A 2ZUUA 2BHZA 3L4UA 2XYLA 1BYDA 1W9UA 3EMCA 2W4XA 5IHSA 1BVZA 5ECUA 5IXEA 2JF6A 4OZOA 1KGXA 2ZX7A 2XFRA 1E15A 3ARPA 1JZ7A 1GPFA 2XSBA 1ZJAA 4KRTA 4H7VA 4BQ5A 3AFBA 3OZOA 2YDRA 1CGYA 1D3CA 3GNRA 1K6AA 1HXJA 3NSNA 3WN6A 5E09A 1R7OA 3APGA 1C8QA 4PYSA 2J74A 3EYPA 1QNRA 4PUEA 4W8BA 1UQYA 1ZBKA 3ARXA 1ISWA 1Z32X 2GK1B 1WZAA 4PRWA 2A3CA 5CLWA 2W66A 1A3HA 2XVNA 1E73M 4MNLA 3CTTA 2DH2A 2ZUVA 1CXFA 1GHSA 5A1AA 5HBFA 1NWRA 1XYFA 3WNOA 3SIMA 3VMPA 1XCXA 2E3ZA 4AEEA 2YL5A 2XG9A 3VM5A 1B2YA 5ABHA 1BPLB 1UKOA 2QPUA 2ZE0A 3OA5A 3T2QA 4ACZB 2YLLA 5CPSA 5ABFB 4DUWA 4QAWA 3WQ5A 5TD4A 3M07A 5LA0A 2PWHA 1V02E 1N82A 4ATWA 1Q4NX 1ZBWA 4XZWA 1HF6A 5FKYA 3POHA 2NW0A 8CGTA 5ABEA 1NWUA 1MVYA 2CBJA 3ZJ6A 2DGAA 1OD0A 2VURA 2WMIB 5E70A 5EFFA 5AC4A 2EPNA 3LPOA 5C70A 3MSDA 1B0IA 3IJ7A 1QBBA 1HJVA 5GQBA 3BSHA 5CPQA 4XUYA 3DECA 1J0JA 2E4TA 3CZEA 5LA2A 3CUFA 4JFWA 5E9AA 4GIAA 3O9NA 4A3YA 1E3ZA 2EXOA 1EDTA 1RP8A 5M3WA 3F5LA 4PMUA 2OYLA 4AZ7A 3EDDA 1E4NA 3WBAA 4BCEA 2O9TA 4V28A 1BFNA 3VD5A 4B9ZA 1TVPA 3A4WA 2G4FA 2C7FA 2CHNA 1HKKA 5F7UA 4XV0A 1OM0A 3VILA 2CCRA 4HOXA 4PCSA 4CUCA 1CXKA 2YA0A 3AMGA 7CGTA 3ALFA 2GSJA 3UCQA 4PMVA 1Q6CA 2Y8KA 3LPFA 3HMCA 2J8GA 2XJ7A 1XH1A 2JIEA 3AIVA 1CXIA 4CD5A 1GUVA 1VEMA 4AD2A 1K9TA 3TOPA 3SCWA 4XZBA 2XVKA 4W5UA 5CXPA 2CERA 5EFDA 1C93A 1B3WA 2CNCA 2ZX9A 4M29A 4UQAA 4W5ZA 1WZMA 4UR9A 1GOWA 2PI6A 1E56A 3AISA 1W1YA 2PBOA 2E40A 2DQXA 4D1JA 3AXIA 2IXVA 3OB8A 1E0VA 1WO2A 1E9LA 3KL3A 2WMFA 3ARUA 3HU7A 5C71A 1PAMA 3AS2A 4IPLA 5CZKA 4LQ1A 3AJ7A 3FAXA 1ISXA 1E6PA 5I2UA 2A3AA 5FOOA 4KGJA 5D9MA 1UWUA 2O9PA 4V27A 4C7GA 2J79A 3W27A 3PZOA 1MW2A 1CXLA 1UR8A 4B3KA 2JEQA 4AD5A 5FCZA 3WQ8A 1VB9A 2WB5A 4F9JA 1QHZA 4GI6A 4PCTA 3D3AA 4W8AA 1VIWA 5CQ1A 2FH6A 1B9ZA 1DWGM 3AQUA 1HKJA 4LX4A 4PMRA 3EMZA 2VX7A 3OGSA 2YL9A 4F8XA 3T2OA 3FHQA 3WD3A 1E72M 3PZUA 3AYRA 1EHAA 3PZMA 2ZWZA 4UQDA 4CCEA 1PZ3A 3FXYA 2QV4A 1XD1A 2E9LA 2PWFA 3NSMA 3IAPA 5I23A 1E6SM 1W3JA 1DWFM 1B90A 4U3CA 5BXTA 3F5JA 2G3IA 5DT5A 2WK2A 1JDAA 3MU7A 2J8FA 1NP2A 3MKKA 1O7AA 3K8KA 5LYRA 3VMOA 4Z2JA 1RH9A 1VRXA 4AD3A 4HMCA 2WXDM 4JHOA 1GOQA 3OLEA
chains in the Genus database with same CATH superfamily
3AMDA 2YB1A 3CZ8A 5HDRA 1W5PA 3E96A 8A3HA 3CUXA 3O15A 3WDHA 4W8LA 1IV8A 1ISYA 3W23A 2QPSA 1MYRA 1XG4A 2CIPA 5CPMA 4WJXA 3U3HA 4QBXA 2G3MA 1PX3A 3TJLA 4PMQA 3TW6A 2R1PA 3JZUA 2HVMA 3HO8A 1HT6A 1A47A 4TQTA 1J18A 2QUTA 3W7IA 1R5YA 4NUWA 1WXYA 1ZJHA 1RBAA 2AQVA 1PEZA 4GXPA 2DSZA 3HQNA 3WJYA 4LBUA 5F2IA 1GQLA 3H2MA 2WBGA 1ITCA 4I5RA 4IGMA 5D9OA 3WBEA 2FZMA 5A8OA 2WV8A 2PTXA 3KP1A 1VHCA 4HCHA 3CT7A 3LCHA 4LAUA 1HJWA 1KFBA 4LY4A 4JIQA 1E1CA 1JDCA 1B31A 1QOPA 3NL5A 4AY1A 4AD1A 2Z2BA 3VZZA 4S23A 3ZT6A 2GVLA 3JUGA 3WQFA 1UOZA 2WVSA 1K03A 2NSXA 3TA9A 4XZIA 2NX9A 3RLGA 2XSAA 5D09A 5LIWX 3GKAA 5D03A 1TELA 1MFUA 4LSBA 2VWTA 4JTHA 4GC4A 1RAKA 3QY7A 4JTSA 3S0CA 3DI1A 3ICJA 5FL0A 1ADSA 1AJ0A 1VGAA 4UZUA 3IUDA 3AO0A 4YPJA 4ATLA 3NCOA 4WOQA 5TQLA 2A3LA 1TV5A 2PLMA 1QDSA 1GHRA 3MSGA 5FA5A 5FEWA 1GPWA 4QM1A 1Z44A 3P93A 3BGGA 3LRLA 4EWND 2VHLA 3WD0A 1UA3A 5FSEC 3SCQA 5HNRA 3KW3A 4LBSA 3PR2A 3QBUA 3WL1A 5BZAA 1W2VA 2NX3A 1R3VA 4OFCA 3O05A 3RLUA 4FA3A 1S5NA 2ATSA 2RDTA 3SQMA 4Z2GA 4MJZA 2YSWA 1Q6EA 3W2MA 3AMKA 1H1NA 1MO0A 4FOJA 2B7OA 4DZAA 3R43A 3C0QA 2POZA 1RQHA 3LRMA 2H8XA 1UYQA 4EP8C 1MRAA 1G01A 3NZPA 2TSYA 2G4JA 3SUUA 5BU9A 1C3FA 3DAQA 4UMCA 4U31A 4B2DA 3CHCA 3FJLA 4XVDA 1XICA 1C90A 3GVQA 3KAOA 3TW9A 3DH7A 4NSBA 4D6GA 4O1EA 1HFBA 2EGZA 2ZXAA 4JFUA 2R14A 4AVFA 2XUCA 3L4YA 3BMXA 5JVLA 5FF7A 3MANA 3AXMA 3V75A 3D0CA 5KZDA 3BCJA 4QITA 1LCOA 4MSSA 1OEPA 1OCBA 2Y89A 2FB2A 3QPYA 1TV7A 3KS6A 3W88A 1TKKA 3PZGA 3RRXA 1J0HA 2BP1A 3UQNA 3AI0A 4NU7A 2J27A 4MYAA 3SUTA 3H2NA 2W92A 1F9CA 4ZXOA 5CPTA 2E8ZA 3LENA 3FV9A 3MYPA 3STGA 1E6QM 3FDGA 3WY1A 3VE7A 1H7RA 4WK9A 1DVJA 1KV8A 2WZHA 1JGIA 4A3RA 3E38A 3G1VA 4CEUC 4JICA 1V0LA 2WSYA 3H6OA 3H12A 4S3DA 3PWGA 1H11A 3GU9A 3VX0A 2VKZG 1EP1A 1QNVA 3E0WA 1WKDA 2ACSA 5DXXA 3GAKA 3QQWA 4CNSA 1ZAHA 3V16A 3LCGA 3KM8A 3V7PA 4R27A 3W7RA 5LIKX 2WM0A 4PCPA 5DBTA 4MWAC 4HA1A 1DIDA 4F2TA 5KSWA 3NXFA 4EAYA 3CZJA 3ZJKA 4ZFCA 5G1MA 2JK2A 3PJTA 3GY1A 1J79A 4GD0A 1YNYA 4MZ1A 1WAUA 1PJ9A 3QYQA 6XIAA 2E5DA 1XLIA 1EIXA 3M43A 4US5D 2PWUA 3R10A 4GX9A 4UTWC 2EG8A 1DV7A 3W37A 2PRMA 1J96A 3NAVA 1PS9A 4QGCA 3KBWA 4M24A 1SO4A 4LVGA 3WLPA 1LQ0A 3AOFA 5AC8A 2B7QA 1KFKA 3EDFA 5AY7A 1W3IA 3GUGA 3R8RA 1ZENA 1W9VA 2V5CA 2WZIA 2PDIA 3GDTA 1A3WA 2POTA 5EMLA 5C9ZA 2E67A 2J88A 1SJAA 3ALGA 2VM8A 4MY1A 3QHNA 2WJZA 4JEQA 2G5WA 4DO5A 4DBEA 2CXEA 1G4TA 5T8GA 3VIHA 5K3VA 3OG3A 5I3FA 1FDYA 1QI3A 3MJMA 3GNOA 3HG3A 1KBIA 1P48A 4P7RA 1WOBA 3NOEA 1M3UA 3LD5A 4P7OA 3I7RA 4IIHA 3IUIA 4DBSA 1WDPA 3BG3A 2HNEA 2Y8VA 4WF7A 1S1PA 3W3OA 3KTXA 4EF9A 2OSWA 2ACQA 3W6MA 1ECEA 3CQIA 3RJXA 2ALRA 2NVDA 1EJWC 4L65A 2VQUA 3BQ6A 2QJGA 4FNPA 2V38A 3FYPA 1A0EA 5GJPA 3VNKA 5H8MA 3TE9A 1JFXA 3W87A 1TJ0A 2WKLA 3KBNA 4QROA 1V5XA 4MAZA 4NAEA 3II1A 2VFIA 4DWDA 4BFAA 2PDJA 3Q2DA 4L4OA 1DPMA 3STFA 4MYXA 4O15A 1X1NA 3TTOA 4E4PA 5HNTA 2BFGA 5E6YA 5C9UA 3UBPC 3S1XA 1E3XA 2PCEA 4RE0A 1QO2A 2AGKA 3V3WA 2X41A 3BPWA 2OKTA 1OSEA 1LUCB 2PWDA 3I4EA 3I6TA 3G1YA 1XLAA 2FVKA 3PF3A 4PTWA 3IVUA 3FKRA 1VJZA 3NZQA 3CHDA 3FA3A 5H6HA 1VPXA 4PUMA 2VC5A 2YW3A 1MW3A 2VWSA 1HJSA 4HHLA 1CZ1A 2WMIA 3LHYA 1W0MA 3E0VA 4HTBA 2ZXBA 1BSLA 3TN4A 1OFAA 2GGEA 4K2SA 4F79A 1KFCA 5AVNA 3HBLA 2F61A 2EBNA 4E5TA 4DAFA 3AYVA 1DXIA 1XLJA 4GKLA 2GSEA 1FWJC 5A8MA 1J0IA 4ZO9A 4D6CA 5AC5A 3XISA 3CV2A 4FPSA 4IIDA 4GO9A 4XD6A 3QXBA 2QJMA 1DL3A 1H0GA 1FWCC 3M47A 4QAIA 4QHRA 4LCRA 4Q32A 1C9DA 3BO9A 3VOJA 1YE6A 4UOZA 4Z1BA 3PUEA 3WL0A 2WHKA 2ISFA 4IGNA 4UNKA 4AZIA 3U7VA 2UY3A 3BLEA 4FI4A 1I75A 3K2GA 3VINA 5BW6A 3WD1A 2NLYA 4G8TA 1OC6A 2BV9A 2V30A 2P3EA 1IT7A 1FKWA 2EG7A 1GKPA 1TV4A 1WCGA 4DNMA 3CO4A 4U4MA 5K9CA 4JN6A 1TJ1A 3TXZA 2B7PA 4HA3A 1PX8A 4LYPA 1UH3A 2VJXA 3V0TA 3TQVA 3GAYA 3ZT5A 4Q7IA 4QEHA 4PMJA 2GGJA 3NQGA 1JCNA 5DX7A 4E38A 4FLRA 1UR1A 2PPGA 4GQBA 3WH5A 1LBMA 1LBFA 3RF9A 3PP7A 1ZB5A 4BK9A 3NA8A 2DZSA 3NQAA 3M0LA 1IWAA 3OLDA 1GEQA 1J0KA 4YTTA 4MB3A 5BWAA 2QCGA 3WKZA 4KRUA 2VP8A 4ZFMA 3GHUA 1VLWA 2DY3A 3U48A 1LYXA 2PRHA 1ODZA 4LVFA 4B5VA 1DXEA 2I14A 2WAGA 3RIKA 2X40A 4GQ0A 3LMYA 2ZUSA 1TPEA 3CIWA 1UD4A 5F1UA 3BMVA 2H6RA 4Z1DA 5A95A 2W91A 4MY9A 3OGRA 3GLCA 1FA2A 3EOEA 2TYSA 5CEWA 1Q13A 1PBGA 4A2RA 1KKOA 1OK6A 4GUHA 2V2CA 1UP3A 4CU8A 5DF0A 2R8WA 3LBCA 1NQKA 2CLFA 1YKWA 2PRLA 2D0FA 3AHVA 4H6KA 2YDQA 2J6VA 4AH7A 3IVSA 1ONRA 3WUFA 1G0CA 4GNVA 1L9WA 4N6FA 1RP9A 1L6WA 1WPCA 3TSMA 1JZ8A 4J4KA 1PZ2A 1RV8A 5BCAA 3CMGA 4Z0SA 3CL7A 3PFRA 5HK4A 2ISVA 1YBQB 1QI4A 4W88A 4G56A 4HNLA 3T0AA 1EPVA 1UG6A 4C6LA 1FUYA 4EF8A 1FWHC 2VFFA 1RPKA 3AXKA 2GLKA 4PFHA 2QF7A 2ZOXA 1CGTA 4F40A 2NXHA 3HG2A 3GVRA 3RMEA 4GXMA 2JKAA 2E6DA 2EHHA 2ODOA 2BOGX 4CQAA 4JKKA 2WLYA 4B9YA 3I7QA 1GJPA 2IS7A 4IP4A 1TV3A 2C1IA 1OT1A 2QJNA 4QLJA 2PDKA 5IBXC 2TPSA 3VIMA 3UZXA 2J7EA 3CB8A 3CWNA 2VL4A 3QW4B 1PCWA 5LNWA 1QI2A 2Q71A 4GK8A 1Q3NA 4IMCA 1KM4A 3C2EA 2PBGA 5LNRA 4GZEA 1ZP3A 4GE8A 3EX2A 4KF1A 2CHRA 6XIMA 1GZGA 2OB3A 4WKFA 4O28A 5HR6A 1QTWA 1WKFA 3L0NA 4NZFA 3B04A 4AZGA 3UZJA 2RH9A 3MVIA 2E1WA 3CYJA 4H00A 4HD5A 2ZA3A 2OELA 1DTNA 1VZWA 1KM6A 2WCGA 3TYBA 4AF0B 3OG2A 2RJHA 2DDXA 1T6MA 3G1DA 4L9YA 1JAEA 4YNGA 1US2A 4GH3A 1UIPA 3G8EA 4MPQA 1MUMA 5A6BA 2OGYA 5IHRA 1E0UA 5A6SA 3GXPA 2CESA 4XIAA 3SGUA 5DXYA 4WUIA 1TA3A 1Q45A 3H22A 3GXDA 2EAWA 4LOCA 3W2NA 2OZ8A 4IFKA 4J3SA 2IPGA 4QX4A 3CPUA 1CCWB 3ME3A 8RUCA 1UA7A 4IPNB 2QVHA 3W29A 3GSMA 4PTNA 5I07A 2NXIA 3NVDA 2F6KA 3DERA 1M7XA 4LAMA 2KX9A 5AYZA 3ITOA 3A3XA 5IFTA 4ZTXA 2HK1A 1CLVA 1R7AA 1T5AA 2PU1A 3UJRA 2ZCGA 3VFCA 4DJFD 1JFHA 5HPCA 8XIMA 4DY1A 4M19A 1JVNA 1LG1A 3ZJ8A 3G0UA 3TCSA 4NAEB 3SCPA 1PXGA 1YQ2A 1HW6A 4WSJA 3SRFA 2QCLA 4Q4PA 4CGTA 2PTDA 1H2JA 1M1BA 4FNRA 3PUOA 3ITTA 1EFZA 4D71A 1Y0EA 3UT0A 4ML9A 2GGGA 2BB0A 2VFHA 3ZR5A 4W7VA 3WK0A 3UR8A 3E6EA 3W70A 4MPKA 4AUBA 4DO4A 3CWHA 1FWAC 4GIYA 1BWLA 2BHYA 2BVTA 3ANUA 4X22A 1D8CA 4U28A 2VRQA 4ALDA 2VDIA 4IMAA 5J5DA 1P43A 1YIXA 3GIPA 3C3UA 4E6MA 2ZRYA 1ITXA 1W5QA 3ZYZA 1KFLA 4DM1A 2C15A 1SR9A 1E70M 4D8ZA 2CKSA 2IKGA 3GXTA 3N2XA 3B9AA 2OYKA 1U5JA 3CAQA 2PGFA 3WZ0E 4O50A 1I4NA 3MS8A 4JGDA 1U33A 1IR1A 3U6WA 4LEQA 2NUXA 3LQLA 4O11A 4FMVA 3GUWA 3IIVA 3N12A 4ACYA 4EACA 1JPHA 4O4WA 3B03A 3N3MA 2QULA 4X0NA 1ZU8A 2XFYA 3FVDA 4C6MA 4XAFA 3N4EA 3LU2A 4S3CA 4UWMA 1A0DA 3RX3A 4DJDA 4YJ5A 4AVNA 3RO6A 5F4XA 3KLLA 2A6LA 1OC7A 2G3NA 3KBSA 4XBSA 2GQ9A 3LCIA 1FWWA 1VFMA 2QCEA 3B8SA 1TPC1 2IMRA 3GTHA 1A80A 4QISA 4YL2A 1KQZA 1DJNA 2GQAA 4K36A 1QPNA 2D2OA 1JRBA 2ZUMA 1A5BA 2I7GA 3BCFA 1YEYA 5DMMA 2CYGA 5HJLA 3KRUA 1DEDA 3WLMA 1N8IA 3P5YA 2DFAA 3T9PA 3TEVA 4ZE4A 1OYBA 2NQ5A 3BARA 5AYIA 4Q6JA 1FDJA 1VC4A 2IW0A 2R1MA 3DDMA 3ZFHA 4YTRA 4GJ1A 4H1ZA 4BWLA 2EF9A 1O6IA 5FJPA 4PODA 2QJJA 4XKMA 3WLJA 3TQ0A 3WDPP 3RPDA 3W02A 1DJYA 4QE1A 1H3GA 4NRSA 1M03A 4OKDA 4ERAA 3VZXA 3DOPA 3M5XA 3OIHA 1UWIA 4PBEA 3IARA 4M56A 2DVXA 1R9ZA 3RM8A 4ZBCA 3ITVA 3VNZA 3LLFA 2J9YA 2QUNA 3WO8A 2D2HA 3OA3A 3W1AA 3CZGA 1V6XA 4PA8A 1W31A 1IZCA 3EWZA 2PDPA 5EYWA 3VD3A 1UZDA 1JRCA 2DJLA 3AYSA 1CIUA 1X1ZA 2ZKMX 3A3WA 3TA6A 1F4AA 5I5RA 2WC7A 1JIBA 1XL9A 3N4FA 4ZOAA 3VIGA 5HNUA 1K7XA 5CGMA 1BXBA 5HANA 1NELA 4INFA 2WMKA 1D3GA 5I09A 3PTDA 2A7PA 1KBLA 2OZTA 4W85A 4X9YA 4QCFA 3L21A 2OSXA 5CH9A 1ESWA 3K5XA 4WR3A 4LS1A 1LL4A 3CV6A 1NU5A 3W1PA 1VFUA 1REQB 1K4HA 1YXYA 3PZTA 4LUSA 4LC8A 3GYEA 1KLYA 1GQIA 3QLDA 4V2XA 4S3JA 3W01A 3AS1A 3TFCA 4L64A 3NVTA 1SO3A 3RX4A 3S9IA 1QNSA 3N1AA 3WD4A 3SURA 4HMNA 1GG0A 1PUDA 3W7QA 2EJ1A 3FA4A 3P61A 3QLLA 1KD0A 4I6KA 4MF4A 4OIFA 4ZQOA 1EQCA 3HA1A 5EMUA 3S5SA 1EC9A 3L4WA 3GFYA 4GUIA 3S5ZA 1RBLA 3RMJA 1S5TA 3W1XA 4LNCA 3LV6A 4NJIA 3BGAA 4Q7BA 4AEOA 3WCZA 4J3XA 4N02A 2WMGA 1HJXA 3UWUA 1EX1A 1TE1A 1SFJA 1LZOA 1U2YA 4GO8A 1V3JA 2G96A 1V3HA 4CN1A 1MZHA 4JDYA 2P5NA 1JI1A 4J3TA 1S5MA 3EAUA 4EK7A 2ZDRA 2YCLA 3ABQA 1TPVA 3WIJA 2DW7A 1A5MC 3ZLGA 1UR0A 2DZVA 4EE9A 4Y8FA 1FVPA 1SQ7A 1MI3A 3IGHX 3HN3A 4XZMX 3H2CA 4KH2A 1M41A 2G8ZA 3KTSA 4HHHA 3WNMA 2FTPA 1DOSA 3NPUA 1OADA 4GY0A 3WBYA 2D0GA 3PN8A 3BOXA 3ZR6A 4H2HA 4M6PA 3KUMA 1UCWA 5KETA 3D6NA 4S2CA 4LRTA 2X0YA 4AIBA 4RDVA 4IGSA 4JCMA 1ZNNA 4NJHA 4JIRA 5B7ZA 3JU2A 1DJHA 4TVDA 4MY8A 1UH4A 5CPNA 2AKZA 2O92A 3GO2A 1M5WA 3NQ2A 5C55A 4ES4A 1BD0A 1UBPC 2O7SA 1ZBVA 3SN4A 4CQDA 1TA3B 1CI1A 3WF3A 1Q2SA 2EQDA 1M6JA 1XIFA 5DO8A 2PP3A 1EP3A 1G4SA 4HPHA 3KOXA 3NEHA 1WX0A 1ZJIA 5FF0A 2BGQA 2B81A 5A3HA 1U1UA 1KR1A 1AD4A 4HU8A 5A6JA 1P1XA 3QC3A 3WDRA 3B4UA 5XIMA 3EX6A 4PE8A 1BEUA 2VX5A 3C2VA 5FL1A 5D2TA 2VEKA 4JY9A 4ZTYA 4LWWA 1QRQA 1W17A 2V5DA 2WWDA 3Q37A 2BMBA 3TN3A 1UWQA 3G8RA 1PV8A 2QDHA 2X2GA 1QPKA 1BXCA 3OEXA 1WA3A 5DCEA 2REQB 4EXQA 3GB6A 1UPMB 2GJRA 3CIXA 4HJFA 4NF7A 5MKGB 1E4MM 2GUUA 4JHZA 3NQEA 5HMDA 5FAGA 3IJQA 3MT1A 4DI9A 1XDMA 1VYRA 3IIXA 1YW1A 4FS9A 2JIWA 5HJXA 5HINA 3SGGA 2I5QA 3UZZA 5HPOA 2QCMA 3G1RA 1JQXA 5M5DA 4IM4A 3VNDA 3ECQA 3MSRA 2ZTJA 3GNXA 1V0KA 1GJUA 3SUSA 5BXPA 2WANA 2WHLA 3MMUA 1JGMA 4GI9A 1YHTA 2CZVA 4JPGA 4A35A 1TIMA 4KWVA 4F0LA 4I9AA 5B80A 4A8LA 1SFSA 3MWCA 1L6SA 2W5FA 2PF0A 4NNCA 1YADA 1SPQA 4C1KA 1KO0A 4R7OA 1XUUA 1BYDA 2W4XA 3FXGA 3UXAA 3PUGA 3NPVA 1EYWA 2C1HA 5IXEA 4OZOA 3RYSA 3MHUA 1CLKA 1F7BA 2LLEA 2PP0A 1ZJAA 1ELSA 2GVGA 3AFBA 5U7SA 3QC0A 3UGVA 3WN6A 1R7OA 1RPXA 4AQLA 1QNRA 2DV0A 4XKYA 2VFEA 2GK1B 1PZ1A 1WZAA 2A3CA 5CLWA 4C6JA 4E4FA 3W9ZA 3U4AA 5M2FX 4MNLA 2DH2A 1V4YA 2ZUVA 3VKJA 1CXFA 1NWRA 1JR1A 3IIZA 3R8GA 4K7YA 3EPNA 3L5LA 3VMPA 3UXDA 2E3ZA 1BPLB 3H7UA 2V81A 4HA0A 5M1TA 3DFPA 3T2QA 1QPOA 5TD4A 1F3TA 1N82A 3W2KA 4S3EA 1Q4NX 4ZVJA 3VOFA 1UC5A 2V2HA 4WD0A 8CGTA 3W7NA 1YPXA 1MVYA 2CBJA 3EZ4A 2G37A 5E70A 5AC4A 1E51A 1EJXC 1AODA 1IHIA 4Q8PA 5H91A 5C70A 5LNSA 3MSDA 2XSXA 4JQAA 4PL1A 4GCAA 3BSHA 5CPQA 4XUYA 1J0JA 3TLLA 3LQGA 1RR2A 5JMUA 4H7ZA 2P0IA 1X7FA 2JQXA 1RJRA 3LRKA 3DG3A 1PTAA 1IXQA 5M3WA 1RP8A 4AZ7A 1HO1A 3EDDA 3WBAA 2Z27A 3FYYA 4UC5A 1BFNA 2ICSA 3A4WA 5F7UA 4UR8A 4XV0A 1OM0A 1A53A 2CCRA 4HOXA 2Y62A 4TR9A 3M0HA 4HNCA 1N2VA 3PFMA 1IEQA 1VS1A 3LM7A 2J8GA 2XJ7A 4UNLA 1GUVA 1XIJA 4QS6A 4QJ4B 1VCFA 1OZQA 3SCWA 3GR7A 3V35A 1ZUAX 2ON3A 2XVKA 1IQ8A 4ILSA 1SW0A 4M29A 4QDPA 1UBSA 2ZX9A 1WZMA 4W5ZA 1P0BA 5K9XA 7XIMA 3F4CA 4GMEA 1E56A 3MDWA 1W1YA 2DQXA 4D1JA 3AXIA 3KL3A 3ITLA 3R12A 3H8AA 1PAMA 5CZKA 3MTWA 2OOFA 2IPWA 4DF1A 5I2UA 2A3AA 1QPRA 1FWFC 2WJEA 4V27A 3ITYA 3QYSA 4QNEA 3W27A 1FWRA 3MJYA 2OXNA 4AVOA 1VB9A 3QN3A 4QR6A 3C8NA 1DWGM 2FIQA 2GOUA 5DY2A 2NQ9A 3UVIA 3ES7A 3ES8A 5G2IA 3WD3A 3FDKA 4O8RA 4NASA 3FXYA 1ZZMA 2PWFA 1A5OC 3F4NA 5G4WA 3KVJA 3UU0A 3V5FA 1JDAA 1KKRA 2NVAA 2J8FA 1NP2A 1XWYA 5C2XA 1RH9A 1ADDA 2GWNA 3MI2A 4MG4A 4UTUA 2PE4A 4UUIA 4GFSA 4UCFA 1GVIA 5D02A 5BRQA 4MUZA 1X39A 1XRTA 2RDXA 1KLZA 2CU0A 2FZ9A 4ADSA 4JTJA 1DHPA 3LCXA 1Y5XA 1HX0A 1HJQA 3FGCA 5AB3A 1ITUA 4UOJA 5TNVA 4US5A 4W7UA 3L2LA 3DXIA 3WFZA 5LA1A 3W86A 5BOOA 1I6NA 1BWVA 4GX8A 4FOUA 4ZSUA 4XD3A 2V67A 1AD1A 2YB4A 2VR5A 4DYJA 2QDGA 4IZGA 4WXYA 2GJXB 3IANA 4NXKA 4OUIA 4C6FA 1H62A 4H04A 4DXVA 1BF6A 4D6FA 1QATA 2V69A 1UJPA 4HNOA 2VZTA 1T41A 3EXRA 4EXBA 3M0JA 2OWXA 4MNMA 3VYLA 2WVVA 2ZE3A 1POKA 1ICQA 2XH7A 4B5TA 3LS9A 1Q7ZA 3QOMA 1LQAA 3RU8X 4WY0B 2OWCA 4EWJA 4OBRA 3NQ7A 2OQLA 1IIGA 1O5RA 1UD6A 3TC7A 2ZZ3A 1UD2A 1TJRA 3CUGA 1B3XA 4EPBC 2QEZA 1G9HA 5JQ9A 3PM6A 5HMEA 2QIIA 3F2CA 3OGVA 2VCBA 1HIZA 4ZODA 4IG2A 3A24A 4X63A 3WQCA 3GYCA 5DMNA 4WLCA 1VPQA 3E0LA 1QW8A 1Z8AA 1PYMA 3AZTA 3O1NA 4R9XA 2VCAA 5AC6A 4PMZA 1R6WA 4JFSA 5BRBA 2NT0A 1UD8A 4JR5A 3VK5A 3W1NA 3EWYA 1DWJM 3QHOA 4NXSA 1PPIA 4HB7A 1LDCA 1A5KC 4LY8A 1UZHA 1EX5A 5AVHA 2Z1SA 5AHNA 4N6EA 5HOSA 2O9OA 1D9EA 3B8WA 5JH2A 3ARVA 4O53A 4JTIA 3GKFA 1ME9A 4IIBA 2Q8ZA 5I78A 5G4HC 1R86A 2EEXA 5BYWA 1OF6A 1OFOA 4IFOA 4QCEA 2CEQA 3VKKA 4AAJA 2O56A 1NQ6A 3MY9A 2O0TA 3BZGA 1Z3NA 3PBVA 1VEOA 3VUPA 3G0SA 3WF4A 1NSJA 3BW3A 4AZBA 1I9CB 2OGJA 3M4HA 3MW7A 3R89A 1T99A 2VX6A 2FMNA 5LIYX 3H24A 3AIRA 4DVOA 1M53A 2GL5A 4GH1A 3WNKA 1YPFA 1W9DM 2XISA 1E5JA 1XIHA 3GNNA 3P74A 1OX4B 3G24A 3A3HA 5AFDA 3DYOA 2QQ6A 2PZNA 1WZKA 1PDYA 2DZAA 2WM1A 3LNPA 2XDFA 2Q3OA 1JAKA 1FHDA 2HVOA 1CECA 1EBHA 1DWIM 3BOFA 3L4ZA 1THFD 1NDZA 2OZ0A 5LIXX 2ATMA 3H2OA 4C1NA 1V6YA 4XKYB 4X61A 2YPIA 4F0MA 1HJUA 1I0BA 1O12A 3NYDA 1M7OA 3HPSA 2NV9A 3VPLA 1E43A 4E0CA 4J3VA 2V3DA 4WGXA 1EC8A 5E1QA 1VFFA 2WKGA 1JCMP 4Y90A 5E6ZA 1PSCA 3AHZA 4UTTA 5FF2A 4AZCA 2DVTA 1V3LA 1LM1A 2J7CA 1J6OA 1TWIA 4L4PA 5D37A 1HKWA 3FJNA 4DELA 1ZHAA 3AICA 4AWEA 3WFLA 4C6BA 4N42A 3HG4A 3SAZA 3U2EA 1EEXA 1JZ4A 2CLPA 3BCDA 1GEHA 2WNNA 2QMJA 4GUFA 1JZ3A 3CIVA 1F6YA 2BVDA 3B9DA 3ZIZA 4DBDA 1AG1O 1J5SA 3DN5A 4IJBA 2JF7A 3SO7A 2E5CA 3WNLA 1AJZA 1B54A 1H7XA 1J11A 1S38A 3LPGA 1CB2A 4U5KA 3VAVA 4TXEA 3L68A 2Y5EA 3QQ0A 3SB0A 3CNYA 1EJ7L 3FSTA 3PAOA 2VCCA 3VNMA 4MLRA 1CWYA 4EANA 3ZWSA 1MUWA 4ENLA 2I57A 1EP2A 3DHPA 4NX5A 1ZL1A 4F0RA 1RSCA 3K13A 3GC5A 1ONXA 5T9BG 3TV8A 2A7RA 2AOSA 4FSAA 2BXZA 4KCUA 1XIMA 1BTCA 3GM8A 4TOQA 3VKCA 3ARWA 3VIOA 1IF2A 4GBUA 1NOWA 1UR3M 4I5UA 4JKMA 1OG6A 4YYCA 1SMDA 1QMLA 5KITA 2ZWYA 1EZWA 1XG3A 1I0DA 5D2WA 4WKAA 4GG9A 1HP4A 5CJNA 3WQGA 5E93A 4Q8QA 4CQBA 2NXGA 7ENLA 3L0GA 2GDVA 2FFIA 3WG6A 3KCOA 3LM3A 5A6LA 4RW3A 2ZZ4A 1RJQA 1KRAC 1LLOA 1K9EA 3ABSA 1P0NA 3M6YA 4I7UA 5HUOA 3QPZA 1JCYA 1VQTA 2JEPA 3G1XA 4P8UA 1HKIA 2ZBTA 1OD8A 3TOYA 4JTQA 3CMJA 3PPGA 4LJ3A 1XYCA 3HIJA 2OVLA 4QLLA 2V2DA 3JZEA 1P0EA 3AC0A 1UWSA 3W22A 5LHEA 4IMFA 4J2MA 3PTQA 1YDNA 1A5LC 4NAFB 4P8WA 3S8HA 4KRZA 3B06A 4Q8UA 1MFVA 3CS2A 3LBOA 1MQPA 3T07A 4CVUA 2CBUA 2H90A 2VENA 3T81A 1C9WA 1GOXA 1C92A 1Q6OA 2X30A 1BTMA 1EXPA 1LJYA 2XH4A 5A8NA 1FY6A 4RXFA 1XYMA 2ZZ5A 2RDUA 3TTYA 4JY8A 1W9XA 4D6HA 2DT2A 4W84A 1RD5A 1TUFA 2FH8A 2I56A 3EBVA 1R3SA 1IIHA 1S2WA 3W6YA 3UWEA 4ACZA 3U2CA 3PULA 4AX7A 2HJPA 1AW1A 4M81A 1ISZA 1F8MA 3UNTA 3CMFA 3L4XA 2OG9A 3QVQA 4MJ4A 2YZRA 2OMAA 1EDGA 3D5HA 2XH2A 4NNAA 1Q6QA 1GK8A 3RPTA 3N6QA 3WQVA 2P0OA 7REQA 1IZKA 2X1UA 3UXKA 4REQA 2Z1BA 3W7LA 4LTSA 1FWEC 3N17A 1WBHA 4CCDA 2BBFA 1TPWA 5CJMA 2D24A 4ZSTA 3EKLA 4D8AA 4KIRA 5BXRA 2XIIA 1VJSA 1Q6LA 1DE5A 2E28A 5HATA 2WVVB 3C2OA 1P7TB 1QNQA 2PDUA 4UFJA 3MUIA 4CQ8A 1VBHA 4ZE5A 3S6OA 2Y7EA 1WP6A 1W3KA 3AU2A 2C13A 4MTVA 4LB4A 4S2BA 1HN1A 3HG5A 3TYAA 4BQ2A 3VD7A 1GJWA 3FK4A 4KBXA 4PTXA 5J04A 3RJYA 4E3VA 2RAGA 1KXVA 2QXWA 1LOQA 1V7YA 4GVHA 3EDKA 3QQ1A 3OYZA 5C9RA 2VXNA 1O94A 3W72A 1KXQA 5CCZA 5K4ZA 2DORA 3H21A 4DJFA 4WXZA 3CH9A 3CYVA 4JX5A 1E6XM 4AC1X 4JTTA 3LTPA 1CX9A 3CT2A 3NG3A 3PJWA 4QFUA 3UXIA 3Q67A 4D6IA 3B0XA 3UWQA 1JD9A 4D72A 1Y7VA 5I3KA 3NSXA 4UFKA 2VZSA 3ZLHA 4FIQA 4TX6A 5CZJA 4LGXA 4I8DA 2DUZA 3LXBA 5PTDA 3H23A 5I6SA 4MKNA 3ZO9A 3LERA 4J9JA 2UWFA 1FHUA 3GK0A 4F3HA 1C91A 1CBGA 3PPCA 1UKPA 3I6RA 3LV5A 4DF0A 1G4EA 3KWXA 3GTXA 1BRLA 3VKDA 3EX1A 3W7GA 1DJQA 3W7CA 4IMGA 2XN1A 4R7WA 1GNXA 2X09A 1PKMA 5A6KA 1EEPA 3KCJA 1UKTA 3GDRA 1O5KA 1PTGA 4JBRA 2J47A 1UH2A 2NQZA 4AYSA 3NQMA 2D2GA 3IUHA 3MA8A 4UTKA 1ZJBA 4BEQA 3LG3A 1DJXA 3NPXA 4DRSA 2O4QA 3GVVA 2VD8A 3VDAA 3K4DA 3UPBA 4J35A 1UD5A 3S5NA 4K8GA 3NZRA 4LNYA 1X38A 2HWGA 3GC2A 2HS8A 4RX0A 2PWEA 3ERPA 3CM4A 4L1XA 4H41A 4Z2HA 2QHAA 1GCYA 3QEZA 3W2LA 2ZA2A 4C1NB 4GZ7A 1XKJA 3VTRA 1W5MA 1I8JA 4AX6A 3AZRA 2CW6A 5I3GA 2FDMA 4FIRA 2Y1HA 3RX2A 2WMJA 3YPIA 1GOMA 2X2YA 4AWTA 3BAJA 1PCKA 5ECVA 1TX2A 3MB9A 1TX0A 3IS4A 1FBAA 1VFTA 3PTKA 5BMXA 2ACUA 3GU1A 5JUVA 2OTDA 3VD4A 5DY3A 3NR0A 4QLKA 2I17A 1WV2A 1MW0A 3WBXA 2D69A 4A3QA 3U57A 2I9UA 2Z28A 4Y7EA 3TJIA 5CJ5A 4DLMA 1BWKA 1W3LA 4P7QA 3W76A 4WRHA 1QNOA 1AL8A 1OQFA 2VRKA 2VMFA 5BMWA 2FHBA 1U5VA 4YTSA 1KR0A 2GYIA 1I2RA 2VZUA 1G67A 1ZTVA 1FDZA 1JJKA 3KZPA 2CWNA 4ZZ9A 3E12A 3P3BA 3AZSA 1XDJA 3PZ9A 3BLIA 5AYYA 3QGAC 5CPLA 2CZ5A 3GR4A 5LHFA 4BS0A 3WK2A 3G5EA 1JYNA 3K46A 3LEPA 4M7TA 4PSRA 1EGMA 3URBA 3WLQA 4C6IA 1TV8A 1QXLA 3U4FA 3REQB 4N7QA 5DMYA 2DSVA 4LPCA 1TPUA 4Y9NA 1A5CA 4Q4QA 4DUOA 3GG7A 1H60A 4S3AA 4XIMA 5D2VA 7A3HA 4L6OA 1R47A 1IZJA 4UQEA 4Y9PA 1AQMA 3IGUA 1B1YA 2Q8XA 4QE4A 3QZ6A 2J7FA 4O8AA 1TRDA 1BG9A 3W1MA 3WQDA 1DIKA 4CQCA 3DFQA 2H9AB 2W3ZA 3KZSA 1W1A1 2YDSA 4FXFA 4TX9A 2G0WA 5CAKA 2YCIX 3PS7A 2Y70A 1RCQA 1TTIA 3MCOA 1Z48A 2BSLA 2PP1A 2VI0A 4R88A 4IFRA 1GVYA 1CYGA 2EG6A 4G1KA 3UYIA 1XQKA 4GVIA 4XD5A 4GI4A 3F03K 3V0UA 1RZMA 3E1F1 2C1GA 3VKAA 4XZ9A 4H6RA 4TV6A 2VEMA 3SY5A 1UUMA 3EWXA 3TP4A 1POJA 3VOHA 4ZENA 3CV1A 4PUKA 3A9IA 3W26A 4GIRA 1YDOA 1NWSA 2PS2A 2YIHA 4D1IA 4ZO7A 3ELFA 3NQVA 3SFKA 4H8NA 3CGTA 1W1VA 2OZ3A 3NO5A 1Z7AA 2FB3A 3RM4A 2PFHA 4D6DA 2HK0A 5JIWA 3WLRA 1RD6A 4Z08A 1KCLA 5A8PA 1F05A 3CASA 1CEOA 3MI6A 1W3NA 3CEUA 1FCUA 2ESCA 1XGDA 2PC8A 2PDHA 1Q2RA 1AVAA 2OO0A 1L2QA 1XIDA 2DT1A 1KXHA 3MCMA 2J4GA 3VOIA 4CCZA 3SGZA 3SEPA 1M65A 3HTWA 4U2ZA 3LUTA 2FFCA 3E2RA 2MNRA 1YTKA 1JF6A 4PTVA 3VZYA 1XSIA 3M9YA 1FCBA 3RPMA 3GTNA 1ZLPA 3DFSA 1N55A 3NZ1A 1GVOA 3WLSA 2QJIA 4N2YA 3DZ1A 2QDEA 1G1YA 3DFHA 4QIUA 5BRPA 1H1YA 3I6EA 5FJTA 3ITCA 3OOQA 3NM1A 1PWMA 5IFPA 5D8ZA 4Y9OA 1A0CA 4JIPA 4EPEC 1SM9A 4GQGA 3HGJA 3BAKA 1H49A 2AMGA 1GOKA 4NQ1A 5I24A 2JGYA 5REQB 1UPPA 1WDRA 1NDYA 2P50A 1AZ1A 3VCRA 1CW2A 4CU7A 3IWPA 3AXXA 2PDXA 2CPUA 1YXCA 1OFQA 1AQ0A 1EGVA 1CPUA 3IEBA 1KRBC 4N9EA 2XIJA 4WDWA 3VGHA 2TAAA 3FCPA 4O17A 3CUJA 5IDZA 3RITA 3EPMA 4IJRA 4HZ7A 4NI8A 2VC6A 5HULA 3UG3A 4HNUA 4ZQCA 4JTRA 1A5NC 1JPKA 1FXQA 6TIMA 4DWSC 4KCWA 1GONA 1XX1A 1XLCA 3P84A 1H50A 4IUGA 3BAIA 1HZYA 2HV5A 1BGAA 3T0BA 4HQVA 3EDEA 2YL8A 2CZDA 2EJAA 3TR9A 9XIAA 2ZQ0A 2O9RA 1T7LA 1KTCA 1NTHA 2ZUTA 2X42A 1Q6GA 5D33A 3EX4A 1R9XA 1DP0A 5CG7A 2F9RA 5D30A 4GQRA 1WKYA 4AXNA 3THDA 4RZBA 1QPQA 1FP9A 4R53A 3HPAA 1QHOA 3EXSA 4UB9A 4JZ5A 4AMAA 1H0IA 2QJHA 3LHZA 1S2UA 5DELA 1O1HA 4B16A 4C65A 3DG6A 4DXKA 3BAYA 5EBUA 4YCPA 1JDDA 4LU0A 2YYUA 1H7OA 1VBGA 5BXSA 2J9XA 3EWWA 4RE2A 1E4LA 2EKCA 4DUVA 3TWBA 3BJSA 3BW2A 3R4IA 4QG8A 1DORA 2Z1VA 3LGGA 1KFJA 1OFRA 4IMEA 3W53A 3SCSA 3WH7A 3VVGA 1LUCA 1JXKA 2Z29A 3A6OA 1WDDA 4KWSA 3STPA 1RVGA 3UVAA 5HAOA 1PYFA 4OTKA 3ZLFA 1DJGA 1PZ0A 4IIFA 2ISDA 4TVUA 3TH6A 1M01A 4L6DA 3PHAA 3WDQA 1A49A 2HQAA 2YXOA 3QZAA 1X8FA 3QH2A 1FWGC 2P1FA 1KM3A 1CGVA 1NF7A 2ANUA 3NQ6A 3TQPA 4KW2A 2ZVRA 1NF0A 1W3TA 2A0NA 3EX3A 2X0HA 4MNKA 1Q6FA 5EMMA 3TYDA 2YA2A 1TPH1 3ABOA 4AWUA 2E6FA 4FLQA 4WKHA 2XM1A 2F84A 1XFBA 3KL0A 1ONEA 4L9XA 4ADTA 3URNA 2QVNA 1K3UA 1W1B1 3C2FA 4KPLA 1E0WA 3S1VA 1DXFA 4LRSA 3A4AA 3LX9A 4GYKA 4XO7A 3TFXA 4XUGA 3OTRA 2G50A 3S2LA 4M6VA 2GVYA 5D04C 3KOZA 3W7KA 4PEKA 3E74A 4QG6A 4IPPA 3LZ5A 2FGBA 4ASTA 4WY0F 4PB4A 2PZ0A 4NKCA 1V3IA 1ZS2A 3RHGA 4L4MA 2VYOA 3VGFA 3VNYA 4OT7A 4DN1A 3KOFA 1SVDA 1KWGA 1G7UA 2HRWA 1XLEA 1Y5WA 1ECQA 3R25A 4H9VA 5AHEA 5BNKA 4GXWA 2V5LA 2X1IA 1FH7A 3Q58A 4LANA 1ME7A 3P80A 4NJGA 2DZUA 3WQEA 4PZVA 2C14A 4YXGA 3E0IA 3TKFA 2Z2AA 1B3YA 3PWAA 5FSDC 3RM9A 1K77A 2YL6A 3BTNA 3TC6A 4BY3A 3T4WA 1GKQA 5G4EA 2QNEA 3UXLA 3H2FA 3F4VA 2X16A 2D3NA 4O12A 4YLWA 4UFIA 2E0PA 1IE7C 3C86A 3GBDA 4W9TA 3ANVA 3THCA 4HZMA 3N73A 3VIIA 1KQYA 3LK6A 3CJPA 3UFYA 3B8TA 4U10A 4IISA 4UFMA 3PY2A 3VIFA 1PE1A 2DT3A 3HOJA 5CZ0A 2A7NA 3BG9A 3NPWA 2P88A 4PULA 3BLOA 1WDQA 3BWWA 1KCZA 2DJXA 1IGWA 4MB5A 3UJFA 5XIAA 4NYYA 3BANA 4ECLA 2OJPA 4ZB0A 1ENUA 2FJKA 1ZP4A 3BV7A 1ZY9A 3NGJA 4B15A 1SR0A 3SECA 4S1FA 4O0ZA 1U1JA 4US6A 1DIOA 4F0SA 4H9XA 4Q7NA 3W81A 4GLEA 3E3HA 2PTZA 4CNOA 1R3RA 3PBMA 2WHMA 5E9XA 3HURA 3C0LA 2NT1A 1VIZA 4AMCA 1YBQA 1X6LA 4MJMA 1QNPA 4CD6A 1MNSA 3N4AA 3EWBX 2CLKA 3MMDA 1JYXA 5A69A 1JI2A 1O4UA 1UQZA 2DZXA 2C3ZA 4YTUA 1XP3A 5AECA 4QJ5B 1ZCCA 3C8FA 2Z2UA 4B92A 1PO9A 3MDUA 1K7FA 3PNUA 2RGMA 4C6PA 5BOEA 3LI1A 1FHLA 1YE4A 1NM9A 3QR3A 1JZ6A 1Z6KA 2PWGA 4LYRA 3HGSA 3V18A 2QYGA 1FWNA 3DHDA 2F2HA 3W2UA 3TN5A 3G22A 2BHZA 3L4UA 3WYZA 3TZFA 3EMCA 3W85A 4B90A 1EJSC 1H7WA 2ZX7A 4O14A 4ZL1A 3KVKA 4KRTA 1DE6A 1QK2A 2OO6A 1UMYA 3OZOA 2YDRA 1CGYA 3GNRA 4F0KA 1K6AA 4UBPC 4ICCX 2HNHA 2J74A 1VBJA 3BQ5A 3EYPA 4W8BA 2DUXA 2BOFX 1UQYA 1ZBKA 4RJEA 3PBYA 4OVXA 1M7PA 2XVNA 2PC4A 3S1WA 1K1DA 2NWSA 4D9PA 2QZRA 4FR6A 4LVAA 3GVGA 1LLWA 5ABHA 4AF0A 1DYSA 3OA5A 5CPSA 4GKTA 5ABFB 4DUWA 4QAWA 4B5UA 3I65A 4ATWA 1PKNA 1ZBWA 4YIWA 3A9BA 3P0XA 2NW0A 1NWUA 1U5HA 4YU1A 5KZMA 3DFTA 3I4KA 3LXCA 1EJRC 2ZA1A 3E2SA 3MHGA 4KWOA 4N4PA 3UG8A 5T91A 3BLFA 3GIQA 4KEMA 2ZFAA 2QUUA 3DECA 3U8GA 1HG3A 1QK0A 3R6IA 3CUFA 2NZLA 5CSSA 3P14A 4GIAA 4A3YA 1AK5A 3EKGA 2ZRXA 2EXOA 1EDTA 3F5LA 1MEWA 2OYLA 1E4NA 3P82A 4GUJA 4Q4RA 2G3FA 3O0FA 4Y96A 5LXEA 1AZ2A 3QTGA 4ADUA 2G4FA 2Y63A 2CHNA 3JR2A 3GW0A 3KXQA 3IJ6A 1CXKA 4GNKB 7CGTA 1NJJA 3ALFA 3UCQA 4PMVA 2Y8KA 4XZNX 4NL1A 1XI3A 4OU1A 4C6DA 4CD5A 5AHLA 1FCVA 1ALDA 1R2SA 3TDFA 5FEXA 4POCA 4DJEC 2WJDA 1NAL1 1SUXA 2NWRA 3OPSA 4G7EB 3HMJG 4UQAA 1X97A 3KCLA 1GOWA 3RG6A 3L9CA 2IXVA 5T9CE 1E0VA 2BDQA 3ARUA 4D8LA 1WOAA 3HU7A 2GVJA 1V7AA 1YNPA 3FAXA 5DBUA 1ISXA 4L7ZA 4MFDA 1UP0A 4ORIA 4KGJA 5D9MA 3MP4A 1KC7A 1JCLA 1B57A 3PZOA 2YFNA 1MW2A 1UR8A 2JEQA 1AQFA 5FCZA 4DEFA 4JN7A 1HQTA 4F9JA 4PCTA 2GUBA 3D3AA 4JTLA 4W8AA 3LOTA 3AQUA 1HKJA 4LX4A 4DZIA 2VX7A 3I10A 3QV9A 3FHQA 3QR0A 4Q8TA 4L1GA 3PZUA 4JTAA 3CPGA 1PZ3A 2ISSA 4HHPA 2QV4A 1XD1A 4JTFA 3R0UA 2PTWA 5EY5A 1W6TA 1QU4A 5LGZA 5LNVA 1IXNA 3WLKX 2XH0A 3F2BA 2GSHA 2I16A 5BXTA 4NJJA 5DT5A 4AY8A 3MU7A 2V8ZA 1O7AA 2QW5A 3K8KA 3SZ8A 3ABZA 2ACRA 3LMZA 3VMOA 3GU2A 4HMCA 5ENLA 2WXDM 1YDVA 1GOQA 1RXOB 2CBVA 3UETA 1FWSA 3BICA 3E2VA 3E2QA 1H63A 2R1NA 4J3WA 3TYZA 3S5OA 2F6XA 2W6RA 3RILA 1MDLA 1TMQA 1XSJA 3F4DA 1IYXA 1XIIA 3M44A 3R58A 1EIBA 2FDSA 4K38A 3CC1A 5TAOA 3SY1A 4IPJA 1PIGA 4J7RA 1K02A 2CKRA 4PMDA 1L6GA 3GXMA 2CHOA 4RZ6A 4KT2A 4J2PA 3N6JA 3QR1A 3QMTA 4B3LA 2A3HA 4NRRA 1HNYA 4AIEA 4KEVA 5C7VA 1US0A 4FK9A 2YXXA 4C7DA 4B5NA 4MWAA 2QUMA 3OYXA 4K6AA 3SI9A 3WDIA 2BVYA 1WYIA 3K1DA 5A6AA 3CAKA 4GZJA 2HDJA 1NY1A 4I9MA 4JFVA 3O6YX 4Y6GA 1Z41A 4HSNA 4UTWA 5HMFA 4JFTA 3G3DA 4RW5A 3T8QA 5AC7A 2DZPA 4H8UA 4HJWA 3HFYA 1SSDA 3KDOA 1EA0A 1I2QA 5JBEA 2F38A 1AH4A 1S2CA 2ISWA 4QNWA 3VABA 3ZSSA 3IPWA 3DBPA 4NZ1A 3PBUA 4DQWA 1KXTA 1FH9A 2IXUA 1UZ1A 3O0KA 5D38A 3NTYA 1YDYA 4DWSB 5IM51 1XW8A 4L6HA 1XPGA 3S6TA 1QI0A 1MQRA 4NILA 1RVKA 4LYKA 2PDGA 4FXRA 5LGXA 4JTUA 2JBMA 4LXFA 3QKZA 3T55A 4J3ZA 3UPMA 2YA1A 2HVNA 3O8AA 4E8GA 3QRHA 1EA9C 4HPNA 5F4SA 3CQ0A 4XTIA 2OEKA 3P5ZA 1R30A 2C8NA 1KV5A 1J01A 1GG1A 2V3FA 1Z42A 2UY5A 4LUTA 4WVXA 3GG0A 1IWPA 2VX4A 1QAPA 3BVJA 3WEOA 4CD7A 3AYTA 5TIMA 1H09A 3O6DA 2WC3A 3UCDA 2WQDA 2E9MA 2PDWA 3LCWA 3L5MA 2PDMA 1NOFA 4MFEA 4HZ6A 3D46A 3T09A 2ABAA 1F6KA 1E1FA 2X05A 2DEPA 3EGJA 1LLZA 1PL9A 2WSKA 1REQA 2WVUA 3BC9A 4QG9A 4I5XA 1FTXA 2XZ7A 4WSKA 4LCSA 3GH5A 4JQ2A 3K30A 2FLIA 4RDWA 2VVNA 4XAPA 5I03A 4ML4A 4H4IA 4BQ4A 5JIPA 5C2CA 1B5TA 3KLKA 1EYEA 1R46A 3WUEA 1XLKA 3NQBA 1P1MA 3EOOA 2OPJA 1BGGA 5LSMA 2FHFA 3UG5A 1MXGA 4IMDA 4LW7A 3QOKA 5AYXA 1PKYA 2TODA 3OZMA 1YXDA 4UQ9A 2NQLA 2E7FA 2CXGA 1RQEA 3ABXA 4N9BA 2A6NA 1OCNA 4BJHA 1ITQA 4O1CA 4AZHA 2PDQA 3WMLA 1EWDA 4KEZA 3QW3A 3VXGA 1H5VA 4Z17A 1ZALA 2HSAA 3OODA 4AC7C 1IXPA 4FR1A 4B5XA 1GKRA 3R1ZA 1KM1A 2C79A 2GJNA 2BS9A 1OGGA 3ARSA 5FF3A 3TAOA 1WUEA 3HPFA 3QV6A 4AD4A 1P4CA 4JL1A 5XINA 1KB3A 4UFHA 4GYPC 5E5CA 3NQDA 9CGTA 1GVEA 3U5UA 3UY7A 3W7PA 4HZ8A 1DJZA 4GOAA 3TK7A 3VU2A 4JN8A 3GDMA 3IK4A 1X98A 1LWJA 1GTEA 1IT0A 2RFGA 2NLIA 2GQ3A 3HFTA 4WEVX 1KWKA 1GWJA 4MJ2A 3ABRA 4ZA0A 3L5AA 1XLDA 5EPDA 4XX6A 3AIQA 4H9YA 4GY1A 2QCHA 3W7EA 4E3TA 1JZ5A 4TX8A 5I79A 3S83A 1VRDA 4FNQA 3RLHA 3WQPA 4PMXA 3NIYA 1TUXA 4N0RA 2ALDA 1GVRA 4FNSA 3ATYA 4I7WA 4HKPA 2YOCA 2PMQA 1QHPA 1KW1A 3MP5A 4AHOA 3EWDA 4NG3A 2PODA 3AHTA 1RALA 3ARTA 2VT0A 3LBMA 4O4VA 3WEMA 1OYAA 2INFA 1QBAA 2C0HA 2FYMA 5GJMA 5I3JA 4W7WA 3B40A 2PD9A 4RZ4A 1SZNA 1XLBA 2Z6IA 4DLFA 2REQA 4ZO8A 5MKGA 5HWJA 1GQKA 1XR2A 2ZRVA 3OVGA 4CCCA 1TWWA 3TTEA 2OOGA 1E0TA 3E5PA 5L9FA 3R13A 3KL5A 5A8QA 1EO7A 3BDKA 2J75A 4OE7A 5FEPA 3SN1A 3OLGA 2VRJA 5A2BA 4OGZA 2FVMA 4B5WA 3L4TA 5TF0A 1CNVA 3U0HA 3W1UA 1VCVA 3LLXA 1E6NA 1XUZA 3I3BA 4DBUA 4ATDA 2ABBA 4LAZA 1BVWA 4TTGA 2DH3A 4LV4A 4IOTA 4DHGA 1Q7MA 1S46A 3EB2A 2YCKX 2FJUB 3WLIA 4PCFA 3QSTA 1PDZA 1JCJA 2BXYA 4XK2A 3CTLA 2YLAA 1OGBA 4HPXA 3SDOA 1O66A 1FH8A 1OC5A 2AQWA 4YVPA 2PGEA 2Y7DA 1E5NA 1YTEA 4RE4A 1QI5A 2Z4GA 4MDPA 3GXNA 1GOOA 1SFLA 2NUWA 4W4QA 1BAGA 2XFWA 1RUSA 4PGLA 1YYAA 1RY0A 2GK1A 4U5IA 2INEA 5DANA 1K9FA 3IACA 3PPHA 1H5YA 4ZO6A 3NURA 4PRRA 5GNZA 5A6MA 2CETA 4HNTA 4PRTA 1HTIA 1W56A 3GTFA 4AFYA 3DHUA 1TSIA 5FD0A 5D9PA 4FLSA 1E9IA 1A50A 1J6PA 3XINA 1GVFA 3N25A 5DEZA 1J8VA 2H3BA 3PSWA 4E2DA 5KINA 1L6YA 1NDVA 1LF1A 4LAOA 5AHIA 3MV01 4JEJA 2ZZ1A 1JNDA 4AIUA 2YFOA 1FRBA 4K37A 3WFAA 4X2RA 4MWAB 3CH0A 1WZLA 1H61A 1FOBA 1B4KA 3KEHA 3SQLA 3ZSTA 1BKHA 5IBXA 1RA5A 4PUWA 2Z6JA 5CG0A 2HBVA 1QASA 2QAFA 3VM7A 1G7VA 2G3JA 5H2ZA 4GJIA 3TN6A 4ZQPA 1UB3A 2UZ9A 2VUYA 2XIMA 3HJZA 5JH1A 2NV1A 4RCXA 3MWAA 4Y2WA 5I7GA 5KEZA 5I00A 2J9ZA 1EJUC 1XF0A 1EC7A 4P7NA 4OUEA 5DFAA 2PLJA 2YXGA 4QEEA 1W2PA 3OO2A 2YBUA 5CPOA 2OWWA 1QJWA 2YBTA 3T40A 1F07A 3SCOA 2Y2WA 3TJXA 5G2WA 3CLMA 3P2VA 3NUKA 2BWGA 3AALA 3URQA 1XC6A 1OIFA 4PUDA 5F2MA 2W67A 5I3HA 3LHTA 2NVCA 1K6WA 4UTFA 1FWBC 1PKLA 1W5OA 2HISA 4O1FA 1EZ2A 3GHSA 3PG9A 5DCDA 4LUJA 2FTYA 4Z42C 2ZRZA 3ARZA 3BAXA 4QRNA 4H9TA 3AWNA 1N8FA 2CLEA 4JTGA 3SW6A 3VFLA 4JNMA 4LUTB 1O5QA 1VEPA 4DYEA 2QUVA 1OFDA 2BTMA 1OHLA 2C18A 2HROA 4HK5A 3UJ2A 3M0IA 1EDQA 4OV4A 3URAA 4CQ9A 3N3TA 1SZGA 2V0TA 4O1DA 2XWEA 4TIMA 3A64A 2AAAA 1FFQA 1OFPA 4XISA 2DP3A 3CL6A 1J9YA 4ZXLA 2EPHA 3HM7A 1JNEA 2FGZA 1UUOA 1GZJA 3B8UA 1K8CA 4P5UA 3U7BA 3DHFA 3HV8A 1IGSA 3VUSA 3GD6A 4G5DA 4MLJA 4C90A 2BY2A 3C0JA 4GWEA 3NL6A 3FEMA 4Q8MA 5TBOA 1T96A 7TAAA 3INPA 1S3TC 3TYCA 4ONVA 3SRDA 2CLMA 3OQ8A 5FF4A 4OECA 2X8RA 1XGZA 3Q94A 2Z1WA 2Y8UA 3IGXA 4UR7A 1V08A 4M7SA 4W86A 4H9MA 4DX3A 1QO5A 4JL2A 1EUNA 3CO8A 4LS2A 3CZLA 3C52A 4NZ3A 5G1YA 1OCJA 2PDFA 2DIKA 3F5KA 4UTLA 3V5OA 1U1HA 3MVTA 4M80A 4HN4A 1XV8A 2O4MA 1FKXA 1VBUA 4TUFA 2F8QA 3PSVA 3WH8A 1E4IA 2C91A 3FFSA 3H53A 2OKOA 1A4MA 2BY3A 1XLFA 3MBDA 2D22A 1G69A 4ROQA 1AQHA 2QGYA 3NXLA 2QMKA 4CLMA 2C6QA 2ZX6A 4WIWA 3R8HA 3ORWA 1FWIC 4MOZA 1X7IA 2Y85A 1R3WA 3RDKA 4HPJA 4B3ZA 1V3MA 5M03A 3SSZA 4GA8A 3PZNA 2GJXA 4MM1A 4O10A 2R24A 1V6UA 1BSIA 2YR1A 1EKOA 2ZADA 3T0CA 4OJYA 4HGXA 3TLQA 2OLAA 5CBJA 5LKYA 2F6UA 2XZ9A 1DWAM 1JXJA 3WUBA 2XN0A 4WY0A 2P10A 3EDJA 2ZDSA 3G2GA 2P8BA 3GZ3A 4M0XA 5GVJA 1Q65A 4JX6A 1TWZA 1W1IE 3QHMA 2BGNE 3L2IA 3FHAA 3NDOA 2V63A 5I77A 2SFPA 4C5YA 2XHYA 4KIEA 4IJCA 4YS1A 1JD7A 1ZBCA 4HIBA 2NV2A 4TMBA 4I3GA 1J10A 3WUGA 5CAHA 1C29A 1F61A 2CFFA 4K68A 4UOQA 5I0DA 2E1DA 1OVDA 3BGJA 4EKJA 2VZOA 1EUAA 2E9BA 1LRTA 2IPJA 5ABGA 4X60A 6TAAA 2Q09A 4RXGA 1GORA 4OQVA 3DFOA 3P60A 4JNZA 5C6MA 3TC3A 3EOSA 3DFNA 1HL2A 5H8UA 1IT8A 3USBA 3WX7A 1E0XA 4OOZA 3RCNA 1DTUA 1O1ZA 1CENA 3DBNA 2OQYA 4Q4KA 4S3FA 2HXTA 1PTDA 1CB7B 3GDKA 5GPRA 1KFWA 3DGRA 3VC6A 2CZFA 3M6DA 3S2CA 3O6CA 4X9SA 1LL7A 1XC4A 1SSGA 4GBDA 1XRVA 3A4XA 4MWAE 5CC6A 4H9ZA 1CDGA 3KDNA 3FVMA 3IIOA 2XIQA 4AU0A 2Y4SA 3C4UA 1S5VA 3BLPX 2DZTA 3UCCA 3SADA 3N15A 4EVZA 4Z1YA 2CWXA 1DJWA 3EOUA 3H4GA 3CUZA 1GW1A 3H54A 1UMLA 1W37A 3IRDA 2XPKA 6PTDA 4LBRA 1MDRA 1ONWA 1OX4A 3UWWA 1IR2A 4PUNA 3MSYA 4UNIA 4JOMA 3B8IA 3O63A 4Y8EA 2XIOA 2OFJA 3DC8A 4KGLA 4P61A 2VFDA 2V82A 2ZRWA 2XVPA 3OLIA 4NZ4A 5J8LA 3GZAA 3B9OA 4MHBA 4W87A 1UR4A 4D6EA 2GJLA 2RJGA 1U83A 1NEYA 5CC3A 4GCXA 3RR4A 3MC5A 1C7SA 3MZ2A 1KGWA 4QQUA 3EEZA 2L5HA 3BURA 3LCFA 3M0ZA 3ARQA 4GYFA 2DT0A 3U5YA 1A5UA 4ZB5A 1L8PA 1TPFA 4MGGA 3M7SA 1AH0A 5MF5A 2YCJA 2BY0A 4O0KA 4DXXA 3WLNA 2PUZA 4XTDA 1CGWA 5A2AA 3B0VC 2DQWA 1P0KA 1Z69A 2W27A 3K8MA 2J25A 2ZZ6A 3BE7A 4B91A 3AROA 1TQXA 4XQ6A 4JYDA 2EO7A 4LVBA 3BJFA 4HNNA 4O19A 4GYJA 1TZZA 4RPPA 1VD6A 1I1XA 4O1AA 4GPNA 4HK7A 1GOIA 1W9BM 3Q4DA 4BF7A 3V36A 1E1EA 3G0XA 4RL3A 2DIJA 2PLKA 1XYLA 4O57A 4JTDA 3VD9A 5C8BB 4BZYA