1E5KA

Crystal structure of the molybdenum cofactor biosynthesis protein moba (protein fa) from escherichia coli at near atomic resolution
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
188
structure length
188
Chain Sequence
MTTITGVVLAGGKARRMGGVDKGLLELNGKPLWQHVADALMTQLSHVVVNANRHQEIYQASGLKVIEDSLADYPGPLAGMLSVMQQEAGEWFLFCPCDTPYIPPDLAARLNHQRKDAPVVWVHDGERDHPTIALVNRAIEPLLLEYLQAGERRVMVFMRLAGGHAVDFSDHKDAFVNVNTPEELARWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS PROTEIN A
publication title Crystal Structure of the Molybdenum Cofactor Biosynthesis Protein Moba from Escherichia Coli at Near Atomic Resolution
pubmed doi rcsb
source organism Escherichia coli
molecule tags Molybdopterin nucleotidyl-transferase
total genus 57
structure length 188
sequence length 188
ec nomenclature ec 2.7.7.77: Molybdenum cofactor guanylyltransferase.
pdb deposition date 2000-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1e5kA00
1TW5A 1ZCYA 3E26A 3V0QA 3K8DA 4FRQA 1WSZA 5CQPA 4KPZA 1G1LA 4J18A 3SXDA 1GWVA 1G95A 3D5NA 4HO3A 1W55A 2Y4KA 3BCVA 2XWMA 2NXVA 1ZI3A 2PA4A 1ZI1A 4Y7GA 4Y7FA 4HO2A 1H7QA 5EIYA 1VGZA 2AM5A 5CQNX 1H5SD 5IFYA 3ZLLA 4EE3A 3JUJA 1WT2A 3DJ4A 5C48A 1SS9A 1VZXA 3T7OA 3I0KA 1NQIB 2RJ6A 2P72A 4ASJA 2V0HA 1YP3A 1NHEB 4Y6UA 1K4VA 1G3LA 1ZJ1A 2RJ1A 4B4MA 4B5BA 4EEAA 3CGXA 3QVBA 1V84A 1MP3A 3U2TA 1ZJ0A 3EE5A 4Y7VA 1ZIZA 4CVHA 3TQDA 5DDTA 3OC9A 4EE5A 2WGZA 4M2BA 1ZJ2A 1Z90A 1H7LA 2CU2A 3R2WA 1W77A 4ZDQA 3ST8A 2Y6PA 1H4CA 1R80A 1NKHB 2VXMA 4EVWA 5CMIA 5C4DA 3SXCA 3CKQA 4G3PA 4AC3A 2VS3A 4HO0A 2VD4A 5L6VA 1GQ9A 2BO6A 1G97A 4Y64A 1FWYA 2JCOA 4K6RA 2Q4JA 3IOHA 2MZBA 4D0ZA 5DDVA 1HJLA 1E5KA 1G9RA 3OH0A 4E1KA 4R7PA 2OEGA 4IRQA 1FGXA 1S4OA 2PGYA 4XWIA 2ZU7A 4AYJA 4Y7UA 1TVYA 3FOQA 2VFZA 5J49A 2APCA 2FYBA 5EJ1A 2P6WA 2OI6A 2O1HA 5CQMX 1HM8A 2O1GA 3SPTA 3U0YA 1W57A 4CJBA 3DK5A 3Q80A 5C4FA 4FRHA 3IOIA 1NF5B 2RIXA 1LZ7A 3N9WA 1LZ0A 1VGTA 3E25A 1LL2A 5CMHA 3USRA 2WVLA 5C47A 2VS4A 3USQA 1YP2A 3RSBA 3V0OA 4MNDA 2PX7A 1OQMB 4Y62A 3I0LA 1TW1A 1R81A 5CMFX 1G93A 1VH3A 1FXJA 2RITA 2YCMA 3NGWA 2V0JA 5C4BA 5C38A 2FY7A 2OEFA 2YC5A 1OMZA 4D48A 5HS2A 4FCEA 3V91A 2W0WA 3DUVA 2Y7AA 2WVMA 3OH4A 1WT0A 3F1YA 4B4GA 1R7VA 2JCJA 1V82A 2VXLA 4HO4A 3OKRA 1MP5A 2YESA 4KNXA 4NANA 3V8YA 1ZJPA 2AECA 4NAIA 3CKNA 1VZTA 3V0MA 2Z87A 5CMJA 4HOCA 1QWJA 4B3UA 4EEOA 4HCQA 4KT7A 5CMGX 3I0EA 2I5KA 2A8UA 3CKJA 1FO8A 3V90A 1YROB 2RJ7A 3SXBA 2FYAA 1QGSA 1GQCA 3SX5A 5C36A 4B42A 3HL3A 2BO8A 3SXAA 2GGQA 3V8ZA 2XWLA 1JYKA 2E8BA 4NAKA 2PGVA 5CQLX 4JISA 3SX8A 1KWSA 1FZWA 2X5SA 5FTSA 4FREA 4KXOA 4B2WA 2VSHA 1HM0A 4M4KA 2X5ZA 2FYCB 1NMMB 4L41C 1VM8A 2FYDB 5FYEA 2FFUA 2ZU8A 1R7YA 2YQJA 1MP4A 5C3BA 4FRDA 4KC1A 2FFVA 3FWWA 2E3DA 2X60A 1H5TA 1H5TB 4HO8A 3SX7A 1VZUA 3POLA 5FU0A 3SXGA 1VICA 4KC2A 1FOAA 2XMEA 4D11A 1ZJ3A 3SXEA 5IDTA 1ZI5A 1H7TA 4CJCA 2AH9A 2RJ4A 5IDSA 4KRVA 3I0IX 3RMVA 5FU8A 4P02A 4EE4A 3I0DA 2GGOA 2WE9A 4D11C 2RIZA 2W0VA 4ARWA 2UX8A 2YC3A 3V0NA 4LW6A 2VSIA 3JTJA 2WVKA 2RJ8A 1FGGA 1G23A 3PKPA 4G3SA 3OH3A 2XWNA 3I0HA 3D8VA 1I52A 4DECA 2WEEA 2Y4LA 3U2VA 2XMHA 1H4EA 4JD0A 3GUEA 4M2AA 3O3PA 2D7RA 2RIYA 4ASYA 1JV1A 2AM3A 4EEGA 1PZTA 3U2UA 4Y63A 3F1CA 3ZF8A 2YQHA 2I7BA 1FRWA 3BRKX 5CQOA 3OAMA 5C3DA 2AM4A 5FV9A 2RJ0A 1VPAA 2Z86A 2QH5A 4DE7A 5FTVA 1G2VA 1INJA 1HJJA 4FROA 3SX3A 5C1GA 4YS8A 1XZ6A 2ICXA 4IRPA 4KNRA 1VH1A 1H7GA 2QKXA 1O7QA 1ZJOA 1LVWA 3RMWA 3I0CA 5C4CA 1JYLA 2V0LA 3U2XA 1V83A 1GX0A 1MC3A 3KIAA 1GWWA 1FG5N 1FXOA 1R7TA 4GBPA 1O0RA 5EJZA 5C3AA 4Y7TA 2JCKA 5AJOA 3K8EA 2BO4A 1O7OA 3D98A 5C8RA 2ICYA 1H7HA 1INIA 2OI7A 1ZCUA 1EZIA 1FR8A 3T7NA 1FO9A 4HO6A 3ZGGA 3I0FA 2Y4MA 2YQSA 1H7FA 1VGUA 4DDZA 4LW3A 4M28A 5C49A 4FRBA 3TZTA 1WVCA 1G8OA 1WT1A 1H5SB 1H5SA 3Q4SA 4FRLA 2V0IA 5FUHA 1R7XA 3R3IA 1ZDFA 3I0JA 4Y6NA 1IINA 1ON8A 4B2XA 4FRAA 1H5SC 2D0JA 2VS5A 4EEMA 4C2SA 2AGDA 3ZLKA 3I0GA 1EYRA 1ZI4A 2OI5A 3CU0A 4FCUA 1S4PA 4HO9A 3PNNA 1WT3A 4AAWA 1LZJA 4Y9XA 3V0PA 4AYLA 5C1HA 3ZGFA 3T7MA 1ON6A 4KQLA 4G3QA 1G0RA 3OGZA 3OH2A 1GX4A 2RJ9A 1H5RB 1H5RA 4MYBA 1QG8A 2X65A 1VGWA 2AESA 4BQHA 1HV9A 4HO5A 1QGQA 2I5EA 4FQWA 1JV3A 4D0TA 5JQQA 2D7IA 4G87A 1TZFA 1LL3A 1O23B 2O1FA 4P00A 3U0XA 4ECMA 2Y4JA 1OMXA 4FRPA 1JVDA 1FR9A 2JCLA 3LW6A 2A8WA 1ZDGA 2WAWA 4KC4A 4KPXA 1PZYB 2DPWA 1XHBA 3JUKA 1H4DA 3IOJA 1ZHJA 1S4NA 4CJ8A 4BMAA 5AJPA 3V0LA 3Q7UA 2V0KA 5BXCA 1H3MA 5L6SA 1R82A 4FRMA 4UEGA 1ZCTA 1R7UA 1JVGA 2AE7A 5C4EA 3CKVA 1YP4A 1LZIA 3CKOA 1IIMA 2QGIA 5AJNA 5I1FA 1H7EA 1HM9A 3OH1A 3U2WA 2P73A 4HG6A 2YQCA 5C1LA 2BO7A 3PKQA 4B4BA 2ZU9A 1ZCVA 1LL0A 4NALA 1GA8A 1NWGB 2RJ5A
chains in the Genus database with same CATH superfamily
1TW5A 1ZCYA 3E26A 3V0QA 3K8DA 4FRQA 1WSZA 5CQPA 4KPZA 1G1LA 4J18A 3SXDA 1GWVA 1G95A 3D5NA 4HO3A 1W55A 2Y4KA 3BCVA 2XWMA 2NXVA 1ZI3A 2PA4A 1ZI1A 4Y7GA 4Y7FA 4HO2A 1H7QA 5EIYA 1VGZA 2AM5A 5CQNX 1H5SD 5IFYA 3ZLLA 4EE3A 3JUJA 1WT2A 3DJ4A 5C48A 1SS9A 1VZXA 3T7OA 3I0KA 1NQIB 2RJ6A 2P72A 4ASJA 2V0HA 1YP3A 1NHEB 4Y6UA 1K4VA 1G3LA 1ZJ1A 2RJ1A 4B4MA 4B5BA 4EEAA 3CGXA 3QVBA 1V84A 1MP3A 3U2TA 1ZJ0A 3EE5A 4Y7VA 1ZIZA 4CVHA 3TQDA 5DDTA 3OC9A 4EE5A 2WGZA 4M2BA 1ZJ2A 1Z90A 1H7LA 2CU2A 3R2WA 1W77A 4ZDQA 3ST8A 2Y6PA 1H4CA 1R80A 1NKHB 2VXMA 4EVWA 5CMIA 5C4DA 3SXCA 3CKQA 4G3PA 4AC3A 2VS3A 4HO0A 2VD4A 5L6VA 1GQ9A 2BO6A 4O6NA 1G97A 4Y64A 1FWYA 2JCOA 4K6RA 2Q4JA 3IOHA 2MZBA 4D0ZA 5DDVA 1HJLA 1E5KA 1G9RA 3OH0A 4E1KA 4R7PA 2OEGA 4IRQA 1FGXA 1S4OA 2PGYA 4XWIA 2ZU7A 4AYJA 4Y7UA 1TVYA 3FOQA 2VFZA 5J49A 2APCA 2FYBA 5EJ1A 2P6WA 2OI6A 2O1HA 5CQMX 1HM8A 2O1GA 3SPTA 3U0YA 1W57A 4CJBA 3DK5A 3Q80A 5C4FA 4FRHA 3IOIA 1NF5B 2RIXA 1LZ7A 3N9WA 1LZ0A 1VGTA 3E25A 1LL2A 5CMHA 3USRA 2WVLA 5C47A 2VS4A 5D91A 3USQA 1YP2A 3RSBA 3V0OA 4MNDA 2PX7A 1OQMB 4Y62A 3I0LA 1TW1A 1R81A 5CMFX 1G93A 1VH3A 1FXJA 5D92A 2RITA 2YCMA 3NGWA 4Q7CA 2V0JA 5C4BA 5C38A 2FY7A 2OEFA 2YC5A 1OMZA 4D48A 5HS2A 4FCEA 3V91A 2W0WA 3DUVA 2Y7AA 2WVMA 3OH4A 1WT0A 3F1YA 4B4GA 1R7VA 2JCJA 1V82A 2VXLA 4HO4A 3OKRA 1MP5A 2YESA 4KNXA 4NANA 3V8YA 1ZJPA 2AECA 2VK9A 4NAIA 3CKNA 1VZTA 3V0MA 2Z87A 5CMJA 4HOCA 1QWJA 4B3UA 4EEOA 4HCQA 4KT7A 5CMGX 3I0EA 2I5KA 2A8UA 3CKJA 1FO8A 3V90A 1YROB 2RJ7A 3SXBA 2FYAA 1QGSA 1GQCA 3SX5A 5C36A 4B42A 3HL3A 2BO8A 3SXAA 2GGQA 3V8ZA 2XWLA 1JYKA 2E8BA 4NAKA 2PGVA 5CQLX 4JISA 3SX8A 1KWSA 1FZWA 2X5SA 5FTSA 4FREA 4KXOA 4B2WA 2VSHA 1HM0A 4M4KA 2X5ZA 2FYCB 1NMMB 4L41C 1VM8A 2FYDB 5FYEA 2FFUA 2ZU8A 1R7YA 2YQJA 1MP4A 5C3BA 4FRDA 4KC1A 2FFVA 3FWWA 2E3DA 2X60A 4FIYA 1H5TA 1H5TB 4HO8A 3SX7A 1VZUA 3POLA 5FU0A 3SXGA 1VICA 4KC2A 1FOAA 2XMEA 4D11A 1ZJ3A 3SXEA 5IDTA 1ZI5A 1H7TA 4CJCA 2AH9A 2RJ4A 5IDSA 4KRVA 3I0IX 3RMVA 5FU8A 4P02A 4EE4A 3I0DA 2GGOA 2WE9A 4D11C 2RIZA 2W0VA 4ARWA 2UX8A 2YC3A 3V0NA 4LW6A 2VSIA 3JTJA 2WVKA 2RJ8A 1FGGA 1G23A 3PKPA 4G3SA 3OH3A 2XWNA 3I0HA 3D8VA 1I52A 4DECA 2WEEA 2Y4LA 3U2VA 2XMHA 2J0BA 1H4EA 4JD0A 3GUEA 4M2AA 3O3PA 2D7RA 2RIYA 4ASYA 1JV1A 2AM3A 4EEGA 1PZTA 3U2UA 4Y63A 3F1CA 3ZF8A 2YQHA 2I7BA 1FRWA 3BRKX 5CQOA 3OAMA 5C3DA 2AM4A 5FV9A 2RJ0A 1VPAA 2Z86A 2QH5A 4DE7A 5FTVA 1G2VA 1INJA 1HJJA 4FROA 3SX3A 5C1GA 4YS8A 1XZ6A 2ICXA 4IRPA 4KNRA 1VH1A 1H7GA 2QKXA 1O7QA 1ZJOA 4O6MA 1LVWA 3RMWA 3I0CA 5C4CA 1JYLA 2V0LA 3U2XA 1V83A 1GX0A 1MC3A 3KIAA 1GWWA 1FG5N 1FXOA 1R7TA 4GBPA 1O0RA 5EJZA 5C3AA 4Y7TA 2JCKA 5AJOA 3K8EA 2BO4A 1O7OA 3D98A 5C8RA 2ICYA 1H7HA 4FIXA 1INIA 2OI7A 1ZCUA 1EZIA 1FR8A 3T7NA 1FO9A 4HO6A 3ZGGA 3I0FA 2Y4MA 2YQSA 1H7FA 1VGUA 4DDZA 4LW3A 4M28A 5C49A 4FRBA 3TZTA 1WVCA 1G8OA 1WT1A 1H5SB 1H5SA 3Q4SA 4FRLA 2V0IA 5FUHA 1R7XA 3R3IA 1ZDFA 3I0JA 4Y6NA 1IINA 1ON8A 4B2XA 4FRAA 1H5SC 2D0JA 2VS5A 4EEMA 4C2SA 2AGDA 3ZLKA 3I0GA 1EYRA 4MIXA 1ZI4A 2OI5A 3CU0A 4FCUA 1S4PA 4HO9A 3PNNA 1WT3A 2C0NA 4AAWA 1LZJA 4Y9XA 3V0PA 4AYLA 5C1HA 3ZGFA 3T7MA 1ON6A 4KQLA 4G3QA 1G0RA 3OGZA 3OH2A 1GX4A 2RJ9A 1H5RB 1H5RA 4MYBA 1QG8A 2X65A 1VGWA 2AESA 4BQHA 1HV9A 4HO5A 1QGQA 2I5EA 4FQWA 1JV3A 4D0TA 2J0AA 5JQQA 2D7IA 4G87A 1TZFA 1LL3A 1O23B 2O1FA 4P00A 3U0XA 4ECMA 2Y4JA 1OMXA 4FRPA 1JVDA 1FR9A 2JCLA 3LW6A 2A8WA 1ZDGA 2WAWA 4KC4A 4KPXA 1PZYB 2DPWA 1XHBA 3JUKA 1H4DA 3IOJA 1ZHJA 1S4NA 4CJ8A 4BMAA 5AJPA 3V0LA 3Q7UA 2V0KA 5BXCA 1H3MA 5L6SA 1R82A 4FRMA 4UEGA 1ZCTA 1R7UA 1JVGA 2AE7A 5C4EA 3CKVA 1YP4A 1LZIA 3CKOA 1IIMA 2QGIA 5AJNA 5I1FA 1H7EA 1HM9A 3OH1A 3U2WA 2P73A 4HG6A 2YQCA 5C1LA 2BO7A 3PKQA 4B4BA 2ZU9A 1ZCVA 1LL0A 4NALA 1GA8A 1NWGB 2RJ5A
chains in the Genus database with same CATH topology
1TW5A 1ZCYA 3E26A 3V0QA 3K8DA 4FRQA 1WSZA 5CQPA 4KPZA 1G1LA 4J18A 3SXDA 1GWVA 1G95A 3D5NA 4HO3A 1W55A 2Y4KA 3BCVA 2XWMA 2NXVA 1ZI3A 2PA4A 1ZI1A 4Y7GA 4Y7FA 4HO2A 1H7QA 5EIYA 1VGZA 2AM5A 5CQNX 1H5SD 5IFYA 3ZLLA 4EE3A 3JUJA 1WT2A 3DJ4A 5C48A 1SS9A 1VZXA 3T7OA 3I0KA 1NQIB 2RJ6A 2P72A 4ASJA 2V0HA 1YP3A 1NHEB 4Y6UA 1K4VA 1G3LA 1ZJ1A 2RJ1A 4B4MA 4B5BA 4EEAA 3CGXA 3QVBA 1V84A 1MP3A 3U2TA 1ZJ0A 3EE5A 4Y7VA 1ZIZA 4CVHA 3TQDA 5DDTA 3OC9A 4EE5A 2WGZA 4M2BA 1ZJ2A 1Z90A 1H7LA 2CU2A 3R2WA 1W77A 4ZDQA 3ST8A 2Y6PA 1H4CA 1R80A 1NKHB 2VXMA 4EVWA 5CMIA 5C4DA 3SXCA 3CKQA 4G3PA 4AC3A 2VS3A 4HO0A 2VD4A 5L6VA 1GQ9A 2BO6A 4O6NA 1G97A 4Y64A 1FWYA 2JCOA 4K6RA 2Q4JA 3IOHA 2MZBA 4D0ZA 5DDVA 1HJLA 1E5KA 1G9RA 3OH0A 4E1KA 4R7PA 2OEGA 4IRQA 1FGXA 1S4OA 2PGYA 4XWIA 2ZU7A 4AYJA 4Y7UA 1TVYA 3FOQA 2VFZA 5J49A 2APCA 2FYBA 5EJ1A 2P6WA 2OI6A 2O1HA 5CQMX 1HM8A 2O1GA 3SPTA 3U0YA 1W57A 4CJBA 3DK5A 3Q80A 5C4FA 4FRHA 3IOIA 1NF5B 2RIXA 1LZ7A 3N9WA 1LZ0A 1VGTA 3E25A 1LL2A 5CMHA 3USRA 2WVLA 5C47A 2VS4A 5D91A 3USQA 1YP2A 3RSBA 3V0OA 4MNDA 2PX7A 1OQMB 4Y62A 3I0LA 1TW1A 1R81A 5CMFX 1G93A 1VH3A 1FXJA 5D92A 2RITA 2YCMA 3NGWA 4Q7CA 2V0JA 5C4BA 5C38A 2FY7A 2OEFA 2YC5A 1OMZA 4D48A 5HS2A 4FCEA 3V91A 2W0WA 3DUVA 2Y7AA 2WVMA 3OH4A 1WT0A 3F1YA 4B4GA 1R7VA 2JCJA 1V82A 2VXLA 4HO4A 3OKRA 1MP5A 2YESA 4KNXA 4NANA 3V8YA 1ZJPA 2AECA 2VK9A 4NAIA 3CKNA 1VZTA 3V0MA 2Z87A 5CMJA 4HOCA 1QWJA 4B3UA 4EEOA 4HCQA 4KT7A 5CMGX 3I0EA 2I5KA 2A8UA 3CKJA 1FO8A 3V90A 1YROB 2RJ7A 3SXBA 2FYAA 1QGSA 1GQCA 3SX5A 5C36A 4B42A 3HL3A 2BO8A 3SXAA 2GGQA 3V8ZA 2XWLA 1JYKA 2E8BA 4NAKA 2PGVA 5CQLX 4JISA 3SX8A 1KWSA 1FZWA 2X5SA 5FTSA 4FREA 4KXOA 4B2WA 2VSHA 1HM0A 4M4KA 2X5ZA 2FYCB 1NMMB 4L41C 1VM8A 2FYDB 5FYEA 2FFUA 2ZU8A 1R7YA 2YQJA 1MP4A 5C3BA 4FRDA 4KC1A 2FFVA 3FWWA 2E3DA 2X60A 4FIYA 1H5TA 1H5TB 4HO8A 3SX7A 1VZUA 3POLA 5FU0A 3SXGA 1VICA 4KC2A 1FOAA 2XMEA 4D11A 1ZJ3A 3SXEA 5IDTA 1ZI5A 1H7TA 4CJCA 2AH9A 2RJ4A 5IDSA 4KRVA 3I0IX 3RMVA 5FU8A 4P02A 4EE4A 3I0DA 2GGOA 2WE9A 4D11C 2RIZA 2W0VA 4ARWA 2UX8A 2YC3A 3V0NA 4LW6A 2VSIA 3JTJA 2WVKA 2RJ8A 1FGGA 1G23A 3PKPA 4G3SA 3OH3A 2XWNA 3I0HA 3D8VA 1I52A 4DECA 2WEEA 2Y4LA 3U2VA 2XMHA 2J0BA 1H4EA 4JD0A 3GUEA 4M2AA 3O3PA 2D7RA 2RIYA 4ASYA 1JV1A 2AM3A 4EEGA 1PZTA 3U2UA 4Y63A 3F1CA 3ZF8A 2YQHA 2I7BA 1FRWA 3BRKX 5CQOA 3OAMA 5C3DA 2AM4A 5FV9A 2RJ0A 1VPAA 2Z86A 2QH5A 4DE7A 5FTVA 1G2VA 1INJA 1HJJA 4FROA 3SX3A 5C1GA 4YS8A 1XZ6A 2ICXA 4IRPA 4KNRA 1VH1A 1H7GA 2QKXA 1O7QA 1ZJOA 4O6MA 1LVWA 3RMWA 3I0CA 5C4CA 1JYLA 2V0LA 3U2XA 1V83A 1GX0A 1MC3A 3KIAA 1GWWA 1FG5N 1FXOA 1R7TA 4GBPA 1O0RA 5EJZA 5C3AA 4Y7TA 2JCKA 5AJOA 3K8EA 2BO4A 1O7OA 3D98A 5C8RA 2ICYA 1H7HA 4FIXA 1INIA 2OI7A 1ZCUA 1EZIA 1FR8A 3T7NA 1FO9A 4HO6A 3ZGGA 3I0FA 2Y4MA 2YQSA 1H7FA 1VGUA 4DDZA 4LW3A 4M28A 5C49A 4FRBA 3TZTA 1WVCA 1G8OA 1WT1A 1H5SB 1H5SA 3Q4SA 4FRLA 2V0IA 5FUHA 1R7XA 3R3IA 1ZDFA 3I0JA 4Y6NA 1IINA 1ON8A 4B2XA 4FRAA 1H5SC 2D0JA 2VS5A 4EEMA 4C2SA 2AGDA 3ZLKA 3I0GA 1EYRA 4MIXA 1ZI4A 2OI5A 3CU0A 4FCUA 1S4PA 4HO9A 3PNNA 1WT3A 2C0NA 4AAWA 1LZJA 4Y9XA 3V0PA 4AYLA 5C1HA 3ZGFA 3T7MA 1ON6A 4KQLA 4G3QA 1G0RA 3OGZA 3OH2A 1GX4A 2RJ9A 1H5RB 1H5RA 4MYBA 1QG8A 2X65A 1VGWA 2AESA 4BQHA 1HV9A 4HO5A 1QGQA 2I5EA 4FQWA 1JV3A 4D0TA 2J0AA 5JQQA 2D7IA 4G87A 1TZFA 1LL3A 1O23B 2O1FA 4P00A 3U0XA 4ECMA 2Y4JA 1OMXA 4FRPA 1JVDA 1FR9A 2JCLA 3LW6A 2A8WA 1ZDGA 2WAWA 4KC4A 4KPXA 1PZYB 2DPWA 1XHBA 3JUKA 1H4DA 3IOJA 1ZHJA 1S4NA 4CJ8A 4BMAA 5AJPA 3V0LA 3Q7UA 2V0KA 5BXCA 1H3MA 5L6SA 1R82A 4FRMA 4UEGA 1ZCTA 1R7UA 1JVGA 2AE7A 5C4EA 3CKVA 1YP4A 1LZIA 3CKOA 1IIMA 2QGIA 5AJNA 5I1FA 1H7EA 1HM9A 3OH1A 3U2WA 2P73A 4HG6A 2YQCA 5C1LA 2BO7A 3PKQA 4B4BA 2ZU9A 1ZCVA 1LL0A 4NALA 1GA8A 1NWGB 2RJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TW5 A;  1ZCY A;  3E26 A;  3V0Q A;  3K8D A;  4FRQ A;  1WSZ A;  5CQP A;  4KPZ A;  1G1L A;  4J18 A;  3SXD A;  1GWV A;  1G95 A;  3D5N A;  4HO3 A;  1W55 A;  2Y4K A;  3BCV A;  2XWM A;  2NXV A;  1ZI3 A;  2PA4 A;  1ZI1 A;  4Y7G A;  4Y7F A;  4HO2 A;  1H7Q A;  5EIY A;  1VGZ A;  2AM5 A;  5CQN X;  1H5S D;  5IFY A;  3ZLL A;  4EE3 A;  3JUJ A;  1WT2 A;  3DJ4 A;  5C48 A;  1SS9 A;  1VZX A;  3T7O A;  3I0K A;  1NQI B;  2RJ6 A;  2P72 A;  4ASJ A;  2V0H A;  1YP3 A;  1NHE B;  4Y6U A;  1K4V A;  1G3L A;  1ZJ1 A;  2RJ1 A;  4B4M A;  4B5B A;  4EEA A;  3CGX A;  3QVB A;  1V84 A;  1MP3 A;  3U2T A;  1ZJ0 A;  3EE5 A;  4Y7V A;  1ZIZ A;  4CVH A;  3TQD A;  5DDT A;  3OC9 A;  4EE5 A;  2WGZ A;  4M2B A;  1ZJ2 A;  1Z90 A;  1H7L A;  2CU2 A;  3R2W A;  1W77 A;  4ZDQ A;  3ST8 A;  2Y6P A;  1H4C A;  1R80 A;  1NKH B;  2VXM A;  4EVW A;  5CMI A;  5C4D A;  3SXC A;  3CKQ A;  4G3P A;  4AC3 A;  2VS3 A;  4HO0 A;  2VD4 A;  5L6V A;  1GQ9 A;  2BO6 A;  1G97 A;  4Y64 A;  1FWY A;  2JCO A;  4K6R A;  2Q4J A;  3IOH A;  2MZB A;  4D0Z A;  5DDV A;  1HJL A;  1E5K A;  1G9R A;  3OH0 A;  4E1K A;  4R7P A;  2OEG A;  4IRQ A;  1FGX A;  1S4O A;  2PGY A;  4XWI A;  2ZU7 A;  4AYJ A;  4Y7U A;  1TVY A;  3FOQ A;  2VFZ A;  5J49 A;  2APC A;  2FYB A;  5EJ1 A;  2P6W A;  2OI6 A;  2O1H A;  5CQM X;  1HM8 A;  2O1G A;  3SPT A;  3U0Y A;  1W57 A;  4CJB A;  3DK5 A;  3Q80 A;  5C4F A;  4FRH A;  3IOI A;  1NF5 B;  2RIX A;  1LZ7 A;  3N9W A;  1LZ0 A;  1VGT A;  3E25 A;  1LL2 A;  5CMH A;  3USR A;  2WVL A;  5C47 A;  2VS4 A;  3USQ A;  1YP2 A;  3RSB A;  3V0O A;  4MND A;  2PX7 A;  1OQM B;  4Y62 A;  3I0L A;  1TW1 A;  1R81 A;  5CMF X;  1G93 A;  1VH3 A;  1FXJ A;  2RIT A;  2YCM A;  3NGW A;  2V0J A;  5C4B A;  5C38 A;  2FY7 A;  2OEF A;  2YC5 A;  1OMZ A;  4D48 A;  5HS2 A;  4FCE A;  3V91 A;  2W0W A;  3DUV A;  2Y7A A;  2WVM A;  3OH4 A;  1WT0 A;  3F1Y A;  4B4G A;  1R7V A;  2JCJ A;  1V82 A;  2VXL A;  4HO4 A;  3OKR A;  1MP5 A;  2YES A;  4KNX A;  4NAN A;  3V8Y A;  1ZJP A;  2AEC A;  4NAI A;  3CKN A;  1VZT A;  3V0M A;  2Z87 A;  5CMJ A;  4HOC A;  1QWJ A;  4B3U A;  4EEO A;  4HCQ A;  4KT7 A;  5CMG X;  3I0E A;  2I5K A;  2A8U A;  3CKJ A;  1FO8 A;  3V90 A;  1YRO B;  2RJ7 A;  3SXB A;  2FYA A;  1QGS A;  1GQC A;  3SX5 A;  5C36 A;  4B42 A;  3HL3 A;  2BO8 A;  3SXA A;  2GGQ A;  3V8Z A;  2XWL A;  1JYK A;  2E8B A;  4NAK A;  2PGV A;  5CQL X;  4JIS A;  3SX8 A;  1KWS A;  1FZW A;  2X5S A;  5FTS A;  4FRE A;  4KXO A;  4B2W A;  2VSH A;  1HM0 A;  4M4K A;  2X5Z A;  2FYC B;  1NMM B;  4L41 C;  1VM8 A;  2FYD B;  5FYE A;  2FFU A;  2ZU8 A;  1R7Y A;  2YQJ A;  1MP4 A;  5C3B A;  4FRD A;  4KC1 A;  2FFV A;  3FWW A;  2E3D A;  2X60 A;  1H5T A;  1H5T B;  4HO8 A;  3SX7 A;  1VZU A;  3POL A;  5FU0 A;  3SXG A;  1VIC A;  4KC2 A;  1FOA A;  2XME A;  4D11 A;  1ZJ3 A;  3SXE A;  5IDT A;  1ZI5 A;  1H7T A;  4CJC A;  2AH9 A;  2RJ4 A;  5IDS A;  4KRV A;  3I0I X;  3RMV A;  5FU8 A;  4P02 A;  4EE4 A;  3I0D A;  2GGO A;  2WE9 A;  4D11 C;  2RIZ A;  2W0V A;  4ARW A;  2UX8 A;  2YC3 A;  3V0N A;  4LW6 A;  2VSI A;  3JTJ A;  2WVK A;  2RJ8 A;  1FGG A;  1G23 A;  3PKP A;  4G3S A;  3OH3 A;  2XWN A;  3I0H A;  3D8V A;  1I52 A;  4DEC A;  2WEE A;  2Y4L A;  3U2V A;  2XMH A;  1H4E A;  4JD0 A;  3GUE A;  4M2A A;  3O3P A;  2D7R A;  2RIY A;  4ASY A;  1JV1 A;  2AM3 A;  4EEG A;  1PZT A;  3U2U A;  4Y63 A;  3F1C A;  3ZF8 A;  2YQH A;  2I7B A;  1FRW A;  3BRK X;  5CQO A;  3OAM A;  5C3D A;  2AM4 A;  5FV9 A;  2RJ0 A;  1VPA A;  2Z86 A;  2QH5 A;  4DE7 A;  5FTV A;  1G2V A;  1INJ A;  1HJJ A;  4FRO A;  3SX3 A;  5C1G A;  4YS8 A;  1XZ6 A;  2ICX A;  4IRP A;  4KNR A;  1VH1 A;  1H7G A;  2QKX A;  1O7Q A;  1ZJO A;  1LVW A;  3RMW A;  3I0C A;  5C4C A;  1JYL A;  2V0L A;  3U2X A;  1V83 A;  1GX0 A;  1MC3 A;  3KIA A;  1GWW A;  1FG5 N;  1FXO A;  1R7T A;  4GBP A;  1O0R A;  5EJZ A;  5C3A A;  4Y7T A;  2JCK A;  5AJO A;  3K8E A;  2BO4 A;  1O7O A;  3D98 A;  5C8R A;  2ICY A;  1H7H A;  1INI A;  2OI7 A;  1ZCU A;  1EZI A;  1FR8 A;  3T7N A;  1FO9 A;  4HO6 A;  3ZGG A;  3I0F A;  2Y4M A;  2YQS A;  1H7F A;  1VGU A;  4DDZ A;  4LW3 A;  4M28 A;  5C49 A;  4FRB A;  3TZT A;  1WVC A;  1G8O A;  1WT1 A;  1H5S B;  1H5S A;  3Q4S A;  4FRL A;  2V0I A;  5FUH A;  1R7X A;  3R3I A;  1ZDF A;  3I0J A;  4Y6N A;  1IIN A;  1ON8 A;  4B2X A;  4FRA A;  1H5S C;  2D0J A;  2VS5 A;  4EEM A;  4C2S A;  2AGD A;  3ZLK A;  3I0G A;  1EYR A;  1ZI4 A;  2OI5 A;  3CU0 A;  4FCU A;  1S4P A;  4HO9 A;  3PNN A;  1WT3 A;  4AAW A;  1LZJ A;  4Y9X A;  3V0P A;  4AYL A;  5C1H A;  3ZGF A;  3T7M A;  1ON6 A;  4KQL A;  4G3Q A;  1G0R A;  3OGZ A;  3OH2 A;  1GX4 A;  2RJ9 A;  1H5R B;  1H5R A;  4MYB A;  1QG8 A;  2X65 A;  1VGW A;  2AES A;  4BQH A;  1HV9 A;  4HO5 A;  1QGQ A;  2I5E A;  4FQW A;  1JV3 A;  4D0T A;  5JQQ A;  2D7I A;  4G87 A;  1TZF A;  1LL3 A;  1O23 B;  2O1F A;  4P00 A;  3U0X A;  4ECM A;  2Y4J A;  1OMX A;  4FRP A;  1JVD A;  1FR9 A;  2JCL A;  3LW6 A;  2A8W A;  1ZDG A;  2WAW A;  4KC4 A;  4KPX A;  1PZY B;  2DPW A;  1XHB A;  3JUK A;  1H4D A;  3IOJ A;  1ZHJ A;  1S4N A;  4CJ8 A;  4BMA A;  5AJP A;  3V0L A;  3Q7U A;  2V0K A;  5BXC A;  1H3M A;  5L6S A;  1R82 A;  4FRM A;  4UEG A;  1ZCT A;  1R7U A;  1JVG A;  2AE7 A;  5C4E A;  3CKV A;  1YP4 A;  1LZI A;  3CKO A;  1IIM A;  2QGI A;  5AJN A;  5I1F A;  1H7E A;  1HM9 A;  3OH1 A;  3U2W A;  2P73 A;  4HG6 A;  2YQC A;  5C1L A;  2BO7 A;  3PKQ A;  4B4B A;  2ZU9 A;  1ZCV A;  1LL0 A;  4NAL A;  1GA8 A;  1NWG B;  2RJ5 A; 
#chains in the Genus database with same CATH topology
 1TW5 A;  1ZCY A;  3E26 A;  3V0Q A;  3K8D A;  4FRQ A;  1WSZ A;  5CQP A;  4KPZ A;  1G1L A;  4J18 A;  3SXD A;  1GWV A;  1G95 A;  3D5N A;  4HO3 A;  1W55 A;  2Y4K A;  3BCV A;  2XWM A;  2NXV A;  1ZI3 A;  2PA4 A;  1ZI1 A;  4Y7G A;  4Y7F A;  4HO2 A;  1H7Q A;  5EIY A;  1VGZ A;  2AM5 A;  5CQN X;  1H5S D;  5IFY A;  3ZLL A;  4EE3 A;  3JUJ A;  1WT2 A;  3DJ4 A;  5C48 A;  1SS9 A;  1VZX A;  3T7O A;  3I0K A;  1NQI B;  2RJ6 A;  2P72 A;  4ASJ A;  2V0H A;  1YP3 A;  1NHE B;  4Y6U A;  1K4V A;  1G3L A;  1ZJ1 A;  2RJ1 A;  4B4M A;  4B5B A;  4EEA A;  3CGX A;  3QVB A;  1V84 A;  1MP3 A;  3U2T A;  1ZJ0 A;  3EE5 A;  4Y7V A;  1ZIZ A;  4CVH A;  3TQD A;  5DDT A;  3OC9 A;  4EE5 A;  2WGZ A;  4M2B A;  1ZJ2 A;  1Z90 A;  1H7L A;  2CU2 A;  3R2W A;  1W77 A;  4ZDQ A;  3ST8 A;  2Y6P A;  1H4C A;  1R80 A;  1NKH B;  2VXM A;  4EVW A;  5CMI A;  5C4D A;  3SXC A;  3CKQ A;  4G3P A;  4AC3 A;  2VS3 A;  4HO0 A;  2VD4 A;  5L6V A;  1GQ9 A;  2BO6 A;  4O6N A;  1G97 A;  4Y64 A;  1FWY A;  2JCO A;  4K6R A;  2Q4J A;  3IOH A;  2MZB A;  4D0Z A;  5DDV A;  1HJL A;  1E5K A;  1G9R A;  3OH0 A;  4E1K A;  4R7P A;  2OEG A;  4IRQ A;  1FGX A;  1S4O A;  2PGY A;  4XWI A;  2ZU7 A;  4AYJ A;  4Y7U A;  1TVY A;  3FOQ A;  2VFZ A;  5J49 A;  2APC A;  2FYB A;  5EJ1 A;  2P6W A;  2OI6 A;  2O1H A;  5CQM X;  1HM8 A;  2O1G A;  3SPT A;  3U0Y A;  1W57 A;  4CJB A;  3DK5 A;  3Q80 A;  5C4F A;  4FRH A;  3IOI A;  1NF5 B;  2RIX A;  1LZ7 A;  3N9W A;  1LZ0 A;  1VGT A;  3E25 A;  1LL2 A;  5CMH A;  3USR A;  2WVL A;  5C47 A;  2VS4 A;  5D91 A;  3USQ A;  1YP2 A;  3RSB A;  3V0O A;  4MND A;  2PX7 A;  1OQM B;  4Y62 A;  3I0L A;  1TW1 A;  1R81 A;  5CMF X;  1G93 A;  1VH3 A;  1FXJ A;  5D92 A;  2RIT A;  2YCM A;  3NGW A;  4Q7C A;  2V0J A;  5C4B A;  5C38 A;  2FY7 A;  2OEF A;  2YC5 A;  1OMZ A;  4D48 A;  5HS2 A;  4FCE A;  3V91 A;  2W0W A;  3DUV A;  2Y7A A;  2WVM A;  3OH4 A;  1WT0 A;  3F1Y A;  4B4G A;  1R7V A;  2JCJ A;  1V82 A;  2VXL A;  4HO4 A;  3OKR A;  1MP5 A;  2YES A;  4KNX A;  4NAN A;  3V8Y A;  1ZJP A;  2AEC A;  2VK9 A;  4NAI A;  3CKN A;  1VZT A;  3V0M A;  2Z87 A;  5CMJ A;  4HOC A;  1QWJ A;  4B3U A;  4EEO A;  4HCQ A;  4KT7 A;  5CMG X;  3I0E A;  2I5K A;  2A8U A;  3CKJ A;  1FO8 A;  3V90 A;  1YRO B;  2RJ7 A;  3SXB A;  2FYA A;  1QGS A;  1GQC A;  3SX5 A;  5C36 A;  4B42 A;  3HL3 A;  2BO8 A;  3SXA A;  2GGQ A;  3V8Z A;  2XWL A;  1JYK A;  2E8B A;  4NAK A;  2PGV A;  5CQL X;  4JIS A;  3SX8 A;  1KWS A;  1FZW A;  2X5S A;  5FTS A;  4FRE A;  4KXO A;  4B2W A;  2VSH A;  1HM0 A;  4M4K A;  2X5Z A;  2FYC B;  1NMM B;  4L41 C;  1VM8 A;  2FYD B;  5FYE A;  2FFU A;  2ZU8 A;  1R7Y A;  2YQJ A;  1MP4 A;  5C3B A;  4FRD A;  4KC1 A;  2FFV A;  3FWW A;  2E3D A;  2X60 A;  4FIY A;  1H5T A;  1H5T B;  4HO8 A;  3SX7 A;  1VZU A;  3POL A;  5FU0 A;  3SXG A;  1VIC A;  4KC2 A;  1FOA A;  2XME A;  4D11 A;  1ZJ3 A;  3SXE A;  5IDT A;  1ZI5 A;  1H7T A;  4CJC A;  2AH9 A;  2RJ4 A;  5IDS A;  4KRV A;  3I0I X;  3RMV A;  5FU8 A;  4P02 A;  4EE4 A;  3I0D A;  2GGO A;  2WE9 A;  4D11 C;  2RIZ A;  2W0V A;  4ARW A;  2UX8 A;  2YC3 A;  3V0N A;  4LW6 A;  2VSI A;  3JTJ A;  2WVK A;  2RJ8 A;  1FGG A;  1G23 A;  3PKP A;  4G3S A;  3OH3 A;  2XWN A;  3I0H A;  3D8V A;  1I52 A;  4DEC A;  2WEE A;  2Y4L A;  3U2V A;  2XMH A;  2J0B A;  1H4E A;  4JD0 A;  3GUE A;  4M2A A;  3O3P A;  2D7R A;  2RIY A;  4ASY A;  1JV1 A;  2AM3 A;  4EEG A;  1PZT A;  3U2U A;  4Y63 A;  3F1C A;  3ZF8 A;  2YQH A;  2I7B A;  1FRW A;  3BRK X;  5CQO A;  3OAM A;  5C3D A;  2AM4 A;  5FV9 A;  2RJ0 A;  1VPA A;  2Z86 A;  2QH5 A;  4DE7 A;  5FTV A;  1G2V A;  1INJ A;  1HJJ A;  4FRO A;  3SX3 A;  5C1G A;  4YS8 A;  1XZ6 A;  2ICX A;  4IRP A;  4KNR A;  1VH1 A;  1H7G A;  2QKX A;  1O7Q A;  1ZJO A;  4O6M A;  1LVW A;  3RMW A;  3I0C A;  5C4C A;  1JYL A;  2V0L A;  3U2X A;  1V83 A;  1GX0 A;  1MC3 A;  3KIA A;  1GWW A;  1FG5 N;  1FXO A;  1R7T A;  4GBP A;  1O0R A;  5EJZ A;  5C3A A;  4Y7T A;  2JCK A;  5AJO A;  3K8E A;  2BO4 A;  1O7O A;  3D98 A;  5C8R A;  2ICY A;  1H7H A;  4FIX A;  1INI A;  2OI7 A;  1ZCU A;  1EZI A;  1FR8 A;  3T7N A;  1FO9 A;  4HO6 A;  3ZGG A;  3I0F A;  2Y4M A;  2YQS A;  1H7F A;  1VGU A;  4DDZ A;  4LW3 A;  4M28 A;  5C49 A;  4FRB A;  3TZT A;  1WVC A;  1G8O A;  1WT1 A;  1H5S B;  1H5S A;  3Q4S A;  4FRL A;  2V0I A;  5FUH A;  1R7X A;  3R3I A;  1ZDF A;  3I0J A;  4Y6N A;  1IIN A;  1ON8 A;  4B2X A;  4FRA A;  1H5S C;  2D0J A;  2VS5 A;  4EEM A;  4C2S A;  2AGD A;  3ZLK A;  3I0G A;  1EYR A;  4MIX A;  1ZI4 A;  2OI5 A;  3CU0 A;  4FCU A;  1S4P A;  4HO9 A;  3PNN A;  1WT3 A;  2C0N A;  4AAW A;  1LZJ A;  4Y9X A;  3V0P A;  4AYL A;  5C1H A;  3ZGF A;  3T7M A;  1ON6 A;  4KQL A;  4G3Q A;  1G0R A;  3OGZ A;  3OH2 A;  1GX4 A;  2RJ9 A;  1H5R B;  1H5R A;  4MYB A;  1QG8 A;  2X65 A;  1VGW A;  2AES A;  4BQH A;  1HV9 A;  4HO5 A;  1QGQ A;  2I5E A;  4FQW A;  1JV3 A;  4D0T A;  2J0A A;  5JQQ A;  2D7I A;  4G87 A;  1TZF A;  1LL3 A;  1O23 B;  2O1F A;  4P00 A;  3U0X A;  4ECM A;  2Y4J A;  1OMX A;  4FRP A;  1JVD A;  1FR9 A;  2JCL A;  3LW6 A;  2A8W A;  1ZDG A;  2WAW A;  4KC4 A;  4KPX A;  1PZY B;  2DPW A;  1XHB A;  3JUK A;  1H4D A;  3IOJ A;  1ZHJ A;  1S4N A;  4CJ8 A;  4BMA A;  5AJP A;  3V0L A;  3Q7U A;  2V0K A;  5BXC A;  1H3M A;  5L6S A;  1R82 A;  4FRM A;  4UEG A;  1ZCT A;  1R7U A;  1JVG A;  2AE7 A;  5C4E A;  3CKV A;  1YP4 A;  1LZI A;  3CKO A;  1IIM A;  2QGI A;  5AJN A;  5I1F A;  1H7E A;  1HM9 A;  3OH1 A;  3U2W A;  2P73 A;  4HG6 A;  2YQC A;  5C1L A;  2BO7 A;  3PKQ A;  4B4B A;  2ZU9 A;  1ZCV A;  1LL0 A;  4NAL A;  1GA8 A;  1NWG B;  2RJ5 A; 
#chains in the Genus database with same CATH homology
 1TW5 A;  1ZCY A;  3E26 A;  3V0Q A;  3K8D A;  4FRQ A;  1WSZ A;  5CQP A;  4KPZ A;  1G1L A;  4J18 A;  3SXD A;  1GWV A;  1G95 A;  3D5N A;  4HO3 A;  1W55 A;  2Y4K A;  3BCV A;  2XWM A;  2NXV A;  1ZI3 A;  2PA4 A;  1ZI1 A;  4Y7G A;  4Y7F A;  4HO2 A;  1H7Q A;  5EIY A;  1VGZ A;  2AM5 A;  5CQN X;  1H5S D;  5IFY A;  3ZLL A;  4EE3 A;  3JUJ A;  1WT2 A;  3DJ4 A;  5C48 A;  1SS9 A;  1VZX A;  3T7O A;  3I0K A;  1NQI B;  2RJ6 A;  2P72 A;  4ASJ A;  2V0H A;  1YP3 A;  1NHE B;  4Y6U A;  1K4V A;  1G3L A;  1ZJ1 A;  2RJ1 A;  4B4M A;  4B5B A;  4EEA A;  3CGX A;  3QVB A;  1V84 A;  1MP3 A;  3U2T A;  1ZJ0 A;  3EE5 A;  4Y7V A;  1ZIZ A;  4CVH A;  3TQD A;  5DDT A;  3OC9 A;  4EE5 A;  2WGZ A;  4M2B A;  1ZJ2 A;  1Z90 A;  1H7L A;  2CU2 A;  3R2W A;  1W77 A;  4ZDQ A;  3ST8 A;  2Y6P A;  1H4C A;  1R80 A;  1NKH B;  2VXM A;  4EVW A;  5CMI A;  5C4D A;  3SXC A;  3CKQ A;  4G3P A;  4AC3 A;  2VS3 A;  4HO0 A;  2VD4 A;  5L6V A;  1GQ9 A;  2BO6 A;  4O6N A;  1G97 A;  4Y64 A;  1FWY A;  2JCO A;  4K6R A;  2Q4J A;  3IOH A;  2MZB A;  4D0Z A;  5DDV A;  1HJL A;  1E5K A;  1G9R A;  3OH0 A;  4E1K A;  4R7P A;  2OEG A;  4IRQ A;  1FGX A;  1S4O A;  2PGY A;  4XWI A;  2ZU7 A;  4AYJ A;  4Y7U A;  1TVY A;  3FOQ A;  2VFZ A;  5J49 A;  2APC A;  2FYB A;  5EJ1 A;  2P6W A;  2OI6 A;  2O1H A;  5CQM X;  1HM8 A;  2O1G A;  3SPT A;  3U0Y A;  1W57 A;  4CJB A;  3DK5 A;  3Q80 A;  5C4F A;  4FRH A;  3IOI A;  1NF5 B;  2RIX A;  1LZ7 A;  3N9W A;  1LZ0 A;  1VGT A;  3E25 A;  1LL2 A;  5CMH A;  3USR A;  2WVL A;  5C47 A;  2VS4 A;  5D91 A;  3USQ A;  1YP2 A;  3RSB A;  3V0O A;  4MND A;  2PX7 A;  1OQM B;  4Y62 A;  3I0L A;  1TW1 A;  1R81 A;  5CMF X;  1G93 A;  1VH3 A;  1FXJ A;  5D92 A;  2RIT A;  2YCM A;  3NGW A;  4Q7C A;  2V0J A;  5C4B A;  5C38 A;  2FY7 A;  2OEF A;  2YC5 A;  1OMZ A;  4D48 A;  5HS2 A;  4FCE A;  3V91 A;  2W0W A;  3DUV A;  2Y7A A;  2WVM A;  3OH4 A;  1WT0 A;  3F1Y A;  4B4G A;  1R7V A;  2JCJ A;  1V82 A;  2VXL A;  4HO4 A;  3OKR A;  1MP5 A;  2YES A;  4KNX A;  4NAN A;  3V8Y A;  1ZJP A;  2AEC A;  2VK9 A;  4NAI A;  3CKN A;  1VZT A;  3V0M A;  2Z87 A;  5CMJ A;  4HOC A;  1QWJ A;  4B3U A;  4EEO A;  4HCQ A;  4KT7 A;  5CMG X;  3I0E A;  2I5K A;  2A8U A;  3CKJ A;  1FO8 A;  3V90 A;  1YRO B;  2RJ7 A;  3SXB A;  2FYA A;  1QGS A;  1GQC A;  3SX5 A;  5C36 A;  4B42 A;  3HL3 A;  2BO8 A;  3SXA A;  2GGQ A;  3V8Z A;  2XWL A;  1JYK A;  2E8B A;  4NAK A;  2PGV A;  5CQL X;  4JIS A;  3SX8 A;  1KWS A;  1FZW A;  2X5S A;  5FTS A;  4FRE A;  4KXO A;  4B2W A;  2VSH A;  1HM0 A;  4M4K A;  2X5Z A;  2FYC B;  1NMM B;  4L41 C;  1VM8 A;  2FYD B;  5FYE A;  2FFU A;  2ZU8 A;  1R7Y A;  2YQJ A;  1MP4 A;  5C3B A;  4FRD A;  4KC1 A;  2FFV A;  3FWW A;  2E3D A;  2X60 A;  4FIY A;  1H5T A;  1H5T B;  4HO8 A;  3SX7 A;  1VZU A;  3POL A;  5FU0 A;  3SXG A;  1VIC A;  4KC2 A;  1FOA A;  2XME A;  4D11 A;  1ZJ3 A;  3SXE A;  5IDT A;  1ZI5 A;  1H7T A;  4CJC A;  2AH9 A;  2RJ4 A;  5IDS A;  4KRV A;  3I0I X;  3RMV A;  5FU8 A;  4P02 A;  4EE4 A;  3I0D A;  2GGO A;  2WE9 A;  4D11 C;  2RIZ A;  2W0V A;  4ARW A;  2UX8 A;  2YC3 A;  3V0N A;  4LW6 A;  2VSI A;  3JTJ A;  2WVK A;  2RJ8 A;  1FGG A;  1G23 A;  3PKP A;  4G3S A;  3OH3 A;  2XWN A;  3I0H A;  3D8V A;  1I52 A;  4DEC A;  2WEE A;  2Y4L A;  3U2V A;  2XMH A;  2J0B A;  1H4E A;  4JD0 A;  3GUE A;  4M2A A;  3O3P A;  2D7R A;  2RIY A;  4ASY A;  1JV1 A;  2AM3 A;  4EEG A;  1PZT A;  3U2U A;  4Y63 A;  3F1C A;  3ZF8 A;  2YQH A;  2I7B A;  1FRW A;  3BRK X;  5CQO A;  3OAM A;  5C3D A;  2AM4 A;  5FV9 A;  2RJ0 A;  1VPA A;  2Z86 A;  2QH5 A;  4DE7 A;  5FTV A;  1G2V A;  1INJ A;  1HJJ A;  4FRO A;  3SX3 A;  5C1G A;  4YS8 A;  1XZ6 A;  2ICX A;  4IRP A;  4KNR A;  1VH1 A;  1H7G A;  2QKX A;  1O7Q A;  1ZJO A;  4O6M A;  1LVW A;  3RMW A;  3I0C A;  5C4C A;  1JYL A;  2V0L A;  3U2X A;  1V83 A;  1GX0 A;  1MC3 A;  3KIA A;  1GWW A;  1FG5 N;  1FXO A;  1R7T A;  4GBP A;  1O0R A;  5EJZ A;  5C3A A;  4Y7T A;  2JCK A;  5AJO A;  3K8E A;  2BO4 A;  1O7O A;  3D98 A;  5C8R A;  2ICY A;  1H7H A;  4FIX A;  1INI A;  2OI7 A;  1ZCU A;  1EZI A;  1FR8 A;  3T7N A;  1FO9 A;  4HO6 A;  3ZGG A;  3I0F A;  2Y4M A;  2YQS A;  1H7F A;  1VGU A;  4DDZ A;  4LW3 A;  4M28 A;  5C49 A;  4FRB A;  3TZT A;  1WVC A;  1G8O A;  1WT1 A;  1H5S B;  1H5S A;  3Q4S A;  4FRL A;  2V0I A;  5FUH A;  1R7X A;  3R3I A;  1ZDF A;  3I0J A;  4Y6N A;  1IIN A;  1ON8 A;  4B2X A;  4FRA A;  1H5S C;  2D0J A;  2VS5 A;  4EEM A;  4C2S A;  2AGD A;  3ZLK A;  3I0G A;  1EYR A;  4MIX A;  1ZI4 A;  2OI5 A;  3CU0 A;  4FCU A;  1S4P A;  4HO9 A;  3PNN A;  1WT3 A;  2C0N A;  4AAW A;  1LZJ A;  4Y9X A;  3V0P A;  4AYL A;  5C1H A;  3ZGF A;  3T7M A;  1ON6 A;  4KQL A;  4G3Q A;  1G0R A;  3OGZ A;  3OH2 A;  1GX4 A;  2RJ9 A;  1H5R B;  1H5R A;  4MYB A;  1QG8 A;  2X65 A;  1VGW A;  2AES A;  4BQH A;  1HV9 A;  4HO5 A;  1QGQ A;  2I5E A;  4FQW A;  1JV3 A;  4D0T A;  2J0A A;  5JQQ A;  2D7I A;  4G87 A;  1TZF A;  1LL3 A;  1O23 B;  2O1F A;  4P00 A;  3U0X A;  4ECM A;  2Y4J A;  1OMX A;  4FRP A;  1JVD A;  1FR9 A;  2JCL A;  3LW6 A;  2A8W A;  1ZDG A;  2WAW A;  4KC4 A;  4KPX A;  1PZY B;  2DPW A;  1XHB A;  3JUK A;  1H4D A;  3IOJ A;  1ZHJ A;  1S4N A;  4CJ8 A;  4BMA A;  5AJP A;  3V0L A;  3Q7U A;  2V0K A;  5BXC A;  1H3M A;  5L6S A;  1R82 A;  4FRM A;  4UEG A;  1ZCT A;  1R7U A;  1JVG A;  2AE7 A;  5C4E A;  3CKV A;  1YP4 A;  1LZI A;  3CKO A;  1IIM A;  2QGI A;  5AJN A;  5I1F A;  1H7E A;  1HM9 A;  3OH1 A;  3U2W A;  2P73 A;  4HG6 A;  2YQC A;  5C1L A;  2BO7 A;  3PKQ A;  4B4B A;  2ZU9 A;  1ZCV A;  1LL0 A;  4NAL A;  1GA8 A;  1NWG B;  2RJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...