1E5SA

Proline 3-hydroxylase (type ii) - iron form
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
290
structure length
260
Chain Sequence
MRSHILGKIELDQTRLAPDLAYLAAVPTVEEFSNGFWKHVPLWNQPTAHVEHVPYLKEIVTTVFDGTHLQMARSRNLKNAIVIPHRDFRYFRTFMVLEDSPLAFHSNEDTVIHMRPGEIWFLDAATVHSAVNFSEISRQSLCVDFAFDGPFDEKEIFADATLYAPGSTPDLPERRPFTAEHRRRILSLGQVIERENFRDILFLLSKVHYKYDVHPSETYDWLIEISKQAGDEKMVVKAEQIRDFAVEARALSERFSLTSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Proline 3-Hydroxylase. Evolution of the Family of 2-Oxoglutarate Dependent Oxygenases.
pubmed doi rcsb
molecule tags Oxygenase
molecule keywords PROLINE OXIDASE
total genus 69
structure length 260
sequence length 290
chains with identical sequence B
ec nomenclature ec 1.14.11.28: Proline 3-hydroxylase.
pdb deposition date 2000-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05118 Asp_Arg_Hydrox Aspartyl/Asparaginyl beta-hydroxylase
A PF05373 Pro_3_hydrox_C L-proline 3-hydroxylase, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1720.10 Mainly Alpha Orthogonal Bundle Proline Oxidase; Chain: A, Domain 2 L-proline 3-hydroxylase, C-terminal domain 1e5sA02
2.60.120.330 Mainly Beta Sandwich Jelly Rolls B-lactam Antibiotic, Isopenicillin N Synthase; Chain 1e5sA01
1ODMA 2WO7A 2Y6FA 2DBNA 2JB4A 1GP5A 2VBDA 3ZKUA 5C3SA 1E5SA 1BLZA 1W2OA 2Y60A 1RXGA 3ON7A 2DBIA 4XAEA 5APAA 1OC1A 1HB1A 1BK0A 1QIQA 1RXFA 2BU9A 1OBNA 1ODNA 2BJSA 2VAUA 2VCMA 2BRTA 1UOGA 2IVJA 4RGKA 1E5IA 1W05A 1QJEA 1W04A 1IPSA 1UO9A 2JB8A 5C3OA 1QJFA 1UZWA 3OOXA 1HJGA 1E5RA 1DCSA 5C3PA 4BB3A 1W28A 1W9YA 1W2NA 2CSGA 1W3VA 3ZKYA 1UOFA 1GP4A 3ZOIA 1W3XA 1UOBA 1W2AX 1GP6A 1W03A 1HB3A 1HB4A 1UNBA 1WA6X 1W06A 2VBPA 2VBBA 2VE1A 5C3QA 5C3RA 2IVIB 1HB2A 1E5HA 1HJFA
chains in the Genus database with same CATH superfamily
3RI9A 3SC7X 1AUYA 4Y26A 4JQRA 3PJQA 3ZX7A 2QDNA 3IT8A 2VTXJ 3WNOA 1SEFA 1WGPA 1QNYA 4I30A 1T6GC 2P3YA 3NWKA 4Q1RA 1ZVFA 4L11A 1AX1A 5FBJA 2YYOA 3Q9OA 3Q8AA 1RUE2 1NLQA 3VD9A 2IXCA 4K8RB 1J1TA 5IUQA 3MW2A 1XE8A 3DEMA 1X9PA 3POJA 1UPIA 5L7OA 3W5NA 1GWMA 1BQPA 1ENSA 2XJVA 4J6GA 2PQSA 4B4PA 3C3VA 1XNDA 4YFWA 3ZKYA 1HQNA 1DZTA 2Q1FA 3WF4A 5DPNA 1UU6A 1UZ0A 2X53S 2AEZA 2MNGA 4LT5A 4ZU4A 1ASJ2 2Y38A 1WW7A 4H3WA 4CU8A 4N90A 5BNNA 2WNVA 1R1A1 5DN2A 3TRSB 2G1MA 3I4IA 2GAUA 2R042 1L7QA 1XJAA 4R9DA 2X5IA 3AZYA 3HNYM 1GZCA 1YLLA 3ETPA 3VN4A 4CU9A 4CEYC 4LJHA 2BV4A 1HX6A 4J25A 1IQDC 4Q4X2 3ZDSA 1QH7A 1Z7S2 4PI2A 3TN92 3WDXA 1VJ2A 4U2AA 3MIFA 5BNPA 4PBPA 4XUOA 4XF0A 2WS93 3AYDA 1POV1 1ENXA 1CIYA 4G4FA 4DNYA 5J37A 1UZVA 2QDRA 3ZN5A 5E89A 1KEXA 4OHYA 2UU8A 1JU4A 2DDUA 4OI2A 2RS31 4LKFA 1QHDA 4YGCA 1Z7S1 5LW9A 1ALYA 2BNOA 4K40A 5LBEA 2GSYA 4BXSV 1B09A 5ABJC 3N9PA 5F7UA 4FPHA 5L9BA 2DUPA 2NLRA 3D6EA 3V0BA 4LO6B 3O0VA 2VTFA 2ZJCA 3DPRA 5JZGC 3KD4A 2V4VA 1AL22 5F5IA 3KHBA 4DQAA 2VUCA 4IE5A 4QPGB 4NO4A 2EALA 3RDIA 3K4ZA 4N53B 1ASJ3 1OKOA 1N1VA 2ETEA 4ES9A 5A1LA 4D69A 3UV9A 4KBZA 1WD4A 1KJLA 4Q1PA 1K12A 3B7MA 4QXCA 5CFCA 1YIFA 3LA3A 4XFGA 3WG4A 2Q4SA 2VMGA 5AVAA 3ZYGA 2VVDA 2HYXA 3SEEA 4QKFA 1SLIA 2CYFA 1WW6A 2QQKA 1BVVA 2LALA 2VUDA 1O4YA 3EHKA 3K2OA 4Q4V1 4FPFA 4P08A 2R071 4RFT0 2OYZA 3H3UA 2FQPA 1SDWA 2P3KA 2VOTA 3KV5A 3KT4A 4LUMA 1DGRA 4QDRA 1LOFC 5FZLA 5AC91 3NAPC 1YWKA 1RVF2 3O5SA 4B4QA 3VKOA 4MHRA 4XETA 1F2NA 2E26A 1PHMA 3ILRA 4AHWA 1O7FA 3LIHA 4EN8B 1C5HA 1JU3A 4YW2A 1Y9GA 2B7YA 4MADA 4QPIB 2WAAA 2ZEZA 3VD3A 2JE9A 4H14A 3J8F2 4QX1A 4Z2AA 3MLJA 5FREA 4LORA 5F3IA 3RFRA 5H9SA 3SCHA 5KXCA 1GZWA 4QU1A 3B5LB 3RNSA 2QBXA 4L9BA 5DXDA 2D6LX 1QMJA 2XB6C 3AYEA 4TLFA 1I3HA 4E2SA 2XOMA 5DUXA 5FP3A 4Y1YA 4W8JA 1ULGA 3Q8BA 1C4RA 2ZGNA 2JDMA 1NCQB 4YW6A 4CP9A 4FAGA 1VRH1 3ZXFA 2QQMA 3UT0A 2PYTA 3DV8A 4LLFA 5FOBB 4Q4W1 4XUQA 1XNBA 1AR63 1SPPA 1TMF2 4XFIA 2WNVC 5LB6A 5C5TA 5E16A 5K0UB 3A22A 1POV3 1HQLA 1JOJA 2R062 3HD8B 3ZXLA 1H2MA 1GNYA 4QXHA 1CESA 3JUUA 1DZQA 3M3OA 3O12A 2B5HA 2RM22 5EV7A 4F8AA 1E5IA 3TEWA 1RUOA 4Y3OA 4YZ3A 5A3UA 1J1LA 4RHV3 2XGXA 3OCPA 4FPKA 4D3WA 1GUIA 2VNOA 3UKNA 5T54A 5CVRA 2P34A 2C0ZA 5I0SA 3O1UA 1O91A 2GZWA 4HOOA 4FT8A 2EXJA 5CISA 1L7LA 3E1F1 1MVQA 3LDKA 1X50A 4P02B 4MXWA 5GLTA 1SFNA 1WLDA 3H1MA 5FYUA 4EWAA 5C3RA 1AX0A 4XJ8A 5LRSA 1ODMA 2CWSA 4GMP3 1URXA 1AHSA 4KBBA 3BKZA 4QDQA 3V56A 2XWBB 1D4M2 2CY6A 5F5QA 4EJRA 2DBIA 5FP4A 4IV1B 4XW3A 3HQUA 1AF9A 1US3A 4R4XA 4XIKA 5KXEA 2Z69A 2Q30A 1TNFA 1H2LA 1ZZ6A 4LULA 2XMLA 2XG3A 3LAGA 2J1SA 3MO4A 5FUPA 2IC1A 4YRDA 1EV12 1UX7A 5F6LB 1MEC1 5L9RA 3RYPA 3WY6A 3MGUA 4KWUA 2ZX1A 2DCKA 5F3GA 1OF3A 3ME2A 5JR2A 3OEAA 4FPGA 1GOHA 5DZEA 5FZKA 2B42B 3U07A 1GP5A 4MYEA 4CDXA 1PGL2 1VALA 4AF9A 4D6QA 3RVHA 4DRRA 1APNA 1Q3EA 2BGPA 2PLV1 3OY8A 3RQ0A 5C6CA 5HV4A 4K1ZA 2PAMA 1OLME 5FO9B 4IUGA 2PQQA 4LBKA 3CJXA 3NSTA 1DLLA 3LCPA 1RHI2 1I9RA 2PHXA 5JXJA 3R4DB 4Q0QA 2E51A 2GMEA 3NJYA 4INDA 4MH0E 5C4WA 2MEV2 4UBHA 1JZ8A 3I3DA 3MW3A 1ZRDA 2OPWA 4Q27A 1C28A 1VBA2 2WZPP 3AB0A 5SV5A 1HIXA 5IVFA 2X8KA 5EYXA 2WQ8A 4MSVA 4MGQA 4OI4A 1NXD1 1N47A 2IZWA 4JCKA 3OUIA 1CX1A 3NW4A 2E7QA 2D3RA 2TEPA 4NAMA 1X33A 1NY71 4I3PA 4IEOA 5E8AA 5FXXA 2WFPA 4PDWC 4WM8C 3P3NA 4YG0A 1LGCA 4RS5C 2GNTA 5FZ4A 3VD4A 3JB8A 4ATFA 4XPVA 4NMIA 1WMXA 1REDA 4LIUA 3HOBA 4QPGA 2JG8B 3E5QA 1DQ0A 1U5ZA 3GCWA 3AL5A 3VBOB 1IZ3A 4OCTA 4KU8A 5T5PA 2OZ6A 2WC2A 3TYJA 1CZTA 1AJOA 1YO8A 4W6YA 4ZXKA 1GWKA 2YHJA 2QUOA 1PK6A 2J42A 1SCSA 3THPA 1WD3A 2JDYA 2FDIA 2QQOA 4MGIE 3RZKA 1SLTA 4N7UA 2ZA9A 3HNMA 5IT6A 2W1WA 1F4AA 4S2FA 4GH4A 4IEQA 5M0TA 5EQUA 2YFZA 5CFCC 3AMPA 4DINB 5I8YA 2BVBA 4BB3A 4UWDA 5LA1A 3WG2A 1NQJA 2HEVF 1IHMA 3ZFFC 1U12A 1J3RA 4CCLA 3IDEA 4LITA 2K2SA 5C3PA 3WF0A 1LHNA 3PIGA 3POIA 3SNMA 1K5MC 1LJ7A 4K8FA 5F1RA 4RHV2 4QPWA 1ZBA1 4XMIA 1RYYA 3DKWA 5BNQA 2WSUA 1O8PA 5K4LA 1OA2A 2WDBA 3RPQA 2AC1A 2QJVA 5FMOL 1IS3A 3GJAA 2RS52 4ASMB 1ZA4A 5C9AC 4DO0A 1ZBE3 4P9YA 4UT5A 4CDUB 1G9FA 1O5UA 2GH8A 2UYAA 3MUY1 3G6JB 2NYYA 4B7EA 3JD73 5JCTA 2GNBA 5FCCA 3WVJA 3RSJA 3RZHA 1UZWA 4XDQA 4TSVA 4HT1T 1OFSA 3JCIA 4HVQA 2VUJA 3AMNA 3LGRA 2B8MA 4UFJA 4BA6A 1RUH3 4AHXA 3LA7A 5FYMA 3HBZA 4YVSA 1W99A 2JE8A 4AFBA 1JN2P 1DYPA 2G4IA 3A4UA 3POYA 4XUNA 4M3CB 5F2SA 3WCRA 2BNMA 3VBHB 3LEKA 3L2YA 5A3OA 4XBNA 1FMD3 3PNAA 3N7JA 3THTA 3WDUA 4M0HA 5CFCB 2RS33 2NPIA 4WV8A 3WF2A 1F15A 5F5AA 5J36A 3RMYA 1C8M1 2AENA 3D5OA 4YW5A 3IBMA 3NV3A 3OB8A 1VAVA 1UD1A 1ZRFA 3KGZA 2H6BA 5CKQA 3R0RA 4AQ2A 2JX9A 3U1XA 5I0RA 2DTWA 5FMDA 5A7PA 3O1SA 2JG8A 4U36A 5IWFA 3VBHA 3ETQA 3FC0A 2EIGA 2D7FA 3I3EA 5JUVA 2VZRA 4Y1ZA 4JGZA 4UAPA 1WW4A 3K48A 4W4ZA 4Q4W2 1PZ9A 3TAYA 3CL1A 4XABA 1GBGA 4CXYA 4BMBA 1EAH1 2QNKA 2HLEA 2Q1MA 2B9VA 2FCUA 2WWJA 2VMDA 4RQPB 2ZZQA 1JUHA 3WSOA 4LKSA 4CXXA 2JE7A 4A41A 1JOBA 1H4GA 3MIBA 4D8MA 3PUQA 4I0WB 4BIOA 2A71A 3FX3A 2W39A 1PK6C 2VZ3A 2P1BA 1AYM2 1S0JA 3CZJA 3EJKA 1LKNA 1Q8QA 1C5IA 2I74A 4E4HA 5KHGA 1WCSA 4RL7A 1GSLA 5JIAA 4AI8A 1UAIA 1O5LA 1W06A 5FO7B 2HWF2 1PVC2 2YBPA 2B39A 1ENRA 2W08A 3B9IA 1C8M3 3PMEA 3ZYHA 4B7KA 4E2GA 5L36A 3VD7A 5A33A 3H8XA 3RZMA 2Q0AA 4O7XA 3I59B 2Z79A 5FZEA 2JDZA 4F7ZA 1CAXA 1IG0A 1LOGA 2E6VA 1V0AA 5J3UA 4NHYA 1O4ZA 3UESA 4CDQB 2A70A 2JG9B 2UYBA 3IMNA 3POSA 3N3HA 2ORXA 1TVGA 4QXKA 3VZMA 5AVPA 2HKXA 5FY8A 4LEJA 3FHQA 4DMIA 3DPRC 5JZGA 2P3JA 3FUQA 1RL3A 4KWKA 1NKGA 4YSFA 5C9AA 2XUEA 1FXZA 1XBFA 1W39A 3S0MA 1JYTA 1DHKB 1NE4A 3DXUA 1DBNA 1HRI3 2J1VA 2JICA 4Y4RA 4OQ8A 4LK7A 1O3SA 4E4SA 4SLIA 4BQ3A 2JD4A 4LHNA 2ZAHA 4NRPA 5A7OA 2ZTNA 3PIJA 3SKVA 4HANA 2JDHA 4LE3A 4NE9A 3HN3A 1XYNA 1DQ2A 3POFA 5T52A 1W9SA 4BQ1A 4LO8A 1XE7A 5LASA 1C8M2 4M4PA 4WBBA 4A6SA 4BQ5A 5FZ8A 3WDVA 4AGVA 4C1WA 5J7MA 2RR13 1RUD1 4ZONA 5BUVA 2VR4A 1JHJA 2QQWA 1WKYA 1DGLA 1VMFA 3B94A 3DGTA 3DL3A 2PHLA 3GDBA 5DDJ3 4YVSC 2GN3A 2VOXA 3EO6A 1AR72 1RUJ2 4FOYA 4QWNA 1WBLA 1TNRA 1RUC1 1VMHA 4KMQA 2N7GA 4Q0PA 4BQ4A 2ZHNA 3RZGA 4HVOA 5HXVA 1ZREA 1OSGA 2ZZJA 1HW5A 5IK5A 4V2WA 3BPZA 3IDAA 4AL9A 1DZRA 4CUGA 4XMAA 3OGSA 5FUIA 1CD3G 2F6BA 5T50A 4OQ9A 3LKJA 3VHRA 2DU0A 2ZPXA 3ZKUA 3UNPA 4Z92B 4Q8KA 4AVBA 5FYTA 5J96B 1DYKA 1OOPB 3CDZB 3INAA 4A7ZA 2WWSA 1AJKA 5EJ1B 5H9RA 1OA4A 1K5JA 3WQ7A 4HK8A 1MS4A 4H7MA 4XFHA 1SBEA 3D4KA 4UFLA 2XPJA 3OG2A 5A33B 2R30A 5HI0A 2GALA 3GBWA 4L97A 2I07B 5A7NA 3OPZA 2K9ZA 4KL1A 4J1XA 1NCRC 1W9TA 2OQ6A 1TG7A 1WLWA 2VOVA 4OZXA 4QX8A 3WEZA 1R081 1YQ6A 3HNBM 2XVKA 3VV1A 1IOAA 5CB7A 4QQLA 2ZGUA 2NZ9A 5CZKA 2XHKA 3WT3A 5FDBA 3N7KA 4HSLA 4NOTA 4W50A 2EAKA 1KITA 4GKXA 1CJPA 3VBRA 4DPNA 5C9AB 2OUJA 1BLZA 3LSEA 3ZXEA 4QPIC 1YFXA 2J1UA 1IKQA 1UU5A 2ZHMA 1U5YA 4IV3A 4G9SB 4P9GA 3T30A 1CAWB 4FTEA 4BK4A 1W05A 4MVTA 1H9PA 1AR93 4P9WA 4WM7C 1QH6A 4YW3A 3WCSA 2H6CA 2HWE2 1S0IA 4K20A 2RMU2 3WNLA 4D0QA 4NPMA 5A7WB 5J98B 5L7OC 5BNNB 1YC61 4B29A 5LA0A 3GZTB 3NL1A 1DYOA 3JZVA 3OYWA 5FZFA 5IVVA 2RJ2A 3N9NA 1N3OA 5KHIA 3ITQA 2KM2A 3J4UH 3LB9A 3NJVA 1QU0A 4GULA 3NNJA 1AVBA 4Z2WA 1DQ6A 2F4LA 2HWE1 3LA2A 3OBRA 4AQTA 5FAXA 1X7NA 3ABZA 2R073 1FMD2 3NMBA 2W9XA 2X5IC 2X5IB 1A34A 3H3LA 1BBT2 4NRQA 3V0AB 3ZYJB 1W6QA 4MXVA 5JLVA 2YBSA 3NV4A 2WJSA 4NHKA 4XFAA 4YVWC 5IW0A 1UX6A 4XZPA 2JG8C 4AEDA 3VBHC 3AYCA 4YFZA 1JYNA 3SH5A 2P37A 1QKQA 5FPLA 3CJIC 3KS7A 3PVEA 3WW3A 5K8SA 1CGPA 1NAEA 2A73B 5FZBA 4IEWA 1H8TC 4HLTA 4OUMA 4AR2A 4JRLA 4KG8A 1NA1B 2R1BA 2R16A 2JB4A 1A78A 3SH4A 4PI0A 2ILMA 4P9LA 2IWGB 2AREA 2WINB 5A32A 3I2GA 3CNAA 2OVUA 5FYSA 2ENRA 1FV2A 3ZM8A 1US2A 4PQ9A 4CE8A 1XOYA 1MZ6A 1POV0 2R072 2WS92 4BH9A 1RUD3 1GV9A 3CQOA 3WDWA 2WO3A 4PBOA 3BN6A 4BMEA 5FQ0A 3P3PA 3VDDC 4CCDA 1VBD2 3WNPA 3F95A 3N4MA 2HBUA 1R082 3CKHA 1X36A 1CAUB 3AXDA 1UWWA 2XQXA 4IERA 3MIEA 3GZAA 5JAXA 3W9AA 3M3CA 1V6NA 2ZHKA 4GB33 4URAA 1NG0A 1IKPA 1NYWA 4MLOA 5J09A 2FBEA 1BK0A 2QQUA 4OHWA 5FXZA 2VMIA 3B3QE 5CADA 2G19A 2KXLA 3I2JA 5A80A 1COV1 1C3HA 5JOYA 3MHZA 4EWEA 1JYIA 3OF1A 2CU5A 5A3TA 1PO21 1AR83 1EV11 2R6QA 3I3QA 2PHTA 3PTRB 3O7OA 4JAAA 1DFQA 2VM9A 3AC0A 2OA2A 4NHXA 3CO2A 1RUG2 2FMYA 1I5ZA 4NROA 1AYM3 4GB31 4IGOA 2OKXA 1RJ7A 3JBG2 3NVCA 3K4AA 3B93A 1AXZA 2PAEA 4BQWA 1PGL1 1CQ9A 4HKOA 3VBOC 1QOTA 1U5IA 1H2KA 2EA7A 4DZGA 5HCAA 2J7MA 1H1AA 2E7AA 4QKDA 2FMDA 3C8XA 1N1YA 1QIQA 3G7DA 4Q4V2 5EXOA 4DB5A 1W8UA 1NA1A 1CIWA 5LY2A 2BPA2 1QJFA 2GMPA 2ZGOA 4EV0A 3Q8EA 5I93A 5FZMA 1VBD3 5DG2A 3H42B 3FBYA 1NCQA 5D2AA 3FLPA 3OJBA 4JVAA 4K3UA 4CP9B 3O1VA 1W3VA 2E7TA 4UFHA 1NQDA 4HPKA 4ONUA 3PVBB 2JWPA 4F83A 3QLQA 1PO11 5E1RA 4A7YA 4Y1XA 2DCZA 1H8TB 3PURA 4AE2A 1A8DA 4BHPA 1SG3A 2ZBJA 3N7LA 2H0BA 5FYYA 3A0KA 5C4WC 1QJX1 4EWDA 4BZ4A 1W8ZA 3FMGA 1RTVA 5FPUA 3D0SA 1DG6A 1UCXA 3EMRA 4FQZA 2BERA 4R9AA 5A1FA 1CR7A 4PHZA 1CAVB 5GALA 2V72A 3USUB 3FL7A 4FTSA 2CWMA 2RS11 2IXLA 3LQCA 5C8CA 2W46A 3RS6A 3CHXA 4LHLA 2VH9A 2Y64A 1M06G 5DDJ2 2XUMA 1VP6A 1YEWA 3VDDB 2VE1A 3HVDA 2Q1ZB 1CAXB 4K9SA 3DXTA 1LNSA 1UZYA 2VZOA 3H8RA 1LOCA 3BTYA 1FOD3 3AKPA 3T08A 3VBRC 3E6DA 3AJZA 5DQ0A 1G9CA 3LOBA 4YZ2A 3AFKA 2A75A 3THDA 3MPPG 4D6RA 1RUH1 1ZBE2 4JC1A 3C7OA 1KFUL 2V09A 3GHNA 2KR2A 4IEUA 3VDDA 3WP3A 5KWRA 2FDKA 2DVDA 1XNCA 2VZSA 1RVF1 2DVBA 1PO22 3CU7A 3LD8A 3BIWE 4A6OA 3T2QA 4QKNA 1MS1A 4D7SA 2PA7A 1UNBA 5T55A 5JXHA 1IS6A 3VBFA 5GM0A 4QXBA 1G7YA 4BDVB 5JPMB 3VBFB 2NMNA 5KHKA 1V6JA 1S0FA 3WW4A 4TYSA 1ZRIA 5BV6A 1W6QB 2QQIA 4ZU7A 1GOFA 4AZZA 3MF9A 3N9LA 1RUE3 4NAOA 2DURA 4XAAA 3I49A 4LKDA 1GZTA 1RMU2 3WW2A 2WA3A 1G9AA 3AP9A 4TTGA 1GZWB 4P00B 3WHTA 3WNNA 5B4NA 2DV9A 2PHRA 2JDPA 1OUXA 3BI3A 3I2IA 5FPVA 1HRV3 1TME1 2YBKA 4LBNA 1QF3A 2Z42A 5FRAA 5H9QA 3WQBA 5K0UC 2OPKA 2RR12 2D97A 5C4WB 2C24A 2DVAA 2UY9A 1FI2A 3IIAA 2IFRA 4KH9A 3ENRA 2E32A 4XQWA 2Q8CA 5EYYA 2YDEA 5A1AA 1JZ2A 5LK7B 5BY5A 3SHRA 1OA3A 1VB2A 1ULEA 1VAKA 2Y26A 2BYVE 5C8CB 2LTNA 5L7OB 4PDWA 2VOWA 3ELNA 5FZ1A 2R061 1VE0A 3ZYBA 3CF6E 3K46A 1HQWA 1UMZA 4HG6B 3PU8A 1O6UA 4D7TA 4KGQA 3VD5A 5IK8A 1ZNPA 1V9U1 4KQ7A 3AZWA 4AAXA 1WW5A 2BBVA 2Y6LA 1KDMA 1WLTA 5DZGA 1AXKA 3TWIA 2CDOA 2R7EB 4YZ5A 1JZ7A 3PMSA 1SBFA 2BOJA 3VHNA 1OH3A 1OD3A 3NQHA 2DVGA 4CEWA 1W9FA 5C8CC 3GXUA 3HBKA 1G86A 4MGSA 2QKDA 2K46A 1RMU1 1GQGA 1SZBA 5G05L 2A6WA 1X82A 3K51A 2OW4A 2D3PA 1V6MA 1EAH2 2CAVA 2RVAA 2BBAA 2UWBA 2V4AA 4P14A 5AC92 2BNNA 3DYMA 3A21A 1OC1A 3NKTA 4XDPA 5LK5A 1QXRA 3ZFFA 2IVJA 3MEPA 3OYWB 4GA9A 3ZPOA 1AYM1 2DCYA 5FBZA 3OOXA 1QJY1 1VLNA 4C91A 5FYZA 1TMF1 5KBFA 4ZS3A 2YPDA 1ZYBA 1JBCA 4FPYA 5L19A 1PMJX 1LU2A 1QOOA 3AMMA 3D0JA 3NRUA 5FY7A 4IV1C 3SCFA 3N9QA 4I2OA 3AKRA 4C0BA 1D4VB 1UYXA 3SXWA 1S0DA 4IEZA 2B4KA 4DOUA 1UKGA 3ZSEA 1DGWA 4BQXA 4NRMA 4FPLA 1ULCA 1LHWA 1G9BA 3H7JA 1Q8PA 5IVCA 4WZCA 4H55A 5BNOA 4ZHNA 3ZFEA 4XZUG 1ND3A 1ULDA 3ZXJA 2D98A 3M4FA 2BOIA 1CZVA 1E57A 3ES4A 3O14A 1RGSA 1I5PA 3BALA 4OMDA 5FJKA 2WYFA 4LA3A 1UY0A 2MEV1 3KLSA 1VBE3 1QXJA 1DDLA 3I2DA 4LO5B 1D4M1 5B2GB 4LPLA 2WZR1 1V70A 1WCQA 1VMJA 3KGLA 2ZGQA 1YXWA 3SEPA 5ISLA 3OGJA 1S55A 1G9DA 3CJIB 4W6XA 5SV8A 2VPVA 4COVA 4WZFA 1O59A 2JDUA 4QX3A 3LDBA 5D21A 2RS13 4XJZA 1CONA 1YCIA 4Q4X3 5EFUA 4QQHA 1ULFA 1OI6A 2XJSA 5LEJA 4RGKA 4AW7A 3KVBA 1OUSA 4FP2A 2J1RA 4RN5A 2VOKA 1RUF3 3NV1A 4RD7A 2PHUA 2HBTA 2UURA 1EY2A 5CU1A 1SLBA 4BK5A 2Y8KA 1TME3 2QZ3A 3LFMA 5JMOA 2Y6HA 5H9PA 4Q26A 1I6XA 3ZPYA 2BDRA 3GZUC 4ARYA 4WVMA 1W2UA 2BWCA 2RM23 3N7MA 4CDXC 1AYN1 2WRAA 5GLZA 1LOAA 4CCOA 4RR3A 1I1EA 1COV3 3FJSA 5C8WA 1LENA 4RQPC 2WT2A 3HJRA 1RC6A 2A1XA 2WZR2 2ZKNA 4MGYE 3V0AA 1A8MA 1BVP1 3RWKX 4Z07A 2WAOA 4CCJA 2ZKLA 4EROA 1ZZ9A 3LSDA 4CDXB 3BIEA 1PX4A 3WG3A 5IHRA 4ZPIA 3OEBA 4R8HA 1JYCA 3I2HA 4XFBA 3ALQA 1BHGA 3OBZA 3HPNA 2ZEYA 2DBNA 1DU3D 2Z5WA 4AEMA 1UIKA 2J1AA 5D1IA 1QJZA 2L9LA 4HZFA 5CBLA 4K1YA 5JWPA 4MXWB 1RUF2 2GNMA 4K21A 2HWC2 2WN3A 2R32A 4Y4YA 1VBA1 1DF0A 5I0UA 3ZYPA 5AC93 1C1FA 3DCQA 2ARCA 1FAYA 2O1QA 3OSDA 4FPOB 3ORJA 1XU1A 5FPAA 2PELA 3WG1A 4AEJA 1STMA 2LROA 2XLGA 4Q4V3 3M3EA 2UWAA 3ZMOA 4XDOA 2ZGMA 5A3NA 1JYXA 3SCGA 2D43A 4XYXA 2ZMLA 3HWJA 1DGWX 4FOVA 4QQ2A 4HN1A 3VHPA 2VULA 1ASJ1 2VBDA 4I01A 1YQ2A 2FZ2A 4FPEA 5FZOB 4CPBA 1OH4A 4DEVA 3HIFA 3ES1A 2WO2A 5JXIA 1SLAA 4XHXA 1YFUA 3U37A 2LS6A 5E88A 4UI9L 1ZZ7A 4PIXA 3MI8A 2HEYF 1OOPA 1VRH3 2H0VA 2XJTA 3M3QA 3T2PA 3VZJA 3LFIA 4JTOA 4CPBD 2R063 3P1IA 3FUOA 3UGGA 3AKTA 3VGIA 4YNIA 2NN8A 2JDKA 1BK1A 3C7HA 4AI3A 1NLRA 4XXPA 2VQUA 1UQXA 1S0CA 4WVZA 3GJBA 4OI1A 5A70A 3K3OA 3GYDA 2DF7A 1PM4A 2W68A 2CHHA 1J3PA 3E97A 3IAQA 3ZSKA 4A44A 1IPSA 1HRV1 3H0OA 1VBC2 2CV6A 2VZ1A 3WXPA 4AI0A 1JTZX 1QJU2 4M3CE 4CXWA 4WM8A 1SDDB 5LA9A 5EPAA 5FQ0B 3IPVA 4FXGB 1X9TA 1R1A2 2ARXA 3DYOA 1SLCA 3P5BA 2RMU3 1VR3A 3J8F3 3H1WA 4QPGC 1LOEA 3FWEA 1W6NA 2ZX2A 4IW3A 4HKLA 1Z7S3 5G04L 1RUI2 4IEYA 5DUUA 4EZHA 5KXBA 3T4HB 4MX3A 2HWB2 1POQA 1HJFA 1XYPA 3BB6A 3NNLA 3R4UA 1OLQA 5JZGB 4AG4A 2AACA 2D6PA 4I0AA 5I0DA 3KT1A 1MQTB 3ON7A 2XKPA 1LOBA 1CN1A 4CU6A 3AKQA 3ZYFA 2EXKA 3S7IA 5ACA3 4WM7A 3WQ1A 1KD7A 2QZ2A 5JDBA 3FHAA 1JMUB 1EP0A 2A3XA 4NWVA 4KU7A 4PJYA 5A3MA 1ND2C 2HWD2 3MDPA 2WWUA 1KGYA 3TB0A 3QBQA 4CCMA 5CKNA 3FHIB 4JKLA 1S2EA 2BFUS 2BGOA 3ZIWA 1MZEA 4A4AA 1C1LA 3RRDA 5JVVA 2P5BA 3WF1A 2WLQA 3W5MA 3U10A 2OS2A 2TBVA 4CDWC 1OF4A 1K5MA 4OFGA 4XURA 5LZ6A 2YMZA 4Y5SA 2JEMA 5FPZA 1CWPA 1F5JA 2ZGTA 3H50A 4AVTA 5GZFA 4OHVA 5DDJ1 2VECA 5FY9A 5LBCA 4M00A 5DAQA 2LRPA 3LEIA 2MEV3 2WBKA 4HK9A 3AXEA 4DS0A 3HT1A 4A2UA 3RG0A 2W1QA 4AEDC 2HWF1 2GDFA 5A6ZA 1LODA 1PNFA 2ID4A 2Z2SB 1AR71 1RUJ1 4WVMB 5FYBA 4R9BA 2FDGA 2D5FA 2GNDA 1K42A 3PL0A 2W2IA 4LUKA 1ZBE1 1W2AX 3ZR5A 1DLCA 5FYCA 1H9WA 1LEMA 5L9VA 5FYHA 2Q5TA 1GQHA 2W3JA 4N8MA 1TME2 2ZABA 4QQPA 4FO9A 3B01A 4ET7A 5EZWA 4XBLA 5A7QA 1NCQC 4IL7A 5F5CA 3CEWA 4L92A 1CJDA 1W0OA 2OZJA 3VDBA 5HCHA 3HMYA 2D40A 4ISQA 2VAUA 1WA4A 1QEXA 2ZACA 5FYVA 5BNOB 3Q8FA 1WZXA 5TSWA 1PVC1 1COV2 5F6KA 4CRQA 2ZMKA 2WUHA 4CEYA 4JKMA 4M3CA 2WFF3 4XFCA 4BJ0A 1AR82 2AYHA 3RZJA 1V9U2 2V5YA 3LPGA 3I54A 4YLZA 1PGSA 1YFWA 5DUVA 5E6HA 3VDCA 1O8SA 3R6SA 3J7HA 1M4WA 3NKGA 4FI9A 2FCVA 2W92A 4AYUA 1NCRB 1PIV1 1ST8A 4IEVA 4QX0A 2Y6JA 3TN93 1IGOA 3OPWA 5C3OA 1QQP3 4Y5TA 3WW1A 4DFSA 3EXUA 1F9KA 3MV01 3WR0A 3C7FA 4UW5A 4FSJA 2JECA 1R083 3T2TA 3MIGA 2FDJA 3POEA 4MG2A 1F8VA 1OVPA 4MV2A 2D6KA 2WZR3 1VBD1 4FFGA 2XJPA 5A6QA 3NNGA 2RS32 1SHWB 4UOJA 5A3WA 3E5UA 4BQ2A 4E4DX 2W95A 5FWJA 4YGBA 4Q0VA 1HB2A 1Q43A 1UY4A 3USSA 5FPXA 1Q8SA 4K6BA 2O14A 2A5ZA 2RDSA 2WO7A 3OY8B 3WP5A 4GIQA 1S0BA 1QWRA 4HPKB 1H1IA 2Y60A 3H3ZA 1OPMA 1UL9A 1RUC2 5EJZB 4N9IA 4JZRA 5IVYA 3VZLA 5I91A 4Z82A 5FK7A 4OMCA 2WNOA 2DCTA 1QJEA 1QJX3 1JXNA 3VBFC 1RINA 4QM8A 4XEZA 4CYDA 4DY5A 2GN7A 5J1XA 3VZKA 5IK4A 1C57A 3D82A 3URFA 2BVVA 3WV6A 1N3PA 4AFCA 3PUAA 1OXCA 1MS5A 4IETA 1HRI2 1LOFA 1UYPA 1UOFA 3NAPA 4O61A 3T4VA 4CDWA 3S57A 3PLQA 2WQZC 4XOGA 2WZEA 1V6LA 2WKKA 4LBJA 5LY1A 2E9QA 1WCUA 3MBWA 1UIJA 3KQRA 3UETA 1NY72 3L2HA 2HJIA 3CLPA 4W6WA 1BBT3 2W5FA 4AQSA 4DXRA 2XBO1 4QD2A 5K0UA 4CP0A 1GZ9A 1FATA 1JZ5A 4JGYA 5FPBA 2GU9A 2CGPA 2XHNA 3SITA 1OD5A 4UF0B 4Q5OA 5JOXA 4QX7A 3WNMA 4CSWA 1WCDJ 2A3YA 2ET7A 1GR3A 3BTZA 2C1FA 1LHOA 3U75A 2XVLA 2JG9C 5IYYA 1PMHX 1XU2A 2XXZA 3ST7A 4E9KA 1P8JA 2Y6KA 4GAZA 3UKVA 5CYYA 5HV0A 2VQAA 2PHWA 4LBMA 1FT9A 1PVC3 1OLMA 5FLJA 4WVWA 1HXS2 2C4XA 4ASLA 1QJU3 4ZKTB 5AFEA 1B35A 1J3QA 1XXNA 3T0BA 3TEYA 4CCKA 1WBFA 2PTMA 3T0DA 4ZXEA 2PFWA 3HT2A 4GH4B 1SBDA 2PLV3 5FLHA 3PVNA 5FZOA 3WQ0A 5CEHA 4JQTA 3LOIA 1QJX2 1J58A 4R4ZA 3TNPB 3IAPA 4RYDA 2WNUA 2VTXA 5LA2A 3UGFA 1YFYA 3GALA 1Q5OA 1OBNA 2DWRA 4NN0A 3ZFGC 4LXLA 2JENA 2ZGRA 1GLHA 3B02A 1UY2A 4DXZA 1W9WA 5JSPA 1EUUA 1W6OA 2QCSB 4RR3B 1VIWB 4N43C 4RHV1 3ZSMA 2VMCA 4XUTA 4XC9A 1LRHA 1ND2A 1WWYA 4GWJA 3IDCB 4BM8A 5IATA 1ND2B 2ZMNA 2WN2A 1EPWA 3NJXA 4B1LA 2RHPA 2VBBA 1FX5A 3BU7A 1KS4A 5JSRA 1XNKA 3AP7A 3K75B 5EWSA 1MS3A 3FFZA 3U11A 1CPNA 1RXGA 1VBE2 3LIGA 3GCXA 3I3BA 4HSJA 4XF1A 3VBUA 1JODA 4IEPA 2A3WA 4QB2A 5A3PA 2ZX4A 2VUAA 1V6IA 1VRBA 4COZA 1UW8A 1GMMA 5IVBA 1UXZA 2BRTA 2RDNA 2HYKA 5FYIA 4YZ1A 2A6XA 3VKLA 1KQRA 4ZZ8A 5FY5A 2DCJA 4LK6A 2RV9A 3IMMA 3OUJA 1ZRCA 4E27A 1BXHA 4HBNA 1FPN2 5KXDA 3B69A 1PZ7A 3FFQA 4NPRA 4DXSA 2HWD1 2PXJA 3TOJA 1KDKA 1MPXA 1W0PA 2CDPA 2FHRA 4B4RA 1KRIA 2NMOA 3D3AA 4KG0A 3IPVB 1HRI1 1W03A 3M1HA 2VZPA 2YUEA 1VRH2 3V65A 5F9TA 5FMOS 3JD71 4GMP0 4LIVA 3ZYIB 4AVAA 5C70A 3MF6A 2X09A 5D8AC 1O3TA 2OT7A 5JI9A 3A23A 4XUPA 2A6VA 4M0NA 4P9JA 3MLLA 4QX2A 4YGEA 5DZFA 1LR5A 4AFAA 1TQ5A 1UOGA 5FZAA 1O3QA 2RG4A 1WMEA 5FXWA 4WM7B 5JR7B 4FPJA 3RZLA 1N1TA 4AFMA 1Y9QA 3H9AA 2RR11 2RJLA 3POGA 5T5LA 1VBE1 2O0OA 1PIV3 1QJY3 3ECQA 2WSVA 3TN91 2DU1A 1R1ZA 4HKWA 2AZ5A 2VBPA 1PK6B 4NHLA 1XRUA 3I3MA 4FXKB 4YW7A 1R091 3VL9A 1JW6A 2ZGLA 1PZ8A 1HN1A 1SQ4A 2YY1A 3PDQA 5FZ7A 1H0BA 1YHFA 1ZM1A 4FQ4A 1E5SA 2VMEA 4UBGA 3VBOA 1ZZCA 2ORZA 4QM9A 5GLVA 1AR62 4TXWA 2Y33A 4O9EA 5FMCA 3VKFC 5FFOC 2D6MA 5FY4A 1H6YA 5JI7A 4BLIA 4IXLA 4LBLA 1NA1C 2QQVA 4CP1A 4XHBA 4XQ4A 1OURA 3IZOA 1IPKA 3ACIA 1UY3A 3AX4A 2XLAA 3ZFFB 3KCYA 4D6SA 3PJYA 2VW2A 1OT5A 4C0HA 5ACA2 2Z4FA 1H6XA 5BNPB 4ZU5A 3VZOA 3M7AA 4O65A 1U5XA 2RE9A 1HN0A 2UWCA 4LO7A 2XDVA 4RQPA 4YM0A 3TBDA 4V1PA 2DUQA 1WMDA 2GC1A 2VG9A 2XKOA 5LBFA 2MPFA 2WFF2 1MZ5A 2F17A 5KHHA 1F5FA 2QQLA 3CIHA 4HMZA 5ERLA 5FOJB 1DQ1A 3EYPA 1D2SA 1F31A 3BTAA 3WF3A 1XC6A 1JS9A 4CDQA 2BJSA 1GNHA 4LQRA 4Q0UA 1QJY2 4FFHA 4JHTA 1EYBA 2R1DA 2SLIA 3BCWA 4TLGA 2DVFA 1UN1A 3DF0A 5FKBA 2RS51 3AMQA 1RHI1 4RS5B 4FP3A 1BKZA 4IGQA 1AXYA 2R0FA 3MFAA 1AR61 2VNVA 3KCCA 4AXOA 3LEMA 5LBBA 3VBSC 5EJ3A 4UYBA 4FAHA 2G9GA 1H2NA 1EV13 4DY3A 2QE3A 4MOAA 2IXHA 4XF3A 1H30A 3E5XA 4AHZA 3KSCA 5DAVA 3VKNA 2ES3A 4AI1A 4M01A 1CZSA 5DG1A 4CEYB 2QQNA 5J48A 1S0EA 1VBB1 2IXJA 4QHOA 2WS91 1DCSA 4XCAA 1L3JA 3DUIA 2LM3A 2YROA 3EQEA 4G3YC 4B8EA 4LO4B 4DUVA 3B9CA 1PGW1 2B9UA 1NXMA 4FFIA 4XXAA 4CZSA 2Q8DA 3KCXA 4Y1UA 1FNZA 2W52A 3VZNA 1W8FA 4LKEA 1YNAA 3ZXDA 3UL2A 2AGSA 5LWBA 1OOPC 2Y6GA 3VLBB 1W6OB 3AFGA 3DN7A 5FTTC 1TMF3 2CGNA 3T09A 4DRVA 1OKQA 1XE0A 2J22A 4Q29A 3M3IA 5I0TA 1JHNA 4CP2A 4OULA 4DIQA 1QJU1 2C9AA 1ENQA 4TN7A 4O9GA 4Q4Y3 2YPJA 4ARXA 2J1EA 2HWC3 4UF0A 3GF6A 4NR1A 1QQP2 3O1TA 1RB8G 1REEA 1NLSA 1RIRA 3UJQA 1ZX5A 1Y9MA 2EXHA 1XB9A 2ZHLA 4Q4X1 1JH5A 1VBB2 1WUVA 4YM1A 2D6OX 3QOPA 3KHCA 4Y1VA 3ACFA 2VC9A 4WM8B 2OIIA 4Q4W3 4N53A 1PGW2 1DGRN 1UU4A 5FV3A 1FV3A 1GYKA 5FUNA 5ABJA 2RDRA 1PO23 1PVXA 1UOJA 4H7LA 3R05A 1UMIA 1AYN3 3UYJA 3GBGA 3WP4A 1HKDA 1CX4A 4IEXA 5CNAA 1ND3B 3QH6A 4XIOA 2EXIA 2YC0A 4C1XA 3DPRB 1GU3A 1H4HA 1SCRA 1QOSA 2WO1A 3BYWA 3KZ4C 3AP6A 1MACA 3QCWA 1MZFA 4N7IA 1MEC2 3OBTA 5DAXA 3GBFA 4FBFA 1MQTA 1ULPA 4LA2A 3K3NA 3DYPA 4RSUA 5FP8A 3ZXKA 4YARA 1YI9A 3KM5A 4CDQC 1LGBA 1ZRRA 1RMU3 2GP5A 3LF7A 4M4RA 1Q8VA 1XNTA 1CAVA 4XJAA 1BEV2 5IK7A 1VBB3 1BBT1 2E33A 3K77A 5IVJA 1QXPA 1Y3TA 4FOQA 3AZZA 3U0ZA 4YWAA 2YU2A 2ZEXA 1T6BX 5LEKA 5I8SA 2JB8A 3PUHA 2VZUA 4ITCA 2FCTA 2OQ7A 3RJ2X 3IM0A 5CAZA 4D7YA 1OQ1A 4YG6A 3Q8CA 4AAPA 5F39A 1S2BA 3NV2A 4QB1A 2NP0A 2Q8OA 1RHI3 5DMYA 3AZVA 2EAAA 2NM1A 4IV1A 2ZAAA 3WNXA 4CTEA 2EIDA 5CG9A 4QPIA 4AWDA 1RUI1 1MEC3 5DAPA 2V5DA 3OTFA 3PVOA 2KD7A 5T5OA 3ZIXA 3H8OA 1LB2A 4IE0A 1AYN2 3PTYA 4ORFA 3S5QA 4E2QA 3W21A 2WT1A 2BGCA 4XFFA 3ZR6A 1OLRA 4XJUA 3PU3A 4FPCA 3ACLA 1Q8OA 4FCAA 3ILFA 3T0AA 1TE1B 3SMHA 1VAMA 4BYYA 2XL9A 3VKMA 1ONAA 1SLLA 3V64A 4AVSA 5IFPA 1JYVA 4BOWA 4Q4Y1 2VZTA 3ZO0B 4AFDA 2PAKA 2GP3A 5F8PA 2WT0A 4MGTA 2JD9A 4IDZA 4Q2FA 1EAH3 4XTMA 1GP6A 4JDNA 3AP4A 1HB3A 1XSRA 2XLFA 2BEOA 3RJRA 1GFF2 4FVVA 1BMV1 2ZX3A 1W8NA 4YW1A 1NZIA 1AX2A 2BWAA 3KB5A 2C6SA 4HETA 2YG0A 4JHZA 1AZDA 2CAUA 2K0GA 2PMWB 3KMHA 4FOWA 4LLOA 3ZFGB 4CEWB 4CEWC 1L7RA 5BXXA 4J1WA 3S5AA 4XJ9A 1HXS1 3KT7A 1XYOA 5FZ0A 1UKRA 2AH2A 4EZ4A 2VCMA 4YGDA 3ZVXA 4NIDA 4OI0A 4LOTA 1UO9A 5A6XA 1VPHA 2W47A 3LE0A 3S7EA 1K45A 1BJQA 4L0PA 1W28A 3BUCA 3HQRA 3AP5A 2O8QA 3LWCA 4L8QA 4P5HA 1LGNA 4Y22A 5ACA1 3CBNA 4PDWB 4HONA 1HLCA 2D6NA 4CA9A 1J84A 4I0BA 2Y0IA 3LPFA 4DUXA 1HB4A 2EIBA 1ZBA2 3ZXGA 3M70A 2HWB1 3PHMA 4PIYA 3VBSA 4IQPA 5IVEA 4L2NA 1B35C 3WDTA 3M8LA 3ZYRA 5CA6A 4XF4A 5C3SA 1KFXL 4Y20A 5ANQA 3C2UA 5BPXA 2B46X 3APBA 5EHDA 1LHVA 3RMXA 1PX3A 1BEV1 4NJ4A 5HXMA 1WLCA 4LBOA 1T2XA 4B1MA 4IV3C 3O1OA 3W20A 3T3YA 3BGAA 4XTPA 4DUWA 2CGOA 5DUWA 1SACA 4S2HA 2JXAA 3SQOA 2VU9A 1K5MB 4XE9A 4AQ6A 1PMIA 3IIIA 1LCLA 4YZ4A 5BNOC 3ZFEC 1SPPB 5C3QA 1V00A 4QGMA 1YIPA 5JMCA 2HWC1 1FPN1 4IE7A 2OX0A 1HXS3 5KC5A 2D3SA 3MFCA 4JGYB 3QACA 5FK8A 4NHMA 1F35A 1W2OA 2VGDA 1MS9A 3KQ4B 2E63A 4XAEA 1HB1A 4TWTA 4EQVA 2OUHA 2QTWB 3ASIA 4MUVA 1W04A 3N35A 5HBAA 1JZ4A 1D4M3 3E6BA 1W0NA 4EYUA 3O1MA 1K3IA 3PUSA 1NUKA 2G9FA 3FLRA 2FDFA 1J59A 3WOGA 4I3GA 1DQ5A 1W2NA 2P6CA 3AJYA 5T5JA 3RI8A 4Q4Y2 5C5UA 4D94A 5F3EA 1ZZ8A 4AGRA 2MHFA 4PIZA 4YVSB 1YI7A 2XJRA 4Y24A 2WR9A 2YV8A 1S2KA 2WABA 4LMFA 5A32B 2WL1A 3CJIA 3MUZ1 4BWOA 3JQWA 5C33A 4CU7A 1Q56A 1UY1A 1QDCA 1W6PB 2ET1A 4EE2A 5ABJB 4URTA 4CVUA 5FZ9A 2DTYA 3FLTA 4N9HA 1H8VA 2F4PA 3J9SA 3T1LA 3IKWA 4YG3A 1BZWA 4COUA 5I8TA 4LR4A 1UMHA 2TUNA 2AR6A 3WZ1A 5IAXA 4GMP1 2P2KA 4QKBA 1Y4WA 5T3NA 3OD0A 3T1MA 1HJGA 1RUC3 4N43B 4GJZA 5KC6A 1OFNA 4RR3C 4GWIA 1NT0A 1V9U3 3R4SA 1REFA 4A3XA 4E8CA 2IUWA 5A7WA 5KR7A 3BODA 3RZZA 1IS4A 3H1YA 1W6MB 2HWB3 2ZOEB 1W3XA 3MICA 1GQPA 5FLIA 3TEXA 3D8CA 4I02A 2O8OA 1D0HA 1FPN3 4GWMA 4QGNA 4ZZ5A 2FZ1A 3U4XA 4KGGA 5IJRA 2A7AA 1MQTC 2JKXA 3ZSJA 2D44A 1EPZA 4NUBA 1Z78A 4OHZA 4IGPA 5IFTA 1Z0HA 2VL4A 4ZS2A 3RYRA 3T2OA 5IAVA 4GH4C 2VZVA 3POBA 2I2SA 4P9XA 4PF5A 2VD7A 3W58A 1LECA 2HWF3 1TEIA 4S2GA 2XBO3 2YGLA 1LULA 3JU9A 1FOD2 2VMHA 3J7NA 2XJQA 2XQRA 3HR9A 2ZCWA 4GB32 1OVSA 1BEV3 1FYUA 2ZX0A 2CNAA 3AK0A 4GALA 2YXSA 4BPZA 3HAGA 3ZLIA 3J7MA 2VVFA 5JPNB 1UYZA 5FZDA 4CUAA 4ES8A 4A45A 3WNKA 4A3ZA 5GKAC 2CSGA 1GP4A 2ZGSA 3JXSA 3EBRA 1RITA 3GGLA 2XJUA 3GZEA 4SBVA 4QMAA 4GKYA 2J1TA 1JUIA 2VW1A 4BE3A 2JDNA 3ROUA 3MIDA 2RS12 1LAJA 2R043 1DIWA 2HH9A 4PQQA 4QB6A 4OLLA 4R52A 4FTBA 4H2AA 1XPWA 4LTAA 5GZDA 4YM3A 4XF9A 4OUSA 4QU2A 2VVEA 3ZSLA 3POWA 4ISRA 4QT6A 2VO5A 2YC4A 3LDRA 4YPJA 2PHDA 4QAWA 2R49A 2WFF1 1HV1A 1C8NA 3K4DA 5C7GA 3QD6A 3OD4A 1GICA 5FMBA 5CFDB 5JOZA 3LEGA 5CG8A 4IE6A 5D8AA 5FP9A 4ASKA 5FIXA 3AKSA 4HN0A 2E53A 4UW3A 4XCBA 5FWEA 3AZXA 1B35B 3S30A 2Y0OA 5BYNA 2IVIB 1FOD1 3DKQA 2XBO2 5GZEA 4X6QB 2XONA 3HQXA 2VJXA 3N9OA 2WNUC 5F3CA 2C26A 2GMMA 1G8WA 1N1SA 1UYYA 4R9CA 3VL8A 5A6YA 2RS53 1YJLA 1DP0A 3JQXA 5GZCA 4XVHA 4C90A 3BU0A 1UZZA 2JJ6A 2YC2A 5A3LA 3WLUA 2VCAA 4BLJA 3WP6A 1S0GA 2XWJB 1KS5A 5HCBA 3OPTA 2D93A 3ZMNA 2JKBA 1X8MA 4GD4A 5BNPC 3N36A 1AR91 2AEYA 2VQTA 4NIIA 2CL2A 4JDOA 4LHKA 4AGGA 2V73A 2VZQA 4QHBA 2ZEWA 4OZOA 3U4SA 2CTVA 1R093 4NVPA 4AOCA 1RUNA 4KWLA 3NNFA 2XL7A 4F3JA 1RUG1 4QQOA 4JTNA 3NJZA 2LUWA 1RUH2 4JGZB 2D5HA 2DYCA 4B3NA 5JIUA 1OQEA 1W8WA 3JBG1 2YGMA 3VUOA 1W8OA 4JKKA 1YYNA 2A6ZA 2BUKA 2VXJA 3IB3A 2BZDA 1ZBA3 5DAWA 3J8F1 1D2QA 1OQDA 3GHMA 4KNCA 1SMVA 2ZXQA 3ACHA 3UGHA 4S2DA 1GANA 2BP6A 5CFDC 3V0BB 3O0XA 4QX5A 5AFBA 1QGLA 2WZ8A 5GLUA 5HPOA 3I97A 4COYA 2YU1A 4EN6B 3IWZA 3UK9A 4LOSA 4MO3M 4EN9B 2VMFA 4EN7B 3H7YA 1WA6X 3NAPB 2WA4A 1PIV2 4K7JA 3USUA 3BPSA 3RYKA 4HVRA 2RJKA 3W59A 2B45X 1W6NB 4GJYA 4MHUA 3VBRB 2FDHA 1BCXA 1KXGA 1R092 3KWVA 4HXCA 1MS0A 1IG3A 2IFWA 1VBC3 4LBQA 4MGKE 4UW4A 3WINE 3O1PA 2GC2A 3QH7A 2ARBA 2GH2A 3E6CC 2A6YA 2P4EA 1FMD1 4AK3A 5JSOA 3BTXA 1CPMA 3TNQA 3FZ3A 1CAWA 2ZGPA 4N53C 4AEKA 1BYHA 3ZN6A 1JZ6A 3ACGA 4OUEA 2WNUB 1GOGA 3AL6A 1CVNA 4BCUA 3C7GA 4NWWA 4Z8BA 1W6MA 4BISA 2X29A 5JOWA 4PLOA 3M2MA 3VB9A 4JRAA 2VCCA 1RUD2 1FNYA 2ADEA 2WQ4A 3OGRA 4META 3VHOA 3KV9A 5FZ3A 1KJRA 3ZDVA 3WHUA 2WLPA 3DECA 2EIEA 3N9MA 2JIJA 4PLMA 1QNWA 5C71A 1N3QA 1UPSA 3ZN6B 1PNGA 1WMFA 2GC0A 5APAA 5FO8B 2BW8A 4E4ZA 1G6NA 1ND3C 4P9IA 2HWD3 3U14A 1X8EA 2NQYA 1YQ5A 4CUBA 1HDKA 1YQCA 5LRRA 3X29B 4CDUA 4PCRA 4WVVA 4DEQA 1YQ8A 1W9YA 5CIRA 1D0GA 3EB7A 4AHYA 1O4TA 1AR92 4HL0A 5JXGA 3FBMA 1ZZBA 1AL0G 3AMHA 3CZUA 4JV4A 4AI2A 1W8HA 3J26N 2WIIB 4NIGA 2YFUA 5GJ6A 3AM2A 5GZGA 1XSQA 4YW4A 1RUG3 4W65A 2ARAA 2VXRA 3U78A 2X10A 4C8DA 2XVGA 1SFPA 1IQAA 2XH6A 2Y34A 4XBQA 1MVEA 4YVWA 3WUDA 3LZZA 3F2ZA 1RVF3 1A6CA 4BIFA 4GZ9A 1SFYA 3IDBB 1QDOA 1YJKA 3WX5A 1GKBA 3JB4C 4OHXA 4IESA 5D8AB 4MZUA 5FKCA 1NCRA 1YUDA 3GNEA 1V6KA 5FXVA 3ILNA 4JDMA 2E31A 4OVEA 5F2WA 4Q0SA 5A7SA 4ATEA 4UXAA 3I59A 4CCCA 2R0HA 2YB7A 2RM21 2SBAA 4FFFA 4UFKA 3JD72 1NE6A 2W94A 4AVVA 4IE4A 3S6PA 4QPYA 5F37A 3I7DA 3MW4A 3CMGA 2G9ZA 3JBG3 3MLKA 1LHUA 1NZCA 2TNFA 3I2OA 3OGVA 1PM7A 4RA0A 5FZHA 1RXFA 1BMV2 5FP7A 1OPOA 1ZA7A 3UJOA 3ZFGA 2IXIA 2QVSB 4CCEA 2VY0A 4GXLA 3TEZA 1E5RA 1GNZA 4I09A 5EP9A 2VNRA 5FZGA 5FZ6A 1TZOA 3ZN4A 1NX9A 3MZHA 4N43A 1XNAA 2BTVC 2W0XA 3C7EA 4NPLA 4RGGA 1UXXX 4QGLA 4Y22B 2EICA 1ACCA 5K7PA 5DABA 4LNVA 5FZCA 4CUCA 5B4XA 4E8DA 1XQNA 2W1SA 3I2FA 4XJWA 5L73A 2X05A 4BXFA 4JGZC 4Y33A 1PO12 3VBSB 2AUYA 3AVRA 2JDAA 2Y6FA 5ANNA 4PLNA 3VBUC 2LW8A 2EF6A 3L9JT 3SLIA 3OBAA 4OYUA 3RWNA 2BU9A 1LTEA 3WD5A 1AL23 3AYAA 2WNVB 3IN9A 2PHFA 3KF3A 2EVXA 2DFCA 1Y7BA 1RJ8A 3HN1A 4JGYC 4YVWB 4YYOA 4NIAA 1EUTA 2I45A 1W8TA 5HCFA 3A7QA 5FZIA 2P17A 4UW6A 3FN9A 1R64A 2QQPA 3KV6A 3VBUB 1Y43B 2PLV2 2JG9A 1UF2C 3I2KA 3PUIA 3ZFEB 5EIYB 2JIGA 4XACA 4DXTA 1H8TA 2Q8EA 1DQ4A 4LHSA 3SISA 1A3KA 1HV0A 3A0NA 4RS5A 2VCBA 3O0WA 2QFEA 1U0AA 5FY1A 4Q8LA 4Z1VA 4IV3B 2ERFA 4CDUC 1PO13 2ATFA 1ODNA 2UY8A 1RUE1 2W91A 3OUHA 4PF1A 3BVCA 5CFDA 3ATGA 1J83A 2RMU1 2BQPA 2DUOA 2XR4A 4RGAA 5BNNC 2YZ4A 4UFMA 1QQP1 4LE4A 4BU2A 4X8PA 3KF5A 4GWNA 2KA3A 2C5DA 4ZY9A 1HRV2 3ZXAC 1QY4A 2ADDA 2HEWF 1RUF1 2RDQA 3BOWA 3MIHA 4A7KA 1LESA 1WCKA 4COWA 1E5HA 3NNMA 1V6OA 4Y20B 4Y5Z0 4KWJA 5FJHA 3VDAA 1LU1A 3MPBA 4X6RB 2GC3A 3MYXA 4RFRB 1RUI3 3UKTA 4AVCA 4BQYA 4MGZE 2BFUL 2R041 2W87A 3RGBA 1MS8A 3WDYA 3B00A 4LBQD 1OMIA 3SKJE 1R1A3 1MR5A 2WYSA 2PN5A 1IPJA 1H1MA 2ZS6B 4NIHA 1VBA3 4A42A 4AEDB 4HFSA 1NOVA 3ZOIA 4KI5M 1UOBA 5LCWL 5KHJA 1VBC1 2P3IA 2IXKA 2C9KA 3KVAA 4P5YA 2VNGA 3SH3A 3KV4A 3OGGA 3THCA 1JYWA 5CKMA 5FY0A 4AI9A 5F32A 1LEDA 4CDWB 1OHFA 3I8TA 2OXBA 1JZ3A 1ULOA 4PT6A 4V2VA 4XQDA 4YM2A 4CCNA 5GLWA 1D7PM 3NO8A 2WNEA 5LATA 1AR73 1RUJ3 1YRZA 1W2TA 4JX0A 3MV11 4UFIA 3WUCA 4TZDA 3P6BA 1VB4A 3BOPA 3HEIA 4GQ7A 4X8NA 4LBQB 1AL21 2VQ0A 1S4CA 5K9YA 1JOPA 1S1AA 1JI6A 1GWLA 4L99A 4QHZA 3GM8A 1O3RA 2DFBA 2QQJA 4XILA 1AR81 3H8UA 3J7LA 2HWE3 4M3CF 4QDSA 1W90A 1IS5A 1CAUA 2P6HA 2W1UA 3O1RA 2FD8A 3FE5A 1F4HA 5FR3A 2ZGKA 1W6PA 4EN0A 2VW0A 3AVSA
chains in the Genus database with same CATH topology
1ODMA 2WO7A 2Y6FA 2DBNA 2JB4A 1GP5A 2VBDA 3ZKUA 5C3SA 1E5SA 1BLZA 1W2OA 2Y60A 1RXGA 3ON7A 2DBIA 4XAEA 5APAA 1OC1A 1HB1A 1BK0A 1QIQA 1RXFA 2BU9A 1OBNA 1ODNA 2BJSA 2VAUA 2VCMA 2BRTA 1UOGA 2IVJA 4RGKA 1E5IA 1W05A 1QJEA 1W04A 1IPSA 1UO9A 2JB8A 5C3OA 1QJFA 1UZWA 3OOXA 1HJGA 1E5RA 1DCSA 5C3PA 4BB3A 1W28A 1W9YA 1W2NA 2CSGA 1W3VA 3ZKYA 1UOFA 1GP4A 3ZOIA 1W3XA 1UOBA 1W2AX 1GP6A 1W03A 1HB3A 1HB4A 1UNBA 1WA6X 1W06A 2VBPA 2VBBA 2VE1A 5C3QA 5C3RA 2IVIB 1HB2A 1E5HA 1HJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ODM A;  2WO7 A;  2Y6F A;  2DBN A;  2JB4 A;  1GP5 A;  2VBD A;  3ZKU A;  5C3S A;  1E5S A;  1BLZ A;  1W2O A;  2Y60 A;  1RXG A;  3ON7 A;  2DBI A;  4XAE A;  5APA A;  1OC1 A;  1HB1 A;  1BK0 A;  1QIQ A;  1RXF A;  2BU9 A;  1OBN A;  1ODN A;  2BJS A;  2VAU A;  2VCM A;  2BRT A;  1UOG A;  2IVJ A;  4RGK A;  1E5I A;  1W05 A;  1QJE A;  1W04 A;  1IPS A;  1UO9 A;  2JB8 A;  5C3O A;  1QJF A;  1UZW A;  3OOX A;  1HJG A;  1E5R A;  1DCS A;  5C3P A;  4BB3 A;  1W28 A;  1W9Y A;  1W2N A;  2CSG A;  1W3V A;  3ZKY A;  1UOF A;  1GP4 A;  3ZOI A;  1W3X A;  1UOB A;  1W2A X;  1GP6 A;  1W03 A;  1HB3 A;  1HB4 A;  1UNB A;  1WA6 X;  1W06 A;  2VBP A;  2VBB A;  2VE1 A;  5C3Q A;  5C3R A;  2IVI B;  1HB2 A;  1E5H A;  1HJF A; 
#chains in the Genus database with same CATH topology
 3RI9 A;  3SC7 X;  1AUY A;  4Y26 A;  4JQR A;  3PJQ A;  3ZX7 A;  2QDN A;  3IT8 A;  2VTX J;  3WNO A;  1SEF A;  1WGP A;  1QNY A;  4I30 A;  1T6G C;  2P3Y A;  3NWK A;  4Q1R A;  1ZVF A;  4L11 A;  1AX1 A;  5FBJ A;  2YYO A;  3Q9O A;  3Q8A A;  1RUE 2;  1NLQ A;  3VD9 A;  2IXC A;  4K8R B;  1J1T A;  5IUQ A;  3MW2 A;  1XE8 A;  3DEM A;  1X9P A;  3POJ A;  1UPI A;  5L7O A;  3W5N A;  1GWM A;  1BQP A;  1ENS A;  2XJV A;  4J6G A;  2PQS A;  4B4P A;  3C3V A;  1XND A;  4YFW A;  3ZKY A;  1HQN A;  1DZT A;  2Q1F A;  3WF4 A;  5DPN A;  1UU6 A;  1UZ0 A;  2X53 S;  2AEZ A;  2MNG A;  4LT5 A;  4ZU4 A;  1ASJ 2;  2Y38 A;  1WW7 A;  4H3W A;  4CU8 A;  4N90 A;  5BNN A;  2WNV A;  1R1A 1;  5DN2 A;  3TRS B;  2G1M A;  3I4I A;  2GAU A;  2R04 2;  1L7Q A;  1XJA A;  4R9D A;  2X5I A;  3AZY A;  3HNY M;  1GZC A;  1YLL A;  3ETP A;  3VN4 A;  4CU9 A;  4CEY C;  4LJH A;  2BV4 A;  1HX6 A;  4J25 A;  1IQD C;  4Q4X 2;  3ZDS A;  1QH7 A;  1Z7S 2;  4PI2 A;  3TN9 2;  3WDX A;  1VJ2 A;  4U2A A;  3MIF A;  5BNP A;  4PBP A;  4XUO A;  4XF0 A;  2WS9 3;  3AYD A;  1POV 1;  1ENX A;  1CIY A;  4G4F A;  4DNY A;  5J37 A;  1UZV A;  2QDR A;  3ZN5 A;  5E89 A;  1KEX A;  4OHY A;  2UU8 A;  1JU4 A;  2DDU A;  4OI2 A;  2RS3 1;  4LKF A;  1QHD A;  4YGC A;  1Z7S 1;  5LW9 A;  1ALY A;  2BNO A;  4K40 A;  5LBE A;  2GSY A;  4BXS V;  1B09 A;  5ABJ C;  3N9P A;  5F7U A;  4FPH A;  5L9B A;  2DUP A;  2NLR A;  3D6E A;  3V0B A;  4LO6 B;  3O0V A;  2VTF A;  2ZJC A;  3DPR A;  5JZG C;  3KD4 A;  2V4V A;  1AL2 2;  5F5I A;  3KHB A;  4DQA A;  2VUC A;  4IE5 A;  4QPG B;  4NO4 A;  2EAL A;  3RDI A;  3K4Z A;  4N53 B;  1ASJ 3;  1OKO A;  1N1V A;  2ETE A;  4ES9 A;  5A1L A;  4D69 A;  3UV9 A;  4KBZ A;  1WD4 A;  1KJL A;  4Q1P A;  1K12 A;  3B7M A;  4QXC A;  5CFC A;  1YIF A;  3LA3 A;  4XFG A;  3WG4 A;  2Q4S A;  2VMG A;  5AVA A;  3ZYG A;  2VVD A;  2HYX A;  3SEE A;  4QKF A;  1SLI A;  2CYF A;  1WW6 A;  2QQK A;  1BVV A;  2LAL A;  2VUD A;  1O4Y A;  3EHK A;  3K2O A;  4Q4V 1;  4FPF A;  4P08 A;  2R07 1;  4RFT 0;  2OYZ A;  3H3U A;  2FQP A;  1SDW A;  2P3K A;  2VOT A;  3KV5 A;  3KT4 A;  4LUM A;  1DGR A;  4QDR A;  1LOF C;  5FZL A;  5AC9 1;  3NAP C;  1YWK A;  1RVF 2;  3O5S A;  4B4Q A;  3VKO A;  4MHR A;  4XET A;  1F2N A;  2E26 A;  1PHM A;  3ILR A;  4AHW A;  1O7F A;  3LIH A;  4EN8 B;  1C5H A;  1JU3 A;  4YW2 A;  1Y9G A;  2B7Y A;  4MAD A;  4QPI B;  2WAA A;  2ZEZ A;  3VD3 A;  2JE9 A;  4H14 A;  3J8F 2;  4QX1 A;  4Z2A A;  3MLJ A;  5FRE A;  4LOR A;  5F3I A;  3RFR A;  5H9S A;  3SCH A;  5KXC A;  1GZW A;  4QU1 A;  3B5L B;  3RNS A;  2QBX A;  4L9B A;  5DXD A;  2D6L X;  1QMJ A;  2XB6 C;  3AYE A;  4TLF A;  1I3H A;  4E2S A;  2XOM A;  5DUX A;  5FP3 A;  4Y1Y A;  4W8J A;  1ULG A;  3Q8B A;  1C4R A;  2ZGN A;  2JDM A;  1NCQ B;  4YW6 A;  4CP9 A;  4FAG A;  1VRH 1;  3ZXF A;  2QQM A;  3UT0 A;  2PYT A;  3DV8 A;  4LLF A;  5FOB B;  4Q4W 1;  4XUQ A;  1XNB A;  1AR6 3;  1SPP A;  1TMF 2;  4XFI A;  2WNV C;  5LB6 A;  5C5T A;  5E16 A;  5K0U B;  3A22 A;  1POV 3;  1HQL A;  1JOJ A;  2R06 2;  3HD8 B;  3ZXL A;  1H2M A;  1GNY A;  4QXH A;  1CES A;  3JUU A;  1DZQ A;  3M3O A;  3O12 A;  2B5H A;  2RM2 2;  5EV7 A;  4F8A A;  1E5I A;  3TEW A;  1RUO A;  4Y3O A;  4YZ3 A;  5A3U A;  1J1L A;  4RHV 3;  2XGX A;  3OCP A;  4FPK A;  4D3W A;  1GUI A;  2VNO A;  3UKN A;  5T54 A;  5CVR A;  2P34 A;  2C0Z A;  5I0S A;  3O1U A;  1O91 A;  2GZW A;  4HOO A;  4FT8 A;  2EXJ A;  5CIS A;  1L7L A;  3E1F 1;  1MVQ A;  3LDK A;  1X50 A;  4P02 B;  4MXW A;  5GLT A;  1SFN A;  1WLD A;  3H1M A;  5FYU A;  4EWA A;  5C3R A;  1AX0 A;  4XJ8 A;  5LRS A;  1ODM A;  2CWS A;  4GMP 3;  1URX A;  1AHS A;  4KBB A;  3BKZ A;  4QDQ A;  3V56 A;  2XWB B;  1D4M 2;  2CY6 A;  5F5Q A;  4EJR A;  2DBI A;  5FP4 A;  4IV1 B;  4XW3 A;  3HQU A;  1AF9 A;  1US3 A;  4R4X A;  4XIK A;  5KXE A;  2Z69 A;  2Q30 A;  1TNF A;  1H2L A;  1ZZ6 A;  4LUL A;  2XML A;  2XG3 A;  3LAG A;  2J1S A;  3MO4 A;  5FUP A;  2IC1 A;  4YRD A;  1EV1 2;  1UX7 A;  5F6L B;  1MEC 1;  5L9R A;  3RYP A;  3WY6 A;  3MGU A;  4KWU A;  2ZX1 A;  2DCK A;  5F3G A;  1OF3 A;  3ME2 A;  5JR2 A;  3OEA A;  4FPG A;  1GOH A;  5DZE A;  5FZK A;  2B42 B;  3U07 A;  1GP5 A;  4MYE A;  4CDX A;  1PGL 2;  1VAL A;  4AF9 A;  4D6Q A;  3RVH A;  4DRR A;  1APN A;  1Q3E A;  2BGP A;  2PLV 1;  3OY8 A;  3RQ0 A;  5C6C A;  5HV4 A;  4K1Z A;  2PAM A;  1OLM E;  5FO9 B;  4IUG A;  2PQQ A;  4LBK A;  3CJX A;  3NST A;  1DLL A;  3LCP A;  1RHI 2;  1I9R A;  2PHX A;  5JXJ A;  3R4D B;  4Q0Q A;  2E51 A;  2GME A;  3NJY A;  4IND A;  4MH0 E;  5C4W A;  2MEV 2;  4UBH A;  1JZ8 A;  3I3D A;  3MW3 A;  1ZRD A;  2OPW A;  4Q27 A;  1C28 A;  1VBA 2;  2WZP P;  3AB0 A;  5SV5 A;  1HIX A;  5IVF A;  2X8K A;  5EYX A;  2WQ8 A;  4MSV A;  4MGQ A;  4OI4 A;  1NXD 1;  1N47 A;  2IZW A;  4JCK A;  3OUI A;  1CX1 A;  3NW4 A;  2E7Q A;  2D3R A;  2TEP A;  4NAM A;  1X33 A;  1NY7 1;  4I3P A;  4IEO A;  5E8A A;  5FXX A;  2WFP A;  4PDW C;  4WM8 C;  3P3N A;  4YG0 A;  1LGC A;  4RS5 C;  2GNT A;  5FZ4 A;  3VD4 A;  3JB8 A;  4ATF A;  4XPV A;  4NMI A;  1WMX A;  1RED A;  4LIU A;  3HOB A;  4QPG A;  2JG8 B;  3E5Q A;  1DQ0 A;  1U5Z A;  3GCW A;  3AL5 A;  3VBO B;  1IZ3 A;  4OCT A;  4KU8 A;  5T5P A;  2OZ6 A;  2WC2 A;  3TYJ A;  1CZT A;  1AJO A;  1YO8 A;  4W6Y A;  4ZXK A;  1GWK A;  2YHJ A;  2QUO A;  1PK6 A;  2J42 A;  1SCS A;  3THP A;  1WD3 A;  2JDY A;  2FDI A;  2QQO A;  4MGI E;  3RZK A;  1SLT A;  4N7U A;  2ZA9 A;  3HNM A;  5IT6 A;  2W1W A;  1F4A A;  4S2F A;  4GH4 A;  4IEQ A;  5M0T A;  5EQU A;  2YFZ A;  5CFC C;  3AMP A;  4DIN B;  5I8Y A;  2BVB A;  4BB3 A;  4UWD A;  5LA1 A;  3WG2 A;  1NQJ A;  2HEV F;  1IHM A;  3ZFF C;  1U12 A;  1J3R A;  4CCL A;  3IDE A;  4LIT A;  2K2S A;  5C3P A;  3WF0 A;  1LHN A;  3PIG A;  3POI A;  3SNM A;  1K5M C;  1LJ7 A;  4K8F A;  5F1R A;  4RHV 2;  4QPW A;  1ZBA 1;  4XMI A;  1RYY A;  3DKW A;  5BNQ A;  2WSU A;  1O8P A;  5K4L A;  1OA2 A;  2WDB A;  3RPQ A;  2AC1 A;  2QJV A;  5FMO L;  1IS3 A;  3GJA A;  2RS5 2;  4ASM B;  1ZA4 A;  5C9A C;  4DO0 A;  1ZBE 3;  4P9Y A;  4UT5 A;  4CDU B;  1G9F A;  1O5U A;  2GH8 A;  2UYA A;  3MUY 1;  3G6J B;  2NYY A;  4B7E A;  3JD7 3;  5JCT A;  2GNB A;  5FCC A;  3WVJ A;  3RSJ A;  3RZH A;  1UZW A;  4XDQ A;  4TSV A;  4HT1 T;  1OFS A;  3JCI A;  4HVQ A;  2VUJ A;  3AMN A;  3LGR A;  2B8M A;  4UFJ A;  4BA6 A;  1RUH 3;  4AHX A;  3LA7 A;  5FYM A;  3HBZ A;  4YVS A;  1W99 A;  2JE8 A;  4AFB A;  1JN2 P;  1DYP A;  2G4I A;  3A4U A;  3POY A;  4XUN A;  4M3C B;  5F2S A;  3WCR A;  2BNM A;  3VBH B;  3LEK A;  3L2Y A;  5A3O A;  4XBN A;  1FMD 3;  3PNA A;  3N7J A;  3THT A;  3WDU A;  4M0H A;  5CFC B;  2RS3 3;  2NPI A;  4WV8 A;  3WF2 A;  1F15 A;  5F5A A;  5J36 A;  3RMY A;  1C8M 1;  2AEN A;  3D5O A;  4YW5 A;  3IBM A;  3NV3 A;  3OB8 A;  1VAV A;  1UD1 A;  1ZRF A;  3KGZ A;  2H6B A;  5CKQ A;  3R0R A;  4AQ2 A;  2JX9 A;  3U1X A;  5I0R A;  2DTW A;  5FMD A;  5A7P A;  3O1S A;  2JG8 A;  4U36 A;  5IWF A;  3VBH A;  3ETQ A;  3FC0 A;  2EIG A;  2D7F A;  3I3E A;  5JUV A;  2VZR A;  4Y1Z A;  4JGZ A;  4UAP A;  1WW4 A;  3K48 A;  4W4Z A;  4Q4W 2;  1PZ9 A;  3TAY A;  3CL1 A;  4XAB A;  1GBG A;  4CXY A;  4BMB A;  1EAH 1;  2QNK A;  2HLE A;  2Q1M A;  2B9V A;  2FCU A;  2WWJ A;  2VMD A;  4RQP B;  2ZZQ A;  1JUH A;  3WSO A;  4LKS A;  4CXX A;  2JE7 A;  4A41 A;  1JOB A;  1H4G A;  3MIB A;  4D8M A;  3PUQ A;  4I0W B;  4BIO A;  2A71 A;  3FX3 A;  2W39 A;  1PK6 C;  2VZ3 A;  2P1B A;  1AYM 2;  1S0J A;  3CZJ A;  3EJK A;  1LKN A;  1Q8Q A;  1C5I A;  2I74 A;  4E4H A;  5KHG A;  1WCS A;  4RL7 A;  1GSL A;  5JIA A;  4AI8 A;  1UAI A;  1O5L A;  1W06 A;  5FO7 B;  2HWF 2;  1PVC 2;  2YBP A;  2B39 A;  1ENR A;  2W08 A;  3B9I A;  1C8M 3;  3PME A;  3ZYH A;  4B7K A;  4E2G A;  5L36 A;  3VD7 A;  5A33 A;  3H8X A;  3RZM A;  2Q0A A;  4O7X A;  3I59 B;  2Z79 A;  5FZE A;  2JDZ A;  4F7Z A;  1CAX A;  1IG0 A;  1LOG A;  2E6V A;  1V0A A;  5J3U A;  4NHY A;  1O4Z A;  3UES A;  4CDQ B;  2A70 A;  2JG9 B;  2UYB A;  3IMN A;  3POS A;  3N3H A;  2ORX A;  1TVG A;  4QXK A;  3VZM A;  5AVP A;  2HKX A;  5FY8 A;  4LEJ A;  3FHQ A;  4DMI A;  3DPR C;  5JZG A;  2P3J A;  3FUQ A;  1RL3 A;  4KWK A;  1NKG A;  4YSF A;  5C9A A;  2XUE A;  1FXZ A;  1XBF A;  1W39 A;  3S0M A;  1JYT A;  1DHK B;  1NE4 A;  3DXU A;  1DBN A;  1HRI 3;  2J1V A;  2JIC A;  4Y4R A;  4OQ8 A;  4LK7 A;  1O3S A;  4E4S A;  4SLI A;  4BQ3 A;  2JD4 A;  4LHN A;  2ZAH A;  4NRP A;  5A7O A;  2ZTN A;  3PIJ A;  3SKV A;  4HAN A;  2JDH A;  4LE3 A;  4NE9 A;  3HN3 A;  1XYN A;  1DQ2 A;  3POF A;  5T52 A;  1W9S A;  4BQ1 A;  4LO8 A;  1XE7 A;  5LAS A;  1C8M 2;  4M4P A;  4WBB A;  4A6S A;  4BQ5 A;  5FZ8 A;  3WDV A;  4AGV A;  4C1W A;  5J7M A;  2RR1 3;  1RUD 1;  4ZON A;  5BUV A;  2VR4 A;  1JHJ A;  2QQW A;  1WKY A;  1DGL A;  1VMF A;  3B94 A;  3DGT A;  3DL3 A;  2PHL A;  3GDB A;  5DDJ 3;  4YVS C;  2GN3 A;  2VOX A;  3EO6 A;  1AR7 2;  1RUJ 2;  4FOY A;  4QWN A;  1WBL A;  1TNR A;  1RUC 1;  1VMH A;  4KMQ A;  2N7G A;  4Q0P A;  4BQ4 A;  2ZHN A;  3RZG A;  4HVO A;  5HXV A;  1ZRE A;  1OSG A;  2ZZJ A;  1HW5 A;  5IK5 A;  4V2W A;  3BPZ A;  3IDA A;  4AL9 A;  1DZR A;  4CUG A;  4XMA A;  3OGS A;  5FUI A;  1CD3 G;  2F6B A;  5T50 A;  4OQ9 A;  3LKJ A;  3VHR A;  2DU0 A;  2ZPX A;  3ZKU A;  3UNP A;  4Z92 B;  4Q8K A;  4AVB A;  5FYT A;  5J96 B;  1DYK A;  1OOP B;  3CDZ B;  3INA A;  4A7Z A;  2WWS A;  1AJK A;  5EJ1 B;  5H9R A;  1OA4 A;  1K5J A;  3WQ7 A;  4HK8 A;  1MS4 A;  4H7M A;  4XFH A;  1SBE A;  3D4K A;  4UFL A;  2XPJ A;  3OG2 A;  5A33 B;  2R30 A;  5HI0 A;  2GAL A;  3GBW A;  4L97 A;  2I07 B;  5A7N A;  3OPZ A;  2K9Z A;  4KL1 A;  4J1X A;  1NCR C;  1W9T A;  2OQ6 A;  1TG7 A;  1WLW A;  2VOV A;  4OZX A;  4QX8 A;  3WEZ A;  1R08 1;  1YQ6 A;  3HNB M;  2XVK A;  3VV1 A;  1IOA A;  5CB7 A;  4QQL A;  2ZGU A;  2NZ9 A;  5CZK A;  2XHK A;  3WT3 A;  5FDB A;  3N7K A;  4HSL A;  4NOT A;  4W50 A;  2EAK A;  1KIT A;  4GKX A;  1CJP A;  3VBR A;  4DPN A;  5C9A B;  2OUJ A;  1BLZ A;  3LSE A;  3ZXE A;  4QPI C;  1YFX A;  2J1U A;  1IKQ A;  1UU5 A;  2ZHM A;  1U5Y A;  4IV3 A;  4G9S B;  4P9G A;  3T30 A;  1CAW B;  4FTE A;  4BK4 A;  1W05 A;  4MVT A;  1H9P A;  1AR9 3;  4P9W A;  4WM7 C;  1QH6 A;  4YW3 A;  3WCS A;  2H6C A;  2HWE 2;  1S0I A;  4K20 A;  2RMU 2;  3WNL A;  4D0Q A;  4NPM A;  5A7W B;  5J98 B;  5L7O C;  5BNN B;  1YC6 1;  4B29 A;  5LA0 A;  3GZT B;  3NL1 A;  1DYO A;  3JZV A;  3OYW A;  5FZF A;  5IVV A;  2RJ2 A;  3N9N A;  1N3O A;  5KHI A;  3ITQ A;  2KM2 A;  3J4U H;  3LB9 A;  3NJV A;  1QU0 A;  4GUL A;  3NNJ A;  1AVB A;  4Z2W A;  1DQ6 A;  2F4L A;  2HWE 1;  3LA2 A;  3OBR A;  4AQT A;  5FAX A;  1X7N A;  3ABZ A;  2R07 3;  1FMD 2;  3NMB A;  2W9X A;  2X5I C;  2X5I B;  1A34 A;  3H3L A;  1BBT 2;  4NRQ A;  3V0A B;  3ZYJ B;  1W6Q A;  4MXV A;  5JLV A;  2YBS A;  3NV4 A;  2WJS A;  4NHK A;  4XFA A;  4YVW C;  5IW0 A;  1UX6 A;  4XZP A;  2JG8 C;  4AED A;  3VBH C;  3AYC A;  4YFZ A;  1JYN A;  3SH5 A;  2P37 A;  1QKQ A;  5FPL A;  3CJI C;  3KS7 A;  3PVE A;  3WW3 A;  5K8S A;  1CGP A;  1NAE A;  2A73 B;  5FZB A;  4IEW A;  1H8T C;  4HLT A;  4OUM A;  4AR2 A;  4JRL A;  4KG8 A;  1NA1 B;  2R1B A;  2R16 A;  2JB4 A;  1A78 A;  3SH4 A;  4PI0 A;  2ILM A;  4P9L A;  2IWG B;  2ARE A;  2WIN B;  5A32 A;  3I2G A;  3CNA A;  2OVU A;  5FYS A;  2ENR A;  1FV2 A;  3ZM8 A;  1US2 A;  4PQ9 A;  4CE8 A;  1XOY A;  1MZ6 A;  1POV 0;  2R07 2;  2WS9 2;  4BH9 A;  1RUD 3;  1GV9 A;  3CQO A;  3WDW A;  2WO3 A;  4PBO A;  3BN6 A;  4BME A;  5FQ0 A;  3P3P A;  3VDD C;  4CCD A;  1VBD 2;  3WNP A;  3F95 A;  3N4M A;  2HBU A;  1R08 2;  3CKH A;  1X36 A;  1CAU B;  3AXD A;  1UWW A;  2XQX A;  4IER A;  3MIE A;  3GZA A;  5JAX A;  3W9A A;  3M3C A;  1V6N A;  2ZHK A;  4GB3 3;  4URA A;  1NG0 A;  1IKP A;  1NYW A;  4MLO A;  5J09 A;  2FBE A;  1BK0 A;  2QQU A;  4OHW A;  5FXZ A;  2VMI A;  3B3Q E;  5CAD A;  2G19 A;  2KXL A;  3I2J A;  5A80 A;  1COV 1;  1C3H A;  5JOY A;  3MHZ A;  4EWE A;  1JYI A;  3OF1 A;  2CU5 A;  5A3T A;  1PO2 1;  1AR8 3;  1EV1 1;  2R6Q A;  3I3Q A;  2PHT A;  3PTR B;  3O7O A;  4JAA A;  1DFQ A;  2VM9 A;  3AC0 A;  2OA2 A;  4NHX A;  3CO2 A;  1RUG 2;  2FMY A;  1I5Z A;  4NRO A;  1AYM 3;  4GB3 1;  4IGO A;  2OKX A;  1RJ7 A;  3JBG 2;  3NVC A;  3K4A A;  3B93 A;  1AXZ A;  2PAE A;  4BQW A;  1PGL 1;  1CQ9 A;  4HKO A;  3VBO C;  1QOT A;  1U5I A;  1H2K A;  2EA7 A;  4DZG A;  5HCA A;  2J7M A;  1H1A A;  2E7A A;  4QKD A;  2FMD A;  3C8X A;  1N1Y A;  1QIQ A;  3G7D A;  4Q4V 2;  5EXO A;  4DB5 A;  1W8U A;  1NA1 A;  1CIW A;  5LY2 A;  2BPA 2;  1QJF A;  2GMP A;  2ZGO A;  4EV0 A;  3Q8E A;  5I93 A;  5FZM A;  1VBD 3;  5DG2 A;  3H42 B;  3FBY A;  1NCQ A;  5D2A A;  3FLP A;  3OJB A;  4JVA A;  4K3U A;  4CP9 B;  3O1V A;  1W3V A;  2E7T A;  4UFH A;  1NQD A;  4HPK A;  4ONU A;  3PVB B;  2JWP A;  4F83 A;  3QLQ A;  1PO1 1;  5E1R A;  4A7Y A;  4Y1X A;  2DCZ A;  1H8T B;  3PUR A;  4AE2 A;  1A8D A;  4BHP A;  1SG3 A;  2ZBJ A;  3N7L A;  2H0B A;  5FYY A;  3A0K A;  5C4W C;  1QJX 1;  4EWD A;  4BZ4 A;  1W8Z A;  3FMG A;  1RTV A;  5FPU A;  3D0S A;  1DG6 A;  1UCX A;  3EMR A;  4FQZ A;  2BER A;  4R9A A;  5A1F A;  1CR7 A;  4PHZ A;  1CAV B;  5GAL A;  2V72 A;  3USU B;  3FL7 A;  4FTS A;  2CWM A;  2RS1 1;  2IXL A;  3LQC A;  5C8C A;  2W46 A;  3RS6 A;  3CHX A;  4LHL A;  2VH9 A;  2Y64 A;  1M06 G;  5DDJ 2;  2XUM A;  1VP6 A;  1YEW A;  3VDD B;  2VE1 A;  3HVD A;  2Q1Z B;  1CAX B;  4K9S A;  3DXT A;  1LNS A;  1UZY A;  2VZO A;  3H8R A;  1LOC A;  3BTY A;  1FOD 3;  3AKP A;  3T08 A;  3VBR C;  3E6D A;  3AJZ A;  5DQ0 A;  1G9C A;  3LOB A;  4YZ2 A;  3AFK A;  2A75 A;  3THD A;  3MPP G;  4D6R A;  1RUH 1;  1ZBE 2;  4JC1 A;  3C7O A;  1KFU L;  2V09 A;  3GHN A;  2KR2 A;  4IEU A;  3VDD A;  3WP3 A;  5KWR A;  2FDK A;  2DVD A;  1XNC A;  2VZS A;  1RVF 1;  2DVB A;  1PO2 2;  3CU7 A;  3LD8 A;  3BIW E;  4A6O A;  3T2Q A;  4QKN A;  1MS1 A;  4D7S A;  2PA7 A;  1UNB A;  5T55 A;  5JXH A;  1IS6 A;  3VBF A;  5GM0 A;  4QXB A;  1G7Y A;  4BDV B;  5JPM B;  3VBF B;  2NMN A;  5KHK A;  1V6J A;  1S0F A;  3WW4 A;  4TYS A;  1ZRI A;  5BV6 A;  1W6Q B;  2QQI A;  4ZU7 A;  1GOF A;  4AZZ A;  3MF9 A;  3N9L A;  1RUE 3;  4NAO A;  2DUR A;  4XAA A;  3I49 A;  4LKD A;  1GZT A;  1RMU 2;  3WW2 A;  2WA3 A;  1G9A A;  3AP9 A;  4TTG A;  1GZW B;  4P00 B;  3WHT A;  3WNN A;  5B4N A;  2DV9 A;  2PHR A;  2JDP A;  1OUX A;  3BI3 A;  3I2I A;  5FPV A;  1HRV 3;  1TME 1;  2YBK A;  4LBN A;  1QF3 A;  2Z42 A;  5FRA A;  5H9Q A;  3WQB A;  5K0U C;  2OPK A;  2RR1 2;  2D97 A;  5C4W B;  2C24 A;  2DVA A;  2UY9 A;  1FI2 A;  3IIA A;  2IFR A;  4KH9 A;  3ENR A;  2E32 A;  4XQW A;  2Q8C A;  5EYY A;  2YDE A;  5A1A A;  1JZ2 A;  5LK7 B;  5BY5 A;  3SHR A;  1OA3 A;  1VB2 A;  1ULE A;  1VAK A;  2Y26 A;  2BYV E;  5C8C B;  2LTN A;  5L7O B;  4PDW A;  2VOW A;  3ELN A;  5FZ1 A;  2R06 1;  1VE0 A;  3ZYB A;  3CF6 E;  3K46 A;  1HQW A;  1UMZ A;  4HG6 B;  3PU8 A;  1O6U A;  4D7T A;  4KGQ A;  3VD5 A;  5IK8 A;  1ZNP A;  1V9U 1;  4KQ7 A;  3AZW A;  4AAX A;  1WW5 A;  2BBV A;  2Y6L A;  1KDM A;  1WLT A;  5DZG A;  1AXK A;  3TWI A;  2CDO A;  2R7E B;  4YZ5 A;  1JZ7 A;  3PMS A;  1SBF A;  2BOJ A;  3VHN A;  1OH3 A;  1OD3 A;  3NQH A;  2DVG A;  4CEW A;  1W9F A;  5C8C C;  3GXU A;  3HBK A;  1G86 A;  4MGS A;  2QKD A;  2K46 A;  1RMU 1;  1GQG A;  1SZB A;  5G05 L;  2A6W A;  1X82 A;  3K51 A;  2OW4 A;  2D3P A;  1V6M A;  1EAH 2;  2CAV A;  2RVA A;  2BBA A;  2UWB A;  2V4A A;  4P14 A;  5AC9 2;  2BNN A;  3DYM A;  3A21 A;  1OC1 A;  3NKT A;  4XDP A;  5LK5 A;  1QXR A;  3ZFF A;  2IVJ A;  3MEP A;  3OYW B;  4GA9 A;  3ZPO A;  1AYM 1;  2DCY A;  5FBZ A;  3OOX A;  1QJY 1;  1VLN A;  4C91 A;  5FYZ A;  1TMF 1;  5KBF A;  4ZS3 A;  2YPD A;  1ZYB A;  1JBC A;  4FPY A;  5L19 A;  1PMJ X;  1LU2 A;  1QOO A;  3AMM A;  3D0J A;  3NRU A;  5FY7 A;  4IV1 C;  3SCF A;  3N9Q A;  4I2O A;  3AKR A;  4C0B A;  1D4V B;  1UYX A;  3SXW A;  1S0D A;  4IEZ A;  2B4K A;  4DOU A;  1UKG A;  3ZSE A;  1DGW A;  4BQX A;  4NRM A;  4FPL A;  1ULC A;  1LHW A;  1G9B A;  3H7J A;  1Q8P A;  5IVC A;  4WZC A;  4H55 A;  5BNO A;  4ZHN A;  3ZFE A;  4XZU G;  1ND3 A;  1ULD A;  3ZXJ A;  2D98 A;  3M4F A;  2BOI A;  1CZV A;  1E57 A;  3ES4 A;  3O14 A;  1RGS A;  1I5P A;  3BAL A;  4OMD A;  5FJK A;  2WYF A;  4LA3 A;  1UY0 A;  2MEV 1;  3KLS A;  1VBE 3;  1QXJ A;  1DDL A;  3I2D A;  4LO5 B;  1D4M 1;  5B2G B;  4LPL A;  2WZR 1;  1V70 A;  1WCQ A;  1VMJ A;  3KGL A;  2ZGQ A;  1YXW A;  3SEP A;  5ISL A;  3OGJ A;  1S55 A;  1G9D A;  3CJI B;  4W6X A;  5SV8 A;  2VPV A;  4COV A;  4WZF A;  1O59 A;  2JDU A;  4QX3 A;  3LDB A;  5D21 A;  2RS1 3;  4XJZ A;  1CON A;  1YCI A;  4Q4X 3;  5EFU A;  4QQH A;  1ULF A;  1OI6 A;  2XJS A;  5LEJ A;  4RGK A;  4AW7 A;  3KVB A;  1OUS A;  4FP2 A;  2J1R A;  4RN5 A;  2VOK A;  1RUF 3;  3NV1 A;  4RD7 A;  2PHU A;  2HBT A;  2UUR A;  1EY2 A;  5CU1 A;  1SLB A;  4BK5 A;  2Y8K A;  1TME 3;  2QZ3 A;  3LFM A;  5JMO A;  2Y6H A;  5H9P A;  4Q26 A;  1I6X A;  3ZPY A;  2BDR A;  3GZU C;  4ARY A;  4WVM A;  1W2U A;  2BWC A;  2RM2 3;  3N7M A;  4CDX C;  1AYN 1;  2WRA A;  5GLZ A;  1LOA A;  4CCO A;  4RR3 A;  1I1E A;  1COV 3;  3FJS A;  5C8W A;  1LEN A;  4RQP C;  2WT2 A;  3HJR A;  1RC6 A;  2A1X A;  2WZR 2;  2ZKN A;  4MGY E;  3V0A A;  1A8M A;  1BVP 1;  3RWK X;  4Z07 A;  2WAO A;  4CCJ A;  2ZKL A;  4ERO A;  1ZZ9 A;  3LSD A;  4CDX B;  3BIE A;  1PX4 A;  3WG3 A;  5IHR A;  4ZPI A;  3OEB A;  4R8H A;  1JYC A;  3I2H A;  4XFB A;  3ALQ A;  1BHG A;  3OBZ A;  3HPN A;  2ZEY A;  2DBN A;  1DU3 D;  2Z5W A;  4AEM A;  1UIK A;  2J1A A;  5D1I A;  1QJZ A;  2L9L A;  4HZF A;  5CBL A;  4K1Y A;  5JWP A;  4MXW B;  1RUF 2;  2GNM A;  4K21 A;  2HWC 2;  2WN3 A;  2R32 A;  4Y4Y A;  1VBA 1;  1DF0 A;  5I0U A;  3ZYP A;  5AC9 3;  1C1F A;  3DCQ A;  2ARC A;  1FAY A;  2O1Q A;  3OSD A;  4FPO B;  3ORJ A;  1XU1 A;  5FPA A;  2PEL A;  3WG1 A;  4AEJ A;  1STM A;  2LRO A;  2XLG A;  4Q4V 3;  3M3E A;  2UWA A;  3ZMO A;  4XDO A;  2ZGM A;  5A3N A;  1JYX A;  3SCG A;  2D43 A;  4XYX A;  2ZML A;  3HWJ A;  1DGW X;  4FOV A;  4QQ2 A;  4HN1 A;  3VHP A;  2VUL A;  1ASJ 1;  2VBD A;  4I01 A;  1YQ2 A;  2FZ2 A;  4FPE A;  5FZO B;  4CPB A;  1OH4 A;  4DEV A;  3HIF A;  3ES1 A;  2WO2 A;  5JXI A;  1SLA A;  4XHX A;  1YFU A;  3U37 A;  2LS6 A;  5E88 A;  4UI9 L;  1ZZ7 A;  4PIX A;  3MI8 A;  2HEY F;  1OOP A;  1VRH 3;  2H0V A;  2XJT A;  3M3Q A;  3T2P A;  3VZJ A;  3LFI A;  4JTO A;  4CPB D;  2R06 3;  3P1I A;  3FUO A;  3UGG A;  3AKT A;  3VGI A;  4YNI A;  2NN8 A;  2JDK A;  1BK1 A;  3C7H A;  4AI3 A;  1NLR A;  4XXP A;  2VQU A;  1UQX A;  1S0C A;  4WVZ A;  3GJB A;  4OI1 A;  5A70 A;  3K3O A;  3GYD A;  2DF7 A;  1PM4 A;  2W68 A;  2CHH A;  1J3P A;  3E97 A;  3IAQ A;  3ZSK A;  4A44 A;  1IPS A;  1HRV 1;  3H0O A;  1VBC 2;  2CV6 A;  2VZ1 A;  3WXP A;  4AI0 A;  1JTZ X;  1QJU 2;  4M3C E;  4CXW A;  4WM8 A;  1SDD B;  5LA9 A;  5EPA A;  5FQ0 B;  3IPV A;  4FXG B;  1X9T A;  1R1A 2;  2ARX A;  3DYO A;  1SLC A;  3P5B A;  2RMU 3;  1VR3 A;  3J8F 3;  3H1W A;  4QPG C;  1LOE A;  3FWE A;  1W6N A;  2ZX2 A;  4IW3 A;  4HKL A;  1Z7S 3;  5G04 L;  1RUI 2;  4IEY A;  5DUU A;  4EZH A;  5KXB A;  3T4H B;  4MX3 A;  2HWB 2;  1POQ A;  1HJF A;  1XYP A;  3BB6 A;  3NNL A;  3R4U A;  1OLQ A;  5JZG B;  4AG4 A;  2AAC A;  2D6P A;  4I0A A;  5I0D A;  3KT1 A;  1MQT B;  3ON7 A;  2XKP A;  1LOB A;  1CN1 A;  4CU6 A;  3AKQ A;  3ZYF A;  2EXK A;  3S7I A;  5ACA 3;  4WM7 A;  3WQ1 A;  1KD7 A;  2QZ2 A;  5JDB A;  3FHA A;  1JMU B;  1EP0 A;  2A3X A;  4NWV A;  4KU7 A;  4PJY A;  5A3M A;  1ND2 C;  2HWD 2;  3MDP A;  2WWU A;  1KGY A;  3TB0 A;  3QBQ A;  4CCM A;  5CKN A;  3FHI B;  4JKL A;  1S2E A;  2BFU S;  2BGO A;  3ZIW A;  1MZE A;  4A4A A;  1C1L A;  3RRD A;  5JVV A;  2P5B A;  3WF1 A;  2WLQ A;  3W5M A;  3U10 A;  2OS2 A;  2TBV A;  4CDW C;  1OF4 A;  1K5M A;  4OFG A;  4XUR A;  5LZ6 A;  2YMZ A;  4Y5S A;  2JEM A;  5FPZ A;  1CWP A;  1F5J A;  2ZGT A;  3H50 A;  4AVT A;  5GZF A;  4OHV A;  5DDJ 1;  2VEC A;  5FY9 A;  5LBC A;  4M00 A;  5DAQ A;  2LRP A;  3LEI A;  2MEV 3;  2WBK A;  4HK9 A;  3AXE A;  4DS0 A;  3HT1 A;  4A2U A;  3RG0 A;  2W1Q A;  4AED C;  2HWF 1;  2GDF A;  5A6Z A;  1LOD A;  1PNF A;  2ID4 A;  2Z2S B;  1AR7 1;  1RUJ 1;  4WVM B;  5FYB A;  4R9B A;  2FDG A;  2D5F A;  2GND A;  1K42 A;  3PL0 A;  2W2I A;  4LUK A;  1ZBE 1;  1W2A X;  3ZR5 A;  1DLC A;  5FYC A;  1H9W A;  1LEM A;  5L9V A;  5FYH A;  2Q5T A;  1GQH A;  2W3J A;  4N8M A;  1TME 2;  2ZAB A;  4QQP A;  4FO9 A;  3B01 A;  4ET7 A;  5EZW A;  4XBL A;  5A7Q A;  1NCQ C;  4IL7 A;  5F5C A;  3CEW A;  4L92 A;  1CJD A;  1W0O A;  2OZJ A;  3VDB A;  5HCH A;  3HMY A;  2D40 A;  4ISQ A;  2VAU A;  1WA4 A;  1QEX A;  2ZAC A;  5FYV A;  5BNO B;  3Q8F A;  1WZX A;  5TSW A;  1PVC 1;  1COV 2;  5F6K A;  4CRQ A;  2ZMK A;  2WUH A;  4CEY A;  4JKM A;  4M3C A;  2WFF 3;  4XFC A;  4BJ0 A;  1AR8 2;  2AYH A;  3RZJ A;  1V9U 2;  2V5Y A;  3LPG A;  3I54 A;  4YLZ A;  1PGS A;  1YFW A;  5DUV A;  5E6H A;  3VDC A;  1O8S A;  3R6S A;  3J7H A;  1M4W A;  3NKG A;  4FI9 A;  2FCV A;  2W92 A;  4AYU A;  1NCR B;  1PIV 1;  1ST8 A;  4IEV A;  4QX0 A;  2Y6J A;  3TN9 3;  1IGO A;  3OPW A;  5C3O A;  1QQP 3;  4Y5T A;  3WW1 A;  4DFS A;  3EXU A;  1F9K A;  3MV0 1;  3WR0 A;  3C7F A;  4UW5 A;  4FSJ A;  2JEC A;  1R08 3;  3T2T A;  3MIG A;  2FDJ A;  3POE A;  4MG2 A;  1F8V A;  1OVP A;  4MV2 A;  2D6K A;  2WZR 3;  1VBD 1;  4FFG A;  2XJP A;  5A6Q A;  3NNG A;  2RS3 2;  1SHW B;  4UOJ A;  5A3W A;  3E5U A;  4BQ2 A;  4E4D X;  2W95 A;  5FWJ A;  4YGB A;  4Q0V A;  1HB2 A;  1Q43 A;  1UY4 A;  3USS A;  5FPX A;  1Q8S A;  4K6B A;  2O14 A;  2A5Z A;  2RDS A;  2WO7 A;  3OY8 B;  3WP5 A;  4GIQ A;  1S0B A;  1QWR A;  4HPK B;  1H1I A;  2Y60 A;  3H3Z A;  1OPM A;  1UL9 A;  1RUC 2;  5EJZ B;  4N9I A;  4JZR A;  5IVY A;  3VZL A;  5I91 A;  4Z82 A;  5FK7 A;  4OMC A;  2WNO A;  2DCT A;  1QJE A;  1QJX 3;  1JXN A;  3VBF C;  1RIN A;  4QM8 A;  4XEZ A;  4CYD A;  4DY5 A;  2GN7 A;  5J1X A;  3VZK A;  5IK4 A;  1C57 A;  3D82 A;  3URF A;  2BVV A;  3WV6 A;  1N3P A;  4AFC A;  3PUA A;  1OXC A;  1MS5 A;  4IET A;  1HRI 2;  1LOF A;  1UYP A;  1UOF A;  3NAP A;  4O61 A;  3T4V A;  4CDW A;  3S57 A;  3PLQ A;  2WQZ C;  4XOG A;  2WZE A;  1V6L A;  2WKK A;  4LBJ A;  5LY1 A;  2E9Q A;  1WCU A;  3MBW A;  1UIJ A;  3KQR A;  3UET A;  1NY7 2;  3L2H A;  2HJI A;  3CLP A;  4W6W A;  1BBT 3;  2W5F A;  4AQS A;  4DXR A;  2XBO 1;  4QD2 A;  5K0U A;  4CP0 A;  1GZ9 A;  1FAT A;  1JZ5 A;  4JGY A;  5FPB A;  2GU9 A;  2CGP A;  2XHN A;  3SIT A;  1OD5 A;  4UF0 B;  4Q5O A;  5JOX A;  4QX7 A;  3WNM A;  4CSW A;  1WCD J;  2A3Y A;  2ET7 A;  1GR3 A;  3BTZ A;  2C1F A;  1LHO A;  3U75 A;  2XVL A;  2JG9 C;  5IYY A;  1PMH X;  1XU2 A;  2XXZ A;  3ST7 A;  4E9K A;  1P8J A;  2Y6K A;  4GAZ A;  3UKV A;  5CYY A;  5HV0 A;  2VQA A;  2PHW A;  4LBM A;  1FT9 A;  1PVC 3;  1OLM A;  5FLJ A;  4WVW A;  1HXS 2;  2C4X A;  4ASL A;  1QJU 3;  4ZKT B;  5AFE A;  1B35 A;  1J3Q A;  1XXN A;  3T0B A;  3TEY A;  4CCK A;  1WBF A;  2PTM A;  3T0D A;  4ZXE A;  2PFW A;  3HT2 A;  4GH4 B;  1SBD A;  2PLV 3;  5FLH A;  3PVN A;  5FZO A;  3WQ0 A;  5CEH A;  4JQT A;  3LOI A;  1QJX 2;  1J58 A;  4R4Z A;  3TNP B;  3IAP A;  4RYD A;  2WNU A;  2VTX A;  5LA2 A;  3UGF A;  1YFY A;  3GAL A;  1Q5O A;  1OBN A;  2DWR A;  4NN0 A;  3ZFG C;  4LXL A;  2JEN A;  2ZGR A;  1GLH A;  3B02 A;  1UY2 A;  4DXZ A;  1W9W A;  5JSP A;  1EUU A;  1W6O A;  2QCS B;  4RR3 B;  1VIW B;  4N43 C;  4RHV 1;  3ZSM A;  2VMC A;  4XUT A;  4XC9 A;  1LRH A;  1ND2 A;  1WWY A;  4GWJ A;  3IDC B;  4BM8 A;  5IAT A;  1ND2 B;  2ZMN A;  2WN2 A;  1EPW A;  3NJX A;  4B1L A;  2RHP A;  2VBB A;  1FX5 A;  3BU7 A;  1KS4 A;  5JSR A;  1XNK A;  3AP7 A;  3K75 B;  5EWS A;  1MS3 A;  3FFZ A;  3U11 A;  1CPN A;  1RXG A;  1VBE 2;  3LIG A;  3GCX A;  3I3B A;  4HSJ A;  4XF1 A;  3VBU A;  1JOD A;  4IEP A;  2A3W A;  4QB2 A;  5A3P A;  2ZX4 A;  2VUA A;  1V6I A;  1VRB A;  4COZ A;  1UW8 A;  1GMM A;  5IVB A;  1UXZ A;  2BRT A;  2RDN A;  2HYK A;  5FYI A;  4YZ1 A;  2A6X A;  3VKL A;  1KQR A;  4ZZ8 A;  5FY5 A;  2DCJ A;  4LK6 A;  2RV9 A;  3IMM A;  3OUJ A;  1ZRC A;  4E27 A;  1BXH A;  4HBN A;  1FPN 2;  5KXD A;  3B69 A;  1PZ7 A;  3FFQ A;  4NPR A;  4DXS A;  2HWD 1;  2PXJ A;  3TOJ A;  1KDK A;  1MPX A;  1W0P A;  2CDP A;  2FHR A;  4B4R A;  1KRI A;  2NMO A;  3D3A A;  4KG0 A;  3IPV B;  1HRI 1;  1W03 A;  3M1H A;  2VZP A;  2YUE A;  1VRH 2;  3V65 A;  5F9T A;  5FMO S;  3JD7 1;  4GMP 0;  4LIV A;  3ZYI B;  4AVA A;  5C70 A;  3MF6 A;  2X09 A;  5D8A C;  1O3T A;  2OT7 A;  5JI9 A;  3A23 A;  4XUP A;  2A6V A;  4M0N A;  4P9J A;  3MLL A;  4QX2 A;  4YGE A;  5DZF A;  1LR5 A;  4AFA A;  1TQ5 A;  1UOG A;  5FZA A;  1O3Q A;  2RG4 A;  1WME A;  5FXW A;  4WM7 B;  5JR7 B;  4FPJ A;  3RZL A;  1N1T A;  4AFM A;  1Y9Q A;  3H9A A;  2RR1 1;  2RJL A;  3POG A;  5T5L A;  1VBE 1;  2O0O A;  1PIV 3;  1QJY 3;  3ECQ A;  2WSV A;  3TN9 1;  2DU1 A;  1R1Z A;  4HKW A;  2AZ5 A;  2VBP A;  1PK6 B;  4NHL A;  1XRU A;  3I3M A;  4FXK B;  4YW7 A;  1R09 1;  3VL9 A;  1JW6 A;  2ZGL A;  1PZ8 A;  1HN1 A;  1SQ4 A;  2YY1 A;  3PDQ A;  5FZ7 A;  1H0B A;  1YHF A;  1ZM1 A;  4FQ4 A;  1E5S A;  2VME A;  4UBG A;  3VBO A;  1ZZC A;  2ORZ A;  4QM9 A;  5GLV A;  1AR6 2;  4TXW A;  2Y33 A;  4O9E A;  5FMC A;  3VKF C;  5FFO C;  2D6M A;  5FY4 A;  1H6Y A;  5JI7 A;  4BLI A;  4IXL A;  4LBL A;  1NA1 C;  2QQV A;  4CP1 A;  4XHB A;  4XQ4 A;  1OUR A;  3IZO A;  1IPK A;  3ACI A;  1UY3 A;  3AX4 A;  2XLA A;  3ZFF B;  3KCY A;  4D6S A;  3PJY A;  2VW2 A;  1OT5 A;  4C0H A;  5ACA 2;  2Z4F A;  1H6X A;  5BNP B;  4ZU5 A;  3VZO A;  3M7A A;  4O65 A;  1U5X A;  2RE9 A;  1HN0 A;  2UWC A;  4LO7 A;  2XDV A;  4RQP A;  4YM0 A;  3TBD A;  4V1P A;  2DUQ A;  1WMD A;  2GC1 A;  2VG9 A;  2XKO A;  5LBF A;  2MPF A;  2WFF 2;  1MZ5 A;  2F17 A;  5KHH A;  1F5F A;  2QQL A;  3CIH A;  4HMZ A;  5ERL A;  5FOJ B;  1DQ1 A;  3EYP A;  1D2S A;  1F31 A;  3BTA A;  3WF3 A;  1XC6 A;  1JS9 A;  4CDQ A;  2BJS A;  1GNH A;  4LQR A;  4Q0U A;  1QJY 2;  4FFH A;  4JHT A;  1EYB A;  2R1D A;  2SLI A;  3BCW A;  4TLG A;  2DVF A;  1UN1 A;  3DF0 A;  5FKB A;  2RS5 1;  3AMQ A;  1RHI 1;  4RS5 B;  4FP3 A;  1BKZ A;  4IGQ A;  1AXY A;  2R0F A;  3MFA A;  1AR6 1;  2VNV A;  3KCC A;  4AXO A;  3LEM A;  5LBB A;  3VBS C;  5EJ3 A;  4UYB A;  4FAH A;  2G9G A;  1H2N A;  1EV1 3;  4DY3 A;  2QE3 A;  4MOA A;  2IXH A;  4XF3 A;  1H30 A;  3E5X A;  4AHZ A;  3KSC A;  5DAV A;  3VKN A;  2ES3 A;  4AI1 A;  4M01 A;  1CZS A;  5DG1 A;  4CEY B;  2QQN A;  5J48 A;  1S0E A;  1VBB 1;  2IXJ A;  4QHO A;  2WS9 1;  1DCS A;  4XCA A;  1L3J A;  3DUI A;  2LM3 A;  2YRO A;  3EQE A;  4G3Y C;  4B8E A;  4LO4 B;  4DUV A;  3B9C A;  1PGW 1;  2B9U A;  1NXM A;  4FFI A;  4XXA A;  4CZS A;  2Q8D A;  3KCX A;  4Y1U A;  1FNZ A;  2W52 A;  3VZN A;  1W8F A;  4LKE A;  1YNA A;  3ZXD A;  3UL2 A;  2AGS A;  5LWB A;  1OOP C;  2Y6G A;  3VLB B;  1W6O B;  3AFG A;  3DN7 A;  5FTT C;  1TMF 3;  2CGN A;  3T09 A;  4DRV A;  1OKQ A;  1XE0 A;  2J22 A;  4Q29 A;  3M3I A;  5I0T A;  1JHN A;  4CP2 A;  4OUL A;  4DIQ A;  1QJU 1;  2C9A A;  1ENQ A;  4TN7 A;  4O9G A;  4Q4Y 3;  2YPJ A;  4ARX A;  2J1E A;  2HWC 3;  4UF0 A;  3GF6 A;  4NR1 A;  1QQP 2;  3O1T A;  1RB8 G;  1REE A;  1NLS A;  1RIR A;  3UJQ A;  1ZX5 A;  1Y9M A;  2EXH A;  1XB9 A;  2ZHL A;  4Q4X 1;  1JH5 A;  1VBB 2;  1WUV A;  4YM1 A;  2D6O X;  3QOP A;  3KHC A;  4Y1V A;  3ACF A;  2VC9 A;  4WM8 B;  2OII A;  4Q4W 3;  4N53 A;  1PGW 2;  1DGR N;  1UU4 A;  5FV3 A;  1FV3 A;  1GYK A;  5FUN A;  5ABJ A;  2RDR A;  1PO2 3;  1PVX A;  1UOJ A;  4H7L A;  3R05 A;  1UMI A;  1AYN 3;  3UYJ A;  3GBG A;  3WP4 A;  1HKD A;  1CX4 A;  4IEX A;  5CNA A;  1ND3 B;  3QH6 A;  4XIO A;  2EXI A;  2YC0 A;  4C1X A;  3DPR B;  1GU3 A;  1H4H A;  1SCR A;  1QOS A;  2WO1 A;  3BYW A;  3KZ4 C;  3AP6 A;  1MAC A;  3QCW A;  1MZF A;  4N7I A;  1MEC 2;  3OBT A;  5DAX A;  3GBF A;  4FBF A;  1MQT A;  1ULP A;  4LA2 A;  3K3N A;  3DYP A;  4RSU A;  5FP8 A;  3ZXK A;  4YAR A;  1YI9 A;  3KM5 A;  4CDQ C;  1LGB A;  1ZRR A;  1RMU 3;  2GP5 A;  3LF7 A;  4M4R A;  1Q8V A;  1XNT A;  1CAV A;  4XJA A;  1BEV 2;  5IK7 A;  1VBB 3;  1BBT 1;  2E33 A;  3K77 A;  5IVJ A;  1QXP A;  1Y3T A;  4FOQ A;  3AZZ A;  3U0Z A;  4YWA A;  2YU2 A;  2ZEX A;  1T6B X;  5LEK A;  5I8S A;  2JB8 A;  3PUH A;  2VZU A;  4ITC A;  2FCT A;  2OQ7 A;  3RJ2 X;  3IM0 A;  5CAZ A;  4D7Y A;  1OQ1 A;  4YG6 A;  3Q8C A;  4AAP A;  5F39 A;  1S2B A;  3NV2 A;  4QB1 A;  2NP0 A;  2Q8O A;  1RHI 3;  5DMY A;  3AZV A;  2EAA A;  2NM1 A;  4IV1 A;  2ZAA A;  3WNX A;  4CTE A;  2EID A;  5CG9 A;  4QPI A;  4AWD A;  1RUI 1;  1MEC 3;  5DAP A;  2V5D A;  3OTF A;  3PVO A;  2KD7 A;  5T5O A;  3ZIX A;  3H8O A;  1LB2 A;  4IE0 A;  1AYN 2;  3PTY A;  4ORF A;  3S5Q A;  4E2Q A;  3W21 A;  2WT1 A;  2BGC A;  4XFF A;  3ZR6 A;  1OLR A;  4XJU A;  3PU3 A;  4FPC A;  3ACL A;  1Q8O A;  4FCA A;  3ILF A;  3T0A A;  1TE1 B;  3SMH A;  1VAM A;  4BYY A;  2XL9 A;  3VKM A;  1ONA A;  1SLL A;  3V64 A;  4AVS A;  5IFP A;  1JYV A;  4BOW A;  4Q4Y 1;  2VZT A;  3ZO0 B;  4AFD A;  2PAK A;  2GP3 A;  5F8P A;  2WT0 A;  4MGT A;  2JD9 A;  4IDZ A;  4Q2F A;  1EAH 3;  4XTM A;  1GP6 A;  4JDN A;  3AP4 A;  1HB3 A;  1XSR A;  2XLF A;  2BEO A;  3RJR A;  1GFF 2;  4FVV A;  1BMV 1;  2ZX3 A;  1W8N A;  4YW1 A;  1NZI A;  1AX2 A;  2BWA A;  3KB5 A;  2C6S A;  4HET A;  2YG0 A;  4JHZ A;  1AZD A;  2CAU A;  2K0G A;  2PMW B;  3KMH A;  4FOW A;  4LLO A;  3ZFG B;  4CEW B;  4CEW C;  1L7R A;  5BXX A;  4J1W A;  3S5A A;  4XJ9 A;  1HXS 1;  3KT7 A;  1XYO A;  5FZ0 A;  1UKR A;  2AH2 A;  4EZ4 A;  2VCM A;  4YGD A;  3ZVX A;  4NID A;  4OI0 A;  4LOT A;  1UO9 A;  5A6X A;  1VPH A;  2W47 A;  3LE0 A;  3S7E A;  1K45 A;  1BJQ A;  4L0P A;  1W28 A;  3BUC A;  3HQR A;  3AP5 A;  2O8Q A;  3LWC A;  4L8Q A;  4P5H A;  1LGN A;  4Y22 A;  5ACA 1;  3CBN A;  4PDW B;  4HON A;  1HLC A;  2D6N A;  4CA9 A;  1J84 A;  4I0B A;  2Y0I A;  3LPF A;  4DUX A;  1HB4 A;  2EIB A;  1ZBA 2;  3ZXG A;  3M70 A;  2HWB 1;  3PHM A;  4PIY A;  3VBS A;  4IQP A;  5IVE A;  4L2N A;  1B35 C;  3WDT A;  3M8L A;  3ZYR A;  5CA6 A;  4XF4 A;  5C3S A;  1KFX L;  4Y20 A;  5ANQ A;  3C2U A;  5BPX A;  2B46 X;  3APB A;  5EHD A;  1LHV A;  3RMX A;  1PX3 A;  1BEV 1;  4NJ4 A;  5HXM A;  1WLC A;  4LBO A;  1T2X A;  4B1M A;  4IV3 C;  3O1O A;  3W20 A;  3T3Y A;  3BGA A;  4XTP A;  4DUW A;  2CGO A;  5DUW A;  1SAC A;  4S2H A;  2JXA A;  3SQO A;  2VU9 A;  1K5M B;  4XE9 A;  4AQ6 A;  1PMI A;  3III A;  1LCL A;  4YZ4 A;  5BNO C;  3ZFE C;  1SPP B;  5C3Q A;  1V00 A;  4QGM A;  1YIP A;  5JMC A;  2HWC 1;  1FPN 1;  4IE7 A;  2OX0 A;  1HXS 3;  5KC5 A;  2D3S A;  3MFC A;  4JGY B;  3QAC A;  5FK8 A;  4NHM A;  1F35 A;  1W2O A;  2VGD A;  1MS9 A;  3KQ4 B;  2E63 A;  4XAE A;  1HB1 A;  4TWT A;  4EQV A;  2OUH A;  2QTW B;  3ASI A;  4MUV A;  1W04 A;  3N35 A;  5HBA A;  1JZ4 A;  1D4M 3;  3E6B A;  1W0N A;  4EYU A;  3O1M A;  1K3I A;  3PUS A;  1NUK A;  2G9F A;  3FLR A;  2FDF A;  1J59 A;  3WOG A;  4I3G A;  1DQ5 A;  1W2N A;  2P6C A;  3AJY A;  5T5J A;  3RI8 A;  4Q4Y 2;  5C5U A;  4D94 A;  5F3E A;  1ZZ8 A;  4AGR A;  2MHF A;  4PIZ A;  4YVS B;  1YI7 A;  2XJR A;  4Y24 A;  2WR9 A;  2YV8 A;  1S2K A;  2WAB A;  4LMF A;  5A32 B;  2WL1 A;  3CJI A;  3MUZ 1;  4BWO A;  3JQW A;  5C33 A;  4CU7 A;  1Q56 A;  1UY1 A;  1QDC A;  1W6P B;  2ET1 A;  4EE2 A;  5ABJ B;  4URT A;  4CVU A;  5FZ9 A;  2DTY A;  3FLT A;  4N9H A;  1H8V A;  2F4P A;  3J9S A;  3T1L A;  3IKW A;  4YG3 A;  1BZW A;  4COU A;  5I8T A;  4LR4 A;  1UMH A;  2TUN A;  2AR6 A;  3WZ1 A;  5IAX A;  4GMP 1;  2P2K A;  4QKB A;  1Y4W A;  5T3N A;  3OD0 A;  3T1M A;  1HJG A;  1RUC 3;  4N43 B;  4GJZ A;  5KC6 A;  1OFN A;  4RR3 C;  4GWI A;  1NT0 A;  1V9U 3;  3R4S A;  1REF A;  4A3X A;  4E8C A;  2IUW A;  5A7W A;  5KR7 A;  3BOD A;  3RZZ A;  1IS4 A;  3H1Y A;  1W6M B;  2HWB 3;  2ZOE B;  1W3X A;  3MIC A;  1GQP A;  5FLI A;  3TEX A;  3D8C A;  4I02 A;  2O8O A;  1D0H A;  1FPN 3;  4GWM A;  4QGN A;  4ZZ5 A;  2FZ1 A;  3U4X A;  4KGG A;  5IJR A;  2A7A A;  1MQT C;  2JKX A;  3ZSJ A;  2D44 A;  1EPZ A;  4NUB A;  1Z78 A;  4OHZ A;  4IGP A;  5IFT A;  1Z0H A;  2VL4 A;  4ZS2 A;  3RYR A;  3T2O A;  5IAV A;  4GH4 C;  2VZV A;  3POB A;  2I2S A;  4P9X A;  4PF5 A;  2VD7 A;  3W58 A;  1LEC A;  2HWF 3;  1TEI A;  4S2G A;  2XBO 3;  2YGL A;  1LUL A;  3JU9 A;  1FOD 2;  2VMH A;  3J7N A;  2XJQ A;  2XQR A;  3HR9 A;  2ZCW A;  4GB3 2;  1OVS A;  1BEV 3;  1FYU A;  2ZX0 A;  2CNA A;  3AK0 A;  4GAL A;  2YXS A;  4BPZ A;  3HAG A;  3ZLI A;  3J7M A;  2VVF A;  5JPN B;  1UYZ A;  5FZD A;  4CUA A;  4ES8 A;  4A45 A;  3WNK A;  4A3Z A;  5GKA C;  2CSG A;  1GP4 A;  2ZGS A;  3JXS A;  3EBR A;  1RIT A;  3GGL A;  2XJU A;  3GZE A;  4SBV A;  4QMA A;  4GKY A;  2J1T A;  1JUI A;  2VW1 A;  4BE3 A;  2JDN A;  3ROU A;  3MID A;  2RS1 2;  1LAJ A;  2R04 3;  1DIW A;  2HH9 A;  4PQQ A;  4QB6 A;  4OLL A;  4R52 A;  4FTB A;  4H2A A;  1XPW A;  4LTA A;  5GZD A;  4YM3 A;  4XF9 A;  4OUS A;  4QU2 A;  2VVE A;  3ZSL A;  3POW A;  4ISR A;  4QT6 A;  2VO5 A;  2YC4 A;  3LDR A;  4YPJ A;  2PHD A;  4QAW A;  2R49 A;  2WFF 1;  1HV1 A;  1C8N A;  3K4D A;  5C7G A;  3QD6 A;  3OD4 A;  1GIC A;  5FMB A;  5CFD B;  5JOZ A;  3LEG A;  5CG8 A;  4IE6 A;  5D8A A;  5FP9 A;  4ASK A;  5FIX A;  3AKS A;  4HN0 A;  2E53 A;  4UW3 A;  4XCB A;  5FWE A;  3AZX A;  1B35 B;  3S30 A;  2Y0O A;  5BYN A;  2IVI B;  1FOD 1;  3DKQ A;  2XBO 2;  5GZE A;  4X6Q B;  2XON A;  3HQX A;  2VJX A;  3N9O A;  2WNU C;  5F3C A;  2C26 A;  2GMM A;  1G8W A;  1N1S A;  1UYY A;  4R9C A;  3VL8 A;  5A6Y A;  2RS5 3;  1YJL A;  1DP0 A;  3JQX A;  5GZC A;  4XVH A;  4C90 A;  3BU0 A;  1UZZ A;  2JJ6 A;  2YC2 A;  5A3L A;  3WLU A;  2VCA A;  4BLJ A;  3WP6 A;  1S0G A;  2XWJ B;  1KS5 A;  5HCB A;  3OPT A;  2D93 A;  3ZMN A;  2JKB A;  1X8M A;  4GD4 A;  5BNP C;  3N36 A;  1AR9 1;  2AEY A;  2VQT A;  4NII A;  2CL2 A;  4JDO A;  4LHK A;  4AGG A;  2V73 A;  2VZQ A;  4QHB A;  2ZEW A;  4OZO A;  3U4S A;  2CTV A;  1R09 3;  4NVP A;  4AOC A;  1RUN A;  4KWL A;  3NNF A;  2XL7 A;  4F3J A;  1RUG 1;  4QQO A;  4JTN A;  3NJZ A;  2LUW A;  1RUH 2;  4JGZ B;  2D5H A;  2DYC A;  4B3N A;  5JIU A;  1OQE A;  1W8W A;  3JBG 1;  2YGM A;  3VUO A;  1W8O A;  4JKK A;  1YYN A;  2A6Z A;  2BUK A;  2VXJ A;  3IB3 A;  2BZD A;  1ZBA 3;  5DAW A;  3J8F 1;  1D2Q A;  1OQD A;  3GHM A;  4KNC A;  1SMV A;  2ZXQ A;  3ACH A;  3UGH A;  4S2D A;  1GAN A;  2BP6 A;  5CFD C;  3V0B B;  3O0X A;  4QX5 A;  5AFB A;  1QGL A;  2WZ8 A;  5GLU A;  5HPO A;  3I97 A;  4COY A;  2YU1 A;  4EN6 B;  3IWZ A;  3UK9 A;  4LOS A;  4MO3 M;  4EN9 B;  2VMF A;  4EN7 B;  3H7Y A;  1WA6 X;  3NAP B;  2WA4 A;  1PIV 2;  4K7J A;  3USU A;  3BPS A;  3RYK A;  4HVR A;  2RJK A;  3W59 A;  2B45 X;  1W6N B;  4GJY A;  4MHU A;  3VBR B;  2FDH A;  1BCX A;  1KXG A;  1R09 2;  3KWV A;  4HXC A;  1MS0 A;  1IG3 A;  2IFW A;  1VBC 3;  4LBQ A;  4MGK E;  4UW4 A;  3WIN E;  3O1P A;  2GC2 A;  3QH7 A;  2ARB A;  2GH2 A;  3E6C C;  2A6Y A;  2P4E A;  1FMD 1;  4AK3 A;  5JSO A;  3BTX A;  1CPM A;  3TNQ A;  3FZ3 A;  1CAW A;  2ZGP A;  4N53 C;  4AEK A;  1BYH A;  3ZN6 A;  1JZ6 A;  3ACG A;  4OUE A;  2WNU B;  1GOG A;  3AL6 A;  1CVN A;  4BCU A;  3C7G A;  4NWW A;  4Z8B A;  1W6M A;  4BIS A;  2X29 A;  5JOW A;  4PLO A;  3M2M A;  3VB9 A;  4JRA A;  2VCC A;  1RUD 2;  1FNY A;  2ADE A;  2WQ4 A;  3OGR A;  4MET A;  3VHO A;  3KV9 A;  5FZ3 A;  1KJR A;  3ZDV A;  3WHU A;  2WLP A;  3DEC A;  2EIE A;  3N9M A;  2JIJ A;  4PLM A;  1QNW A;  5C71 A;  1N3Q A;  1UPS A;  3ZN6 B;  1PNG A;  1WMF A;  2GC0 A;  5APA A;  5FO8 B;  2BW8 A;  4E4Z A;  1G6N A;  1ND3 C;  4P9I A;  2HWD 3;  3U14 A;  1X8E A;  2NQY A;  1YQ5 A;  4CUB A;  1HDK A;  1YQC A;  5LRR A;  3X29 B;  4CDU A;  4PCR A;  4WVV A;  4DEQ A;  1YQ8 A;  1W9Y A;  5CIR A;  1D0G A;  3EB7 A;  4AHY A;  1O4T A;  1AR9 2;  4HL0 A;  5JXG A;  3FBM A;  1ZZB A;  1AL0 G;  3AMH A;  3CZU A;  4JV4 A;  4AI2 A;  1W8H A;  3J26 N;  2WII B;  4NIG A;  2YFU A;  5GJ6 A;  3AM2 A;  5GZG A;  1XSQ A;  4YW4 A;  1RUG 3;  4W65 A;  2ARA A;  2VXR A;  3U78 A;  2X10 A;  4C8D A;  2XVG A;  1SFP A;  1IQA A;  2XH6 A;  2Y34 A;  4XBQ A;  1MVE A;  4YVW A;  3WUD A;  3LZZ A;  3F2Z A;  1RVF 3;  1A6C A;  4BIF A;  4GZ9 A;  1SFY A;  3IDB B;  1QDO A;  1YJK A;  3WX5 A;  1GKB A;  3JB4 C;  4OHX A;  4IES A;  5D8A B;  4MZU A;  5FKC A;  1NCR A;  1YUD A;  3GNE A;  1V6K A;  5FXV A;  3ILN A;  4JDM A;  2E31 A;  4OVE A;  5F2W A;  4Q0S A;  5A7S A;  4ATE A;  4UXA A;  3I59 A;  4CCC A;  2R0H A;  2YB7 A;  2RM2 1;  2SBA A;  4FFF A;  4UFK A;  3JD7 2;  1NE6 A;  2W94 A;  4AVV A;  4IE4 A;  3S6P A;  4QPY A;  5F37 A;  3I7D A;  3MW4 A;  3CMG A;  2G9Z A;  3JBG 3;  3MLK A;  1LHU A;  1NZC A;  2TNF A;  3I2O A;  3OGV A;  1PM7 A;  4RA0 A;  5FZH A;  1RXF A;  1BMV 2;  5FP7 A;  1OPO A;  1ZA7 A;  3UJO A;  3ZFG A;  2IXI A;  2QVS B;  4CCE A;  2VY0 A;  4GXL A;  3TEZ A;  1E5R A;  1GNZ A;  4I09 A;  5EP9 A;  2VNR A;  5FZG A;  5FZ6 A;  1TZO A;  3ZN4 A;  1NX9 A;  3MZH A;  4N43 A;  1XNA A;  2BTV C;  2W0X A;  3C7E A;  4NPL A;  4RGG A;  1UXX X;  4QGL A;  4Y22 B;  2EIC A;  1ACC A;  5K7P A;  5DAB A;  4LNV A;  5FZC A;  4CUC A;  5B4X A;  4E8D A;  1XQN A;  2W1S A;  3I2F A;  4XJW A;  5L73 A;  2X05 A;  4BXF A;  4JGZ C;  4Y33 A;  1PO1 2;  3VBS B;  2AUY A;  3AVR A;  2JDA A;  2Y6F A;  5ANN A;  4PLN A;  3VBU C;  2LW8 A;  2EF6 A;  3L9J T;  3SLI A;  3OBA A;  4OYU A;  3RWN A;  2BU9 A;  1LTE A;  3WD5 A;  1AL2 3;  3AYA A;  2WNV B;  3IN9 A;  2PHF A;  3KF3 A;  2EVX A;  2DFC A;  1Y7B A;  1RJ8 A;  3HN1 A;  4JGY C;  4YVW B;  4YYO A;  4NIA A;  1EUT A;  2I45 A;  1W8T A;  5HCF A;  3A7Q A;  5FZI A;  2P17 A;  4UW6 A;  3FN9 A;  1R64 A;  2QQP A;  3KV6 A;  3VBU B;  1Y43 B;  2PLV 2;  2JG9 A;  1UF2 C;  3I2K A;  3PUI A;  3ZFE B;  5EIY B;  2JIG A;  4XAC A;  4DXT A;  1H8T A;  2Q8E A;  1DQ4 A;  4LHS A;  3SIS A;  1A3K A;  1HV0 A;  3A0N A;  4RS5 A;  2VCB A;  3O0W A;  2QFE A;  1U0A A;  5FY1 A;  4Q8L A;  4Z1V A;  4IV3 B;  2ERF A;  4CDU C;  1PO1 3;  2ATF A;  1ODN A;  2UY8 A;  1RUE 1;  2W91 A;  3OUH A;  4PF1 A;  3BVC A;  5CFD A;  3ATG A;  1J83 A;  2RMU 1;  2BQP A;  2DUO A;  2XR4 A;  4RGA A;  5BNN C;  2YZ4 A;  4UFM A;  1QQP 1;  4LE4 A;  4BU2 A;  4X8P A;  3KF5 A;  4GWN A;  2KA3 A;  2C5D A;  4ZY9 A;  1HRV 2;  3ZXA C;  1QY4 A;  2ADD A;  2HEW F;  1RUF 1;  2RDQ A;  3BOW A;  3MIH A;  4A7K A;  1LES A;  1WCK A;  4COW A;  1E5H A;  3NNM A;  1V6O A;  4Y20 B;  4Y5Z 0;  4KWJ A;  5FJH A;  3VDA A;  1LU1 A;  3MPB A;  4X6R B;  2GC3 A;  3MYX A;  4RFR B;  1RUI 3;  3UKT A;  4AVC A;  4BQY A;  4MGZ E;  2BFU L;  2R04 1;  2W87 A;  3RGB A;  1MS8 A;  3WDY A;  3B00 A;  4LBQ D;  1OMI A;  3SKJ E;  1R1A 3;  1MR5 A;  2WYS A;  2PN5 A;  1IPJ A;  1H1M A;  2ZS6 B;  4NIH A;  1VBA 3;  4A42 A;  4AED B;  4HFS A;  1NOV A;  3ZOI A;  4KI5 M;  1UOB A;  5LCW L;  5KHJ A;  1VBC 1;  2P3I A;  2IXK A;  2C9K A;  3KVA A;  4P5Y A;  2VNG A;  3SH3 A;  3KV4 A;  3OGG A;  3THC A;  1JYW A;  5CKM A;  5FY0 A;  4AI9 A;  5F32 A;  1LED A;  4CDW B;  1OHF A;  3I8T A;  2OXB A;  1JZ3 A;  1ULO A;  4PT6 A;  4V2V A;  4XQD A;  4YM2 A;  4CCN A;  5GLW A;  1D7P M;  3NO8 A;  2WNE A;  5LAT A;  1AR7 3;  1RUJ 3;  1YRZ A;  1W2T A;  4JX0 A;  3MV1 1;  4UFI A;  3WUC A;  4TZD A;  3P6B A;  1VB4 A;  3BOP A;  3HEI A;  4GQ7 A;  4X8N A;  4LBQ B;  1AL2 1;  2VQ0 A;  1S4C A;  5K9Y A;  1JOP A;  1S1A A;  1JI6 A;  1GWL A;  4L99 A;  4QHZ A;  3GM8 A;  1O3R A;  2DFB A;  2QQJ A;  4XIL A;  1AR8 1;  3H8U A;  3J7L A;  2HWE 3;  4M3C F;  4QDS A;  1W90 A;  1IS5 A;  1CAU A;  2P6H A;  2W1U A;  3O1R A;  2FD8 A;  3FE5 A;  1F4H A;  5FR3 A;  2ZGK A;  1W6P A;  4EN0 A;  2VW0 A;  3AVS A; 
#chains in the Genus database with same CATH homology
 1ODM A;  2WO7 A;  2Y6F A;  2DBN A;  2JB4 A;  1GP5 A;  2VBD A;  3ZKU A;  5C3S A;  1E5S A;  1BLZ A;  1W2O A;  2Y60 A;  1RXG A;  3ON7 A;  2DBI A;  4XAE A;  5APA A;  1OC1 A;  1HB1 A;  1BK0 A;  1QIQ A;  1RXF A;  2BU9 A;  1OBN A;  1ODN A;  2BJS A;  2VAU A;  2VCM A;  2BRT A;  1UOG A;  2IVJ A;  4RGK A;  1E5I A;  1W05 A;  1QJE A;  1W04 A;  1IPS A;  1UO9 A;  2JB8 A;  5C3O A;  1QJF A;  1UZW A;  3OOX A;  1HJG A;  1E5R A;  1DCS A;  5C3P A;  4BB3 A;  1W28 A;  1W9Y A;  1W2N A;  2CSG A;  1W3V A;  3ZKY A;  1UOF A;  1GP4 A;  3ZOI A;  1W3X A;  1UOB A;  1W2A X;  1GP6 A;  1W03 A;  1HB3 A;  1HB4 A;  1UNB A;  1WA6 X;  1W06 A;  2VBP A;  2VBB A;  2VE1 A;  5C3Q A;  5C3R A;  2IVI B;  1HB2 A;  1E5H A;  1HJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...