1E5UI

Nmr representative structure of intimin-190 (int190) from enteropathogenic e. coli
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
187
structure length
187
Chain Sequence
b'TLTIDDGNIEIVGTGVKGKLPTVWLQYGQVNLKASGGNGKYTWRSANPAIASVDASSGQVTLKEKGTTTISVISSDNQTATYTIATPNSLIVPNMSKRVTYNDAVNTCKNFGGKLPSSQNELENVFKAWGAANKYEYYKSSQTIISWVQQTAQDAKSGVASTYDLVKQNPLNNIKASESNAYATCVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTIMIN
publication title Structural Basis for Recognition of the Translocated Intimin Receptor (Tir) by Intimin from Enteropathogenic E. Coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Intimin
total genus 27
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2000-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF07979 Intimin_C Intimin C-type lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1e5uI01
3.10.100.10 Alpha Beta Roll Mannose-Binding Protein A; Chain A Mannose-Binding Protein A, subunit A 1e5uI02
2RIDA 1G1SA 2GGUA 4MTHA 1BJ3B 4KZVA 1V4LA 1IODA 3ALTA 1R13A 3C8KD 1BUUA 4E52A 3P5HA 1C3AA 5K8YA 1UEXB 1JWIB 4QKJA 3G84A 1PWBA 3CCKA 3NCWA 1QDDA 3UBUB 4EZMG 4WUWA 4GJXA 1J34B 3BDWA 2GO0A 4WCOA 1KWUA 1WT9B 3WBPA 1IXXA 3GPRA 4GKOG 1TLGA 4CSYA 4AQ1C 2IT5A 1K9IA 4GI0A 3G8KA 3CDGE 3WWKC 3P7GA 3VLGA 1KZA1 3FF9A 2ZIBA 4KMB1 1KZD1 1T8CA 1F02I 1B6EA 3BX4B 1YXKA 4J6PA 3IKRA 2RIEA 2VRPB 3K7BA 3RS1A 1ESLA 3P5FA 4IOPA 1MPUA 4J6QA 1X2TB 1KZB1 2OS9A 3P5DA 1U0NB 1FM5A 1LITA 1KWZA 1V4LB 1IODB 1WT9A 1KX0A 1C3AB 1R14A 2MH4A 1RDL1 2LS8A 2M94A 1P4LD 1SL4A 3FD4A 3VYJA 4AK8A 1H8UA 1KWWA 3BDWB 3WBRA 2BPDA 1IXXB 3GPRB 2OX9A 1B08A 1Y17A 1J35A 1AFA1 3P5GA 4N33A 2MSBA 4N36A 4N38A 3WH3A 5B1WA 2RIBA 1G1RA 1X2TA 3WH2A 4C9FA 2IT6A 1K9JA 1YPUA 4N35A 2PY2A 1RTM1 1MSBA 1JZNA 4GJ0A 1KZE1 2ZQKA 1RDO1 1MUQA 4C16A 1HUPA 1PW9A 4N34A 1BV4A 1HYRA 2C6UA 4IOPB 3KQGA 2N40A 1RDI1 1E8IA 2OX8A 2RIAA 4ZRWA 3P5IA 4WQQA 4KZWA 1U0NC 1WMYA 1KZC1 1BYFA 1SB2B 3CFWA 3FF7C 1XPHA 2N7SA 1TN3A 1V7PA 2I83A 4QKHA 4WREA 3HUPA 1E5UI 4UXMA 3WBQA 1Y17B 1J35B 1DY0A 3GPRC 5FFSA 1TDQB 1U0OA 1BNLA 4J6LA 1JA3A 3PBFA 4LU5A 3P5EA 4M17A 3VPPA 1O7CT 2H2RA 1OZ7A 2VUZA 3PARA 1KWXA 3G83A 1SB2A 1UV0A 1F00I 1BCH1 3T3AA 4QKIA 4HU8A 4J6NA 3ALUA 1FVUA 1G1TA 3CDGF 4KI1E 1FIHA 1QO3C 1V7PB 1SL5A 2L04A 1KWTA 4LQFA 5F2QA 3ZHGD 3CADA 2BPEA 4N37A 2E3XB 4QKGA 2BPHA 1WMZA 3G81A 1RDK1 3ALSA 1UKMA 5J6GG 2MTIA 2AFPA 1IJKB 1AFB1 1U0OB 5B1XA 2YHFA 1KCGA 1YTTA 1CWVA 2VUVA 5M62A 1BCJ1 3WSRA 1G1QA 1E87A 4ZESA 4CAJA 1DV8A 4AQ1A 2XR6A 2MOGA 4GK1A 1OZ7B 4J6JA 1XARA 3KMB1 3WWKA 1X2WA 3NCXA 2ZWKA 3WHDA 2KMB1 1GZ2A 4WRCA 3P7FA 1UMRA 1WK1A 3IKPA 1FIFA 2GGXA 1FVUB 4PDCA 1KOEA 1DY2A 2XR5A 2KV3A 4WUXA 1RDJ1 4M18A 1RDM1 1UOSA 3C22A 5LGKE 2BRSA 1YPQA 3L9JC 4G9AA 1RJHA 4G96A 4ZETA 3GPRD 3VYKA 1KWYA 4J6KA 4ZRVA 5FFRA 3C8JA 1BJ3A 4DN8A 3M9ZA 1UMRC 1KX1A 5B1RA 1RDN1 2E3XC 1SL6A 1UKMB 2ORKA 4WRFA 3PAKA 1KMB1 1HTNA 1UEXA 1JWIA 4S0UA 1P1ZD 3DBZA 4YLIA 1AFD1 3UBUA 1IJKC 2MQGA 4N32A 1J34A 5KTIA 3IKQA 1KWVA 3G8LA 3IKNA 1KG0C 2PF5A 5KTHA 2CL8A 3ZHGA 1HQ8A 3WWKB 1O7BT 1X2WB 3P7HA 4UWWA 4M1GA 2RICA 4YMDA 5FFTA 3FF8C 1DY1A 3BX4A 4PP8A 1EGGA 1UOSB 1YPOA 2VRPA 1T8DA 4WR9A 2H2TB 1EGIA 2ORJA 3PAQA 1YXJA 4J6MA
chains in the Genus database with same CATH superfamily
4PGEA 3EO9L 4M4RA 3LV3B 3LRLA 1BF5A 2ZWLT 4B5EA 5KSAA 1EWHA 4PI0A 1KJMB 2AV7B 3E3QE 2F1AA 4G1EB 5LBSA 3ZRFC 4MASA 4M43H 5GJTL 4IRZH 3QUMB 4HT1H 3U4KA 5AKVA 2YK1L 4W81A 4XCFL 1F90L 1XTMA 3PXHA 1S3KH 5GSRB 3WEXA 5L88L 4JR9H 1FZOA 2R1XA 3ZHLA 4EN3D 2FCBA 2EYRB 4PJIB 4TTDD 1J88A 3CCKA 5ERWA 4B3VA 1QEXA 1QVOB 1RUAL 2W8CA 3UMNA 5FYKD 5HY9B 4PJEE 3Q5YA 5GGTL 2C4FU 3FU9A 2WINB 3CLFH 2A99A 1XBRA 1YDPB 8CGTA 2DQEH 4WWKB 4HU2A 3KYMB 1CCZA 1CD8A 1IXXA 1Y07A 4I3GA 1ETZB 1S2EA 2H5UA 1XR8B 4TLTA 2IOOA 1TLGA 4IDLA 2LTQB 3HKZA 3IDJA 4OF8A 3HMXH 4HOZA 5SWZE 2AK1H 4G8AC 2IT5A 3QT2A 3VFGH 2BY1A 3GMOB 1A2YA 3WAJA 3CFNA 1L6XA 2IGLA 5IMMB 3VQ1C 4BK4A 4ZYKA 3F00A 1WT5C 1EHAA 2JB5H 3IKKA 1G6RL 4R4NC 3GJFH 4N8UA 4PJIE 3GF8A 4UQEA 1DBJL 3D3VA 4P2QE 1D5MB 5KVGE 5DD3L 5E8OA 3CSFA 3NAAL 3KPQA 1KYOK 2FJGB 3QAZB 1ZSDA 1JNHA 2IQ9H 1CXHA 4ISVB 4H8WC 4Y1SA 4YFLI 1A6ZA 1O6SA 1C16A 2EE0A 3IKRA 3WS3B 1H6UA 1S5IL 5C7ZA 4A68A 3RI5F 4WEBL 4JREB 2AEQL 4NN6B 4X6CF 5KVDE 4IOPA 1PEZA 2R2BA 4I13B 5IY5B 3C5SA 3QEUA 2OI9C 3RE0A 5GS3A 2JXMB 4AZ8A 1J0ZA 1HHKA 2D9CA 4NOBA 4XRCA 4B6ZA 4PJAB 3UIYA 3RKDC 3JV4B 4PBDA 4WI3A 3DUHA 2NXZC 3EOBA 4V1DD 2NY4C 4U1SB 5IF0B 2N7AA 3CZJA 5EOCJ 4NQEB 3AREC 2NUTB 1R14A 1YYLH 1ADWA 1VZGA 3V9EA 3VFRB 3QWRA 4JJHA 1CDYA 4C54A 2K1MA 1J7VR 4NGHH 2ZYIA 4GW5B 3LEVH 3FQWB 3HI5H 3MNDA 1YEGH 3PCYA 1VFAB 1JBJA 5JOPE 4HPYL 1JGDA 2NRDA 3TCLA 2YAHA 3BC9A 4Z77A 5CJ5A 4FQ1L 5CNHA 5F7UA 2WLKA 3JSSA 4CSZA 3RY5A 3FN0L 4F2MA 3UXFA 1J1OL 1KLGA 3FT4B 3GIVA 2VDNL 4PIBA 4UT9H 1INDH 1HE7A 4BIKA 1M7IB 2YPLA 4UTBL 4KKAD 1KLFA 2WYIA 5BVPL 3UL4A 4X98B 4NQEE 2O5YL 4IRSD 1M4KA 4KFZC 5ICZB 3WE6A 1EERB 1MN4A 4B9PA 4OZIF 1UZ8B 1CGXA 1RD6A 3WIIH 4FQLL 4F37F 4UYPA 2CDFB 3S3CB 5IQOA 5J6HA 3X1FA 1SLVA 2B9AA 2WSKA 4H20L 3UAJD 2Z8WC 4FQCL 3FT9A 5F7MC 2AAVA 2FWOA 1HQ4B 2K9UA 3DOSB 1BF2A 1YMHB 3MUGA 2DQTH 3S3PA 1WIUA 5F3BB 5MEQA 2O61A 1KZE1 4OFQA 4J3SA 1XF3A 1FJ1B 1GY2A 1KGCD 3PNWA 4OQTL 4PU2A 2CCWA 3WJLC 5I15H 5IMOA 3MPCA 4CNIB 3ALPA 3QXAB 2WLJA 3BHBA 4TXVB 5IHUH 2HVKA 4RWYL 2QADC 2L0DA 2P7TB 2FYYA 4CN1A 5I1GH 1E8IA 2DF3A 4OR1A 4X4XA 2RIAA 1MVUA 2V5TA 1ZEAL 1T2QH 2EP6A 1W16A 4ZRWA 2YGNA 5C0FA 5D7IA 2P24A 5A2LH 2NY0C 25C8L 1U8NA 4JHBA 1P4LB 1WMYA 4ZFZA 3L48A 3VXUA 3K1KC 5BCAA 1D6EB 3NABL 4FYSA 1P69B 2ALAA 3IJEA 3P2BA 3RWJB 1NDMB 4K3JH 1LDPL 3KXFA 4BZ1H 3ZKQD 5C3LD 1M1XB 1HIMH 3AG2B 5C9KA 3OHXB 4AIZA 4Y4KA 3PIQB 4YSTA 5DRNB 5L4IA 3MRJA 1TZ8A 2ED6A 4PR5A 3T1FB 3PL6D 1L9RA 3ES6A 4GSUA 3ZHKA 3UTTB 4WDIA 1GA2A 3SQOL 2H26A 4PB0H 5DDHB 5ALBL 1DE4A 2P45B 2BCKA 4O4YL 3GBMH 4WZ9A 3QDJD 3BJLA 2MKWA 1ZOXA 1ZPUA 4L1DA 4PSRA 3ELQA 1J9TA 1FNSL 4JHAL 2IPKA 2BIIA 4X7DC 5JIHA 1X7QB 4GMTH 2QQNH 4OUUA 3T3PF 1J35B 3WNNA 1RK0A 2G75B 3H3PH 5HDQL 4X6BA 3QNFA 2W38A 4U1GC 4ZPVA 5FUOL 2WWMC 5HDRA 1BM3H 4KQ4H 3ZSTA 4J6LA 1V10A 2HTKC 4XAKE 1I1AA 1FYTA 4I3SH 3HHRB 3ROLB 5I75C 5E08L 1QUPA 2DIBA 2E74C 1U91A 2QQKH 4CBZA 3DIFB 3FQXB 5CGYD 2ALWA 3TTSA 4O51A 4R9HA 3DYPA 5EO1A 1XIWC 1UURA 3UTTE 5I0VA 1Z0MA 4L8DB 2WXLA 2YS4A 3QO0B 1RMFL 5D96B 5I6LA 4Z6AT 4U6XB 1CXFA 3ECWA 5B3NA 3QZWB 1NUGA 4TS6A 4PJ9D 2OA9A 2XQYA 4JQIA 1CE1L 5D7EA 2QPUA 3NJMA 5E0FA 3S3JA 3TBSA 1X5IA 2R4RL 1X5HA 3VFVA 5GZND 2AJVH 4Q7DA 2OMXA 3TEUA 4OLVL 2EDEA 4LEXL 3SDAB 3HE6D 4HU8A 4GS7C 2C9VA 2N7BA 3OF6A 3QYMA 1HHHA 2BDNH 5E23A 4BFIA 2QSQA 1BREA 2CIKA 2HH0H 5FOBB 1Z6JT 5I66B 4LHUB 4G8GD 1A14H 4M7LT 7PAZA 2C3VA 1CICD 1SHXA 2KHAA 2BVOA 1ORSB 4TNGA 3TH2T 3MRIA 1EAQA 1LGVA 2Q2LA 3S8FB 1HCYA 1QSZA 3HG2A 1ES0B 5JLZB 1V7PB 1A3LH 4YAQB 2BW4A 3BSZH 2VZOA 4HGKC 1VCAA 2Y6SC 1S8DA 4M48H 5ILTL 5E95B 1KIPA 3M88A 1OP3H 4N2LA 2DMGA 3TA3D 1YEJH 5KYWA 4K07A 1WA1X 2CNYA 4J27A 2BIHA 2BPHA 2DKMA 3OKEA 3NUKA 4JKPL 4AM0A 1FNLA 4IKJA 4UT6A 5KVGL 3GM0A 1CIDA 4HEPG 3SDDA 4C58B 1FAKT 5TQ0L 2XQBH 2E9GA 2WB7A 2VMDA 3VXTB 4FXLA 1KTBA 2ZF9A 3S4SA 4XO5A 4NYLB 4XCEB 5KVDL 3CJJA 1IC5H 3BFOA 3CPLA 3MV7A 2VQ1A 4RGOL 4DGVH 2AQ2A 2DQUL 5DGRA 4BK5A 4QRPE 1OOWA 2APTA 4JANB 5FIEA 4V2BA 4GI9A 1L5GB 3QDMA 3RFZB 3HMWL 1H0DA 3GB7A 4AY0A 5LAXA 5J11B 3TZVC 3BVTA 2ZWSA 2BNQE 2ZUVA 2Q76B 4RMTA 4R26H 3VI4A 4P4KB 3CV5A 1UM6H 3V4LA 1GOFA 3HLAA 4NQUA 2XJLA 1JHTA 4Y5YB 3EW3B 3PWVA 4YHLH 1MQ8A 1TOXA 3V4VH 5F3FA 5DJYB 3ZE0B 5GXBB 1GRWA 1NCAL 4HKXA 3MNMA 5DXWA 4LLDA 3WKPA 3L3IB 3MNWB 5F9JB 4X4MA 4OI8A 2OX5A 2MCPH 3K6NA 2VITA 4G9FB 4KJWD 4Z7NB 3GHBL 1KOEA 2AGJH 4FOMA 5AZEH 2D7OA 1A1OB 3OPUA 1LEKB 4Y5XC 2VSDA 2PYFB 2ZKWA 3FHAA 4LDLB 3ZO9A 4FNPA 1WAAF 4P59H 5F71A 4F8NA 3WI9A 2HUEA 4LARH 1WZAA 5DMIL 1OF0A 3BAIA 4X6EB 3W9EB 2V2WB 3DX1A 2XTLA 2P43B 3MOBL 1G0XA 4ILDA 4G96A 5I73B 1NMCB 1KWYA 4HEMA 4PJ8D 2XC8A 3GS7A 3RY6A 4HPHA 3CSGA 3NJFA 4OCMC 1AHWB 1JN6A 4Y9FA 3QEQE 4NRYA 5SWQB 2D0FA 3I02A 3IDUA 4YPGA 2DYSB 3RWHB 4PY8J 4NJAH 4AEEA 3N04A 2XY1A 1EJOL 1MAMH 1KJVB 4Q8BA 1T0MA 1E7VA 5HDBE 3TWCH 1VGEH 4WUUE 1PDKB 4HJSA 2P49B 3LKQB 4G11A 3U0TA 2R59A 1DQJA 4JM2A 3BZFB 3GD1C 1EDYA 5FO8B 1QFUH 1IX2A 4M3HA 3ULUH 4UOW1 5KVEH 2PW1B 5SWZD 4I87A 1NFKA 4X4KA 3TO4A 4NKDB 4MNGB 5C09E 3WNJA 4YUEL 1I3GH 1R3IL 1TVHA 3COOA 3FH8A 5T1KD 3IKQA 1W91A 4A04A 5GSVA 5TDNB 2A73B 4QXGH 2EEBA 1JMZA 1KTDA 1J10A 3OJMB 3MODL 1C8QA 2DYPA 3KPSA 1KJ2A 2I85A 1Q72H 4JUTA 2IAMA 3WFHB 3WEOA 2ZUWA 3U36A 1KN2L 4ANXA 2J57A 4JPVL 3GWJA 3U46B 4N4YB 4JO1H 1GXEA 2WXFA 4KU1A 4K9JA 4LSVL 4C83B 1BXUA 4FQJH 4N0YH 1DLHB 5EEUA 3N40F 3NIGF 1G1OA 3WFCH 4ZFGH 2PWFA 1JK8A 2JFCA 4R7NA 4L0PB 1IAKB 2AJSL 4L8BA 5ECGA 2PO6D 2H3KA 4UV4L 4FXGA 2VERN 4AYMC 2ICEC 2UY6A 4E9VA 4PWGA 2FNBA 1A25A 2WLIB 4XVOA 1TJIL 4YK4B 5IK3B 3W11D 1YPZA 3MRPA 3WELA 3LKOB 2EZ0C 5H37H 4N0CC 4YQXL 1FA4A 3IK2A 1M2VA 3GINA 1D9KC 4FMVA 5DEGA 5E8PB 4DP7X 1ZLDA 4EI6A 2J8UA 1OCOB 1WLHA 3ABKB 5KTEL 4Y7OC 3KVPA 1Z1WA 2JKIS 4Y2DC 1GH7A 3J27A 1E27B 4KJYB 5K1NA 4DW2L 5DD0H 3TEXA 4U6HA 3VH8B 2H2SC 5JUEH 3MCLH 4NNYB 1K2DA 2ZUTA 5D7JD 1DBBH 3LKRB 3FCSA 5JOPD 3P5HA 3WFEH 1MG3C 1F3DJ 1MNNA 2BW5A 4OCRH 3OPZH 1KGJA 3QXTA 3WS6C 1U93B 1A7OL 3SYQA 4K3GA 3EZ8A 1PWBA 1TPXB 1FGNH 3I6KA 1NGQH 3GQFA 3IT8D 3D0VA 2VW6A 3KGRA 1H3VA 4FG4A 3MTRA 3WNMA 2I07A 1WS7A 4N5ED 1J34B 3FSVA 4NQED 1I8IA 1SN2A 2ZTBA 5C86A 1X7SA 3VWJA 4OLYH 1KWUA 5IW1A 2OYPA 1FGVH 2H0EA 4W9KC 3ZHFA 1DJSA 4IRZA 4QTFA 3VFSB 3ULVE 3IGKA 2FBJL 4H2CA 4HWZB 3U9UB 1EAOA 3VFPB 4ADJA 4JJOA 1PF3A 4KITB 4CSYA 2M8XA 4OT1L 3WYRA 4MCMA 2GCYA 3KH3A 1CLYL 4ZOAA 3GBNL 4F8LA 1E4HA 3ZTJH 2M83A 3G8KA 1KT2A 2D7QA 1JWUB 3UYRL 4L3EB 2XOTA 1ECYA 5IJBC 5F7LB 4GUQA 4AV5A 4L37B 1NGZB 3OLGA 2OL3B 5C3TA 2K0RA 5FKPA 3N1FC 2NY5C 1LE5A 2IBZX 1T7XA 4RRPM 3G5VA 1WE5A 1L7TH 1EEQA 2EYSB 2BP0A 3HMXA 4LLUA 2GJRA 1IT9H 2XV0A 4WCYH 4Q4IA 3N44B 4AQEB 2IDSA 5C0EB 1MW2A 4NC2B 4D9RE 2WXQA 3LTVA 5CBEA 2Z91B 3MV01 2JKWA 1DQIA 3P40A 1MPUA 1GR7A 4HLZH 1MFBH 1XGUB 3GJFA 4GSXA 4NQXA 3FO1B 5EZLB 1LNUA 3NFPA 3W38A 4GSDL 5FHAL 1BBJA 4HS6B 3JT2A 3IDNA 2ESVB 4UV7H 4P5RA 1IFGA 4PJ9C 3VG0H 3JT0A 4RSVA 3IGAA 3DGDA 4MMYA 4NO0A 4NPYA 4FQQA 5GZNC 2CDGA 5AAMC 1CBVH 3L4TA 3EUDA 2R0LL 4JFUA 3LQMA 3HE6C 2RTTA 3IFNH 3T77A 3VFOA 3H2WA 1P4LD 4GI6A 1WFJA 2OJZL 4LKXB 4MZ3A 3IF1A 1KWWA 4YHNA 1CYWA 4M6OH 2NUPB 3LEXB 5EFIB 2WPGA 1MRFL 5D5MB 4XAKD 1EGJL 4LF3B 1E28A 3O4OC 4KH9A 3N1GC 3NTCL 2LV4A 1VFBA 1HNFA 1NIEA 1H6TA 4DGIH 4HUWA 1FFNA 1WAEA 2OJ1A 2OZ4L 1VRSA 2Y06L 4V33A 1Y17A 1FDLH 1AFA1 1KBGL 3P5GA 4M1CD 2PMZA 3HS0A 3QS2A 4EDXB 3UTTD 1PVHA 1NOLA 1IE4A 4AYID 2XQ0A 4UMGA 3TA3C 4EI5B 4UTAH 3QS3A 4UAOC 4R0LC 5CGTA 4PJBF 4TULH 3QHTC 3MLYL 1JYXA 3RAJH 4PUBH 4JM4H 5BOJA 2DWDB 1CGSH 3BKJH 4AX3A 3N41B 4I3RH 4OFIA 4N35A 5CMAA 4K73A 3TT3L 1LWHA 1MSBA 2BY3A 4NLAA 4B97A 4UT9A 4YHOL 2ZQKA 3LZPA 4I8DA 1J5OH 3QB7C 1HL4A 1CYXA 4QNPE 3V2AR 3SDYH 1BEXA 3X1GA 4FERA 1HYRA 3E8VA 4DP1X 3P30L 4JCLA 4FMFA 4WI5A 4OQ1A 1H3TA 1SBBA 5EMYA 3UP1A 3GSOA 4P46B 4JDTH 5EOQH 4IIZA 1COBA 2AQPA 3P69A 4K8RH 1NUDA 4NQTA 2F68X 1FIGH 3P73A 3QHZH 4NO3A 1TT6A 5IB2B 3QRGL 1BIIB 5GJSL 3I6GB 3BP6B 3TEYA 5DZJA 1JHKH 1WZLA 2X4QB 4L9LC 3I74A 2V9UA 3BVXA 2LVEA 3W5MA 1D6VL 3SO3C 1YAZA 2GW5A 4KVNL 1XCTB 1XPHA 3SDAD 4U1KA 4G3YL 4U33A 5GQBA 3HG3A 4OZHB 2BZDA 1QHQA 3HG4A 4NQQA 1HWHB 4WW2A 4I2XB 1UB5B 4KJWC 1FZJB 1DJYA 3GEWB 4ZUVB 1F6AA 3SOBH 3SGJA 4F9LA 4KJPD 2ZCKL 4LHUD 5IVOA 1QI4A 4NQCA 2VDLH 5EPMB 2B15A 1FL3B 1E9OA 3MBWA 1E5ZA 2N1TE 4UQAA 4QRPD 3T2LA 4BZ1A 1HTYA 3OWEA 3VI3A 5IB5A 2DQ6A 3LKSA 4DNLA 3ESVF 1TDQB 1I85C 1F58L 3FT3B 2BNQD 4PVLA 3QRFM 3C8KB 3FB6B 3OKKB 4U49A 5SWSA 3UBXA 4QKXB 4GRWH 3WU1A 2F2HA 3GRGA 1Z3GL 2I27N 3KYOA 5B7FA 3UTZB 1UFUA 2GUOB 3IU4L 4HXBH 4YN3A 1S7QA 2V5SA 2V9RA 2DICA 1QUNA 1RZPA 2XRAH 4OZIE 1O7CT 3BKCH 3LS5H 5BUPA 4O5LL 4ZMNA 3E2HC 3QUYA 3WTVA 5DWPA 4BCXA 4YXKH 1OZ7A 1IM9A 4PN6A 1YC7A 1N6VA 3G5ZA 4EBQL 4KOBA 5F88B 3S88H 1E6JH 2ERJB 5IQ7H 1UV0A 1AFVH 2DQMA 4KTDH 1W2KT 1XEUA 4I5BA 2E47A 4I89A 1OAZL 1PLGL 4GI8A 2BOBB 1DQDL 1XSKA 3ZY7A 4DVBA 5TF1L 2FLBT 2D4DA 2A77H 1N4XH 5ENWB 1A02N 3OAYH 1UD4A 2ZG1A 1AI1L 4QRUA 1YA5A 3ECBA 2XX0A 1WVZA 1RUML 2VLJB 2VZSA 3FTZA 3CDGF 2DD8H 4ZUTB 4ZAKB 1QRNB 1Y0LB 3QEQD 3DX8B 4Z9KB 4DFIA 5FA3A 3ULVL 3LZQA 2R7EA 1I1YA 3P9MB 2QVFB 2R56L 2LFGA 3Q13A 5EU4B 1UJ3A 2DQCL 1OZTG 1LK2B 4OW6A 5JHDA 1H5BA 1UT1A 3BQUB 1NPNA 1SRDA 4ORGB 5D7LB 3DVFA 4DPRA 1LP9B 1S4IA 2V17H 3NSYA 2XBZA 1EZVX 5CJBA 4IOSA 4MA7H 4WUUD 4FL4C 5I17A 3CHPA 3BZEB 3GSNB 1NJ9B 4JFDE 2PO6C 2H8PB 1ZANH 1UEYA 4N25A 3MLVL 5F9AC 1S5HB 3AZUA 2WXJA 1I9RL 2GIYA 2R0WL 3KW7A 4XP5H 2YKLH 2J88H 3W11C 5HI5C 1IGTA 4M5ZH 5C09D 4A6YH 5TK4A 5H4YA 2WY3B 4Y5VA 3R1GL 4YE0A 3P3YA 3CDZA 5E51A 1T22A 3D4CA 3WD5L 2JCCB 3B3IA 5CU9A 2VLJE 2XACC 4Y9EA 1M7XA 4HUXA 1V54B 3SPCA 3QNYB 3BN9D 3BSZA 1S78D 4DN4L 1AFB1 1QRNE 1RHHA 2XWJA 3L5HA 4LVNB 1TTRA 1KCGA 4E0RB 3CFDA 2E46A 2W9EL 3T3PE 3EGSA 1KPRB 3QH3A 1AQ8A 2BIPA 5IQLA 1KENH 2FD6H 5D7JC 3ZL1A 5EWIH 1LP9E 5IBLC 2J7LA 1S7TB 2VDMB 4AC4A 1WHPA 1IFHH 4AGPA 1JWSA 4K3HA 5CJOH 1TMCB 3DI3B 2XPGA 2EXWD 2PP8A 3GDBA 3ZYZA 3VW3L 3VCLB 3N5AA 4Z7QB 3HC2A 3Q3GB 5BVJB 1SXSA 4Z95L 1F1AA 5IHWA 1XT5A 4ZMVA 1KULA 3Q6GH 2AXFB 4MJ6B 1MCEA 4QCIB 1BOGA 1CLZH 4J3OD 3UC0H 4YR6A 3FCGA 2VDOB 3O0RH 4QRTA 3N1MC 1QR1A 2JCCE 1MLCB 4PWEA 3SE3C 4P5SA 1XGYH 1K8DB 2EADA 4QYAA 2CGRL 1IGML 4NM8L 1AOZA 1I1FA 3SE4C 5CSGA 5AG9A 1BD2B 1NQBA 4BGDA 3CQPA 3DJTA 2DLFL 2P42B 2W65B 3GHEH 1WD8A 1T83C 1QFOA 4DO4A 4IKIA 3G6JA 2UV3A 4L29A 4F7EA 4YFLF 5C0GA 1PSKH 4M18A 4U1IB 4YBHA 4BD4A 3EDEA 2H9GA 3BPNC 4QHLA 1R5IB 2KLRA 5E5LA 2WTPA 3ME0B 5LN8A 4J6RH 5E6ZA 3V4VA 3KPTA 2E76C 2R1YA 4Q89A 2EH7H 4RX4A 4XNZC 3WIHL 3I85A 4XN8A 1N64H 4DAGL 1U36A 5C08A 3U0PB 5D7IF 1L9PA 4ACPA 2WP3O 3D69B 2VERA 3PRZA 3U83A 3WKNA 3Q2NA 4OD3H 1UACH 5KEZA 3QCUL 4AVIA 3UJJH 4PGCB 2P8MB 5EU7E 1Q4NX 2MPAL 3WO4B 1Q0YL 4XBGA 5FFRA 4WUKH 5DO2D 5AEAA 4G80B 4QOKB 3QUHA 4DN8A 1ASQA 3PXJA 3VXRA 4UANA 5BV7B 5FUCC 1BD2E 3QIWC 4O2FA 3ZZQA 2E3XC 4XVUD 1UKMB 2DL9A 2K70A 2UY7A 4MWFB 3HIZA 4HA1A 3RVVC 4JPKH 5AKSA 2MRYA 1WAPA 3ULVD 4FG6D 4KZ0A 3QDGA 4ZMQA 4HMEA 4EZJA 5JXEA 1JGLH 5I30L 1NIAA 3QORA 1C5CH 4M8RA 1MW1A 4NJ9L 2ADGA 1UKTA 2I9LA 1RVFH 2XU9A 3AU1A 5K9JL 1XGTA 2PABA 3P2DA 4WI6A 5AYUL 1AQKL 2K8QA 3D33A 4HJTA 4JQVA 4JL2A 4UZSA 3HC4L 3QPKA 5TH2B 7CGTA 2AI0H 5AVQB 5HYQA 4MQXD 5CWSB 3VE0A 2XDHA 2ZPKL 3ZHGA 2X0WA 2IANA 4QOKE 4AVKA 1LILA 2AANA 4EDWH 2ZUXA 3KLKA 3BZ4A 1HKLL 3A4EA 1LMIA 4OM0L 1BMGA 1JYNA 3N42B 4XXCC 2W88A 3APFA 4PRAA 3WHE0 3M8OL 2X4NA 2EXYD 4NERA 1HOCB 2WLLB 2A4EA 4TUOB 4D9RD 4OAWB 4PJHA 5AL0A 3ZDXF 1JS4A 2VZVA 3NQKA 4MXWL 4FAAB 1HWWA 3D51A 5AFAA 3VACA 2J4WH 1VACB 3DV4A 3OWRA 3AG3B 3IDXL 3KM1A 4M1CC 1KFAL 3WJMB 3FH7A 1A6WL 1V7MH 4JHWL 3IAGC 4IDJH 1WWAX 2N4IA 3PJSA 4L3ED 5FCUH 1UOSB 2IVFC 4U6TA 5D6CA 2XZQH 3ZT5A 5KS9A 3D9AL 3FQ1A 1GYVA 1T04A 1WEJL 2IH1B 4NEHB 1CF1A 5I71B 2NTSP 4DPBX 1MDTA 4UT7H 2FHBA 3APMA 4D0DB 2CKNA 1E9QA 1E6OH 1YN6B 4N2GA 3GKWH 4FABH 4DN3H 4X9FA 2DBJA 5DJXA 5JDSB 4XHJC 1R19A 4N68A 5ICYA 1PZSA 5EN2A 1N0LA 4JVWA 4AI7A 4PRHE 3WTXA 3EG9A 1BJ3B 4HZLA 1AR1B 1V4LA 4KKRA 1IODA 2KZBA 3KDPB 4B53A 3GS4A 1SEBB 2D03L 3MCYA 1BUUA 3B9VA 2R2EA 4LCCA 2KT6A 3DURB 5GGRY 1RFDL 5H37A 3VFWA 1PYWA 4ANVA 4RRPA 2NDGA 2HT4C 3O45A 1I8LC 2FEDC 3NCWA 3BGFC 1MRDH 1JK9B 3Q8FA 2XUWA 1QLEL 2FRGP 4N0UE 1ACCA 4JG1H 4L23A 1CE6A 1MCNA 5TDPB 3DPDA 4BFNA 1B0RB 1NFIA 3DRQA 4NKMA 1WT9B 1QSFE 5IB4B 2NNXA 1A8ZA 4LB8A 3GPRA 1R3JA 2NW2B 3GSXB 5CLZA 5D9SA 1FE8H 3D2TA 3MXVH 3LPWA 1MELA 1BQLL 3QK0A 4JO2H 5D1ZC 1MFDH 5DD5L 3S36H 3TBWA 4LMQI 4PY7A 3KPNB 2AF2A 2OMZB 1R3KA 3MMEB 2O1AA 1PZ3A 4XAWL 4Z7WB 3PP3K 1Z32X 2ATPB 4MX7A 3VLGA 1FAIH 1R24A 1LDSA 4DWHA 1PCSA 4WIQA 2E7CA 2UXFA 3N2JA 1W0WB 2YMXL 3QRBA 4GQRA 4FRWA 4AIEA 3VI4F 2AQQA 2J6EL 1SJEA 1SDDA 5I6MA 3FUKA 1F4YL 1S7VA 4EI5D 1EV2E 2N59A 4J6PA 4D9QE 3FU5A 2ZSVB 2WTRA 4MB5A 1JAEA 4R97B 4XMKL 4G2AA 3HNVH 1Z9SB 3O81A 4CA4A 2V2TB 3B83A 3X1EA 1INQA 4Z7VB 3IB4A 2OK0L 2IGFL 3OSVA 1R5VA 2EVJA 3NK4A 3DUSB 5DUBB 3V6OE 1N12A 2QMJA 3QXUA 3WN6A 2NTFB 2NYKA 5ISZA 1EHXA 15C8L 3FSOA 4EZMA 4HS3B 4U6YB 4Z7WE 1MJJA 3AM8C 2Y25A 5DJCB 4PRBB 1RJYB 3HC0A 5GRZA 1AQMA 3UAEA 1IKFH 4P46D 4E36A 1BMZA 3X13A 3GO1H 1AIZA 2CLZB 2WUBL 3BE1L 4YSDA 4U1JB 4X4YB 5EHFA 2D7TH 5IFJA 1N8ZA 3NFSH 3WFDL 5K1JA 3MJ7B 3WIFB 3HUJB 3II3A 3SKMB 5F72S 3L2LA 4MZIA 3QQ9D 2CDEA 2R39A 1X5MA 1JWMA 3ABZA 5DR5H 1H8UA 1GOGA 2AKRB 2D31A 4LLVB 1F42A 1AMYA 3ARBA 3DK0A 3WSQL 3H0TA 2Z6FA 5E6UB 5IBTL 1C12B 4AQ8C 3LIUA 3MCKB 1BG9A 4N2AA 1IBBA 3AACA 3ARWA 3OVUB 3SYPA 1A7NL 5ANMB 4EE2A 2P5WB 1XTLA 3V6ZA 2BH0A 4JY4A 4WFHE 3BPCA 1T0NB 1IKNA 4FQXD 3ZVVA 3QXWA 5FYKH 3RGHA 1ML0A 3X3FH 2CJTA 1Z5LA 2P52A 4APXA 2HVJA 4QLRA 5KSUA 2HSIA 2Z7YA 1Y1UA 2YD3A 3NJHA 2R4SH 1TTBA 3D12B 2W59A 1OE1A 3ALWA 4WWPA 5DUPL 3SY0B 3HUJE 4HGWA 3O3EA 3DOHA 3UAAA 4WGKA 3GXNA 1YPUA 2IV9A 1UZGA 3CQFA 2J5LB 4MS8D 4XMVA 3KE0A 4E9TA 3BN9C 1S78C 3KLQA 1B2WL 1MCBA 3MRBB 4KK6D 4MQ7B 2JIXA 5DJ8A 2AK4B 5T5FH 2IGTA 4LFHG 4XODA 4X7TA 4F20A 3MFFB 1E4WL 5IIEA 4OV5A 5ANME 4UTAA 2P5WE 4IBSA 3TN0B 1LLAA 2VXVL 1MFUA 1TZGH 2RD0A 5DCCA 3JZYA 4JPQA 1KYAA 2IPTH 2ZXWB 4DVRH 2X6MA 4M61A 4P3DB 4PJDB 4E9SA 2EXWC 3O6LL 2HUHA 2BJMH 3KLHD 1T20B 5E2WH 5GGQL 3ZL4L 5I1KL 3ARPA 2VR3A 2YD8A 3PP3H 3VQLA 5C6WH 4XOBA 4PJCB 1EXUB 3RWGA 2HKFL 5ID0A 2YMTA 4JFDD 4ZMYA 1YPZF 1NCWH 6PCYA 4H25B 1T4KB 4X6DF 2B20A 1Q0XH 1BVLA 4HKBB 1AXTH 2VLKA 5C0DA 3UABA 1EMTL 4F80A 2J8UF 3H7BB 1B9KA 2HPOA 4GMSL 4XWGH 4GXVH 4CDHA 4OFKA 4U05A 1LD9A 2EUVA 2AQRA 1AGFB 4KHTH 2VLJD 3WY2A 4ZMPA 1CDIA 2RA1A 4I4WA 4ZAKD 5FWRA 2BP8A 1LO4L 4Y16C 1QRND 4Y4FB 1KTJA 1BXXA 2VDPL 5C9JA 3HUPA 1F6FB 1U8LA 4XP4H 4JDZB 3T2NH 5C0CE 1RIUH 4PJDE 5T3XH 1OEZW 1I8MA 2F7IA 5D7LD 3FZUD 2O6DA 3NA9L 1NGYA 4XNUH 1FBIL 3IMTA 4PS8A 4ADGA 2VR7A 4XPFL 2PCPA 1UXWB 2GBUA 2FIKB 1Z9NA 4N8CL 3NN8A 1TZIB 4IK7A 2F58H 1S7RA 3B2PA 4X6FA 3EO9H 5IB3A 1D5XB 1EVUA 4PP2A 1PMYA 1ZVHA 3DSNB 1QKZL 2NW3B 4BKLB 5DO2C 2YR3A 1U2YA 2RFXB 3W39A 3EOAA 5LLIC 4L48A 1MCDA 1SMOA 2GTQA 4H5SB 1SN0A 4XVUC 1ROCA 4MDIA 4LCWB 3P9WB 2X2HA 4LPTA 5GJTH 4PJ5B 1E0OB 5HVGB 3O0LA 1U2HA 4M7LL 3EYVA 2O5ZH 4MJIB 4PJFF 3UZVB 4QYOB 2YK1H 4XCFH 1EFQA 1F90H 2GAZB 3ULVC 3EXJA 4JFYA 3RVTD 1FFPA 4EQ3A 3N0AA 5ESQA 2IF7A 1SB2A 4P5MB 5JO5A 3OGCA 4H1LB 1JGEB 3OR6A 1RUAH 4FQHB 3ISRA 4F5CA 4GINA 5GGTH 2WJ5A 1X5JA 3HC3L 2YEZA 4GYBA 4QXVA 4MQXC 2Y7QB 3CMOL 3NJLA 3HLKA 3OJVC 1DSWA 1OCRB 3KBPA 2DS4A 3MV8E 4FADA 1F11B 3DTXB 5E8NA 4OLWL 4E5XG 2P5EE 2WWOA 4LCWE 2VC2L 1TETL 2YQBA 4PJ5E 5C6PB 3NIDF 2VISA 4N86A 4KI1E 3K2IA 3RZCA 5IROD 4KDTA 3S5YA 4MJIE 2X89D 1KTLA 4L4VA 1BD2D 2E27L 1LWJA 2UZYB 4UQCA 1G6RH 4KQ3L 5DZ9A 1BBDL 4YOKA 4DFHA 3MROB 2VR6A 1A1NB 1DBJH 2G60L 1J5IA 2YQ3A 3FPYA 4WHCA 3IMSA 3QA3A 3NAAH 2JKTM 5DD3H 4AEIL 5LG6A 1FCGA 3KPRB 2BPEA 2E8ZA 1G84A 3OM3B 1CDGA 1JPFB 4F8QA 1S5IH 1OSYA 2A9AA 3LVTA 2LT9A 4WEBH 4WU5A 2AEQH 1GYCA 3GMPB 1OM3L 2CA3A 5KYUB 1U0OB 3KDMA 5B1CA 5JYMA 3L3KB 4KKPA 5DS2A 4UIMA 4JAMA 3MLZL 4QOKD 4G8EB 2Z34A 4XP1L 3IDGB 3NEOA 3GXFA 1JL8A 4O58L 4K7PX 1M7DA 1P4IL 3AT8A 4HH9B 1ZVNA 2IDQA 1FFQA 3G9AB 4A6YA 4MS6A 2XNAB 5C6TH 3KNBB 2A6DB 3KPRE 4TQ8A 3SYCA 3TBTA 3S35X 4FC3E 3ROOB 2HN7B 4XBEL 1PIGA 5LHDA 2GEQA 1WT5A 4C8XA 3PQYB 5L4FA 3PDOA 4ELKB 4Q9CA 2YGVA 1BZ7B 4FTVB 4BZ2L 5AB9A 5IQ9B 4HPYH 3ZHDA 5K39B 4FQ1H 4N8VB 4F58L 2DW5A 5L2JA 4OLUL 1LEGB 2CJSA 1UMRA 1HHIA 4QMEA 1FIFA 1GGBL 5E00B 3DX0A 3FN0H 2FO4A 5F3HA 4QJ4B 1XF5B 4WJG3 5KAQG 1J1OH 1RZKL 3IGFA 2VDNH 1MIEL 3QIUD 4BQBA 2PNDA 1SY6L 4UTBH 4U3SA 3C2SA 4NXKA 4PRHD 5BVPH 3C60D 1P84J 2O5YH 1B90A 5LGKE 2R2HA 4QTHA 3TASA 3QULB 3ARRA 1G9HA 3QFJA 3VYNA 4JFOB 4MVBD 1OHQA 4FQLH 4TVPE 5HHPA 1EUTA 2B14A 1JDCA 1CI3M 1HVXA 3B7YA 3PQYE 4LRIC 1SYVB 2EDXA 4H20H 2ISDA 2DYRB 4FTVE 3WNIA 4FQCH 5GGRB 3S3DB 4RIRB 1R1CA 3AREA 4JN1H 4EN2A 2XT1B 3K6OA 4WFGE 4MAZA 5DS8A 5TDOA 2XVLA 4OQTH 5JTWA 1PBYA 4RNRA 2IQAA 4JPIB 3OC8A 4MAYB 1FFOB 1QSFD 4GKSA 5DMJB 3VQMA 4RWYH 5A6IA 3HJEA 2WP3T 1P7HL 2VE6B 1WIOA 4C56B 5BXFA 1ZEAH 3HPJB 4X5QA 3S6CA 1D7DA 1A47A 1EEUA 1AHMA 1AGDA 1OARL 2WW8A 25C8H 3RIFF 2UZXA 4OLXL 3NABH 3SDCD 5F7AA 3ML8A 2NY1C 1RQ5A 3VI3F 3DHMA 4FLSA 1LDPH 4OGAC 3F8UB 1BPVA 4O9HL 4PG9B 2Z31D 1PU0A 5E6IB 3DWTA 1BQKA 2JTYA 1AKJA 4V11A 1J0YA 4BGLA 1DQMH 4D9QD 1DDHA 2FR4B 2E7MA 1K5NB 1D5BB 5F2FA 3SQOH 1OTUC 5ALBH 3EFDL 4NZ8A 3VGAB 2FDBP 4O4YH 5CEYB 2B9BA 4CMHC 1N19A 4DO5A 3ILPB 4NWTL 1JHLL 1FNSH 2XV2A 1MF2L 3BPLB 4JHAH 2NNAA 5KOVC 3TURA 4FQXC 3EIFA 1KLUB 3MNVB 4UBDD 3SBRA 1NEUA 3WJLA 5HDQH 2XPZA 3AMKA 4HKZA 3O8XD 4XCYA 1NCOA 5FUOH 5KG9B 3MJGX 3MRNA 1YQ2A 2OMTA 1FO0L 5E08H 4TM9A 3LNFA 3MUUA 2SEBB 5CR8A 1PL3A 3JTSA 4OGQC 4MS8C 4ZOBA 1U3ZA 1ILSA 1BVKB 5CZXD 1G1SA 1AGBA 4WO4B 4XPGL 5I8CB 4KK6C 1B4LA 3JWNG 2PYEA 4KKLD 2QGBA 5FO7B 4EO5A 1RMFH 4FXTA 3FNKA 3CDCA 4S0SD 3S96A 2BSDA 3T4YB 3A4FA 3SJVA 1CLCA 5JQIB 4A7UA 2D2OA 4XN5A 4EIBA 2YSSB 1CE1H 2R29L 3KPOB 3TU6A 2LVCA 2R4RH 3GMNB 2X87A 2CRYA 5L2KB 1BHGA 3AG4B 3CX5J 3KLHC 4OLVH 2WYHA 4LEXH 1EJ8A 1VIWA 3O9WB 4WFHD 4I77L 4ZZFA 5ETUA 2OQJA 3BISA 2VIRB 5E0QA 3S98A 3VM7A 2BMKA 5FF6A 1U92B 2HFEB 1GZQA 3H53A 4DKDC 1KCVL 1T7ZA 1S9WA 3L5IA 3OLEA 1GSMA 1GC1L 5FM4A 4DCQA 3ENEA 1XBDA 1Z7JA 2FHCA 2XG4B 4TNWF 5KN5A 5DFVD 2D3NA 5D93B 1RAMA 4Q9QL 1AIFA 2VLLB 1BW8A 5DK0A 3IMBA 2BO0A 5ILTH 4ODHL 4Z23A 5FFOA 5J13C 4LKCB 1KCUL 4WHTB 1RERA 1VHPA 1T1XA 3MI6A 1JDDA 2P5WD 2IALB 2FQEA 1TLMA 2YZ8A 1XIWA 3O3BB 5L2KE 2RACA 4NUJB 4JKPH 1F1DA 5KBPA 4Z7UA 5KVGH 2Z1PA 1WITA 1Q9KB 4Y1AB 5TQ0H 1XMEB 1VDGA 4FNRA 4GKLA 1FH2A 4B9CA 2YUZA 1VGKB 4J8RA 1VA9A 1S7SA 3T0EB 4PJ7E 4UDTA 5KVDH 5TE7L 3BPOC 4KDVA 4AQZA 6PAZA 1FORL 2C4XA 3LQZB 4RGOH 1ZHBA 1OCWL 4QT5A 2DQUH 4L8CA 1PFCA 3J07A 1CMOA 3RUGA 1EJ6A 5H2BB 3HMWH 4LOUD 5MENE 2GSIB 3G6JF 1Q1JL 2EIMB 4F33A 1BZ8A 1G7IB 3BVNA 5BRZE 1BFSA 1KB5L 3C5JB 3MUZ1 2Y7LA 4KTEL 3ZE1F 3FPXA 3Q2VA 4GQPH 3U7AA 1URZA 5LNGA 1GGYA 4FA8A 5DVNA 5C0CD 4Y1AE 4AJ0A 4FF9A 1QTSA 2MEJB 2XV3A 2MH4A 1LK3L 1NCAH 1HI6A 2IIJA 3HRZB 1A1MB 2X4SB 2M94A 3T0EE 4E41B 5KBMA 2DMBA 1LO5B 3C6EA 3GHBH 3A6CL 5D6DA 3DRTB 4HJ1A 5SX5K 1XXFC 4UM9B 2HJLB 5E7FA 1XD1A 2IH3B 5EU7C 5LUMA 1BFOB 3MRHB 2KUTA 1QTYT 3LDBB 2ZCLL 5IROC 1S9XA 5H35A 5JHBA 1SXNA 3BOVA 4QAMB 4XOAA 4NNPL 5DMIH 4N2BA 3CD4A 3I3EA 5CLWA 2QSCL 5DRWB 2RALA 4G42A 4QIRA 1SQMA 3MOBH 5HTSA 1T6VN 4Y4FD 2JQMA 4UNUA 4M7KL 5DHEA 5ADOL 2NQDA 2AZUA 5G4OA 4Q6IB 4TVPL 2G4EA 1X2TA 3BQVA 5CEXB 4XGZB 1TUPA 2IJ0C 4PJGA 1MCCA 2AXGA 3T5WA 4F24A 1BJMA 4ONHB 5B8CC 5FECA 3FRPA 3BESR 4E41E 5BOPA 4DZBB 1EJOH 2ITEA 3FFCA 3NDZE 4EN3A 3MSPA 2EDMA 5C7XL 1KYOJ 3N55A 2MOVA 3D52A 1JZNA 3B5HA 2CGYA 2F74A 2WLZA 2BWQA 5F96L 1HUPA 4B9FA 5FLUA 1BQRA 4X7FC 4M3KB 3MV8D 4WI7A 4E42B 3B2VL 4PW4A 1OK0A 5C0AB 2P5ED 4LCWD 3CWGA 4PJHF 3P4LA 5C0ND 4PJ5D 4YUEH 3FT2A 4MJID 4R7LA 2NY6D 3AW5A 4WEUD 5B4MC 5IMLA 5DMGD 3X14A 5DMKB 4GG8A 4AEHL 3BEWB 3MODH 2FBRA 3T2OA 1FVEB 4WHYH 2E86A 4Y5XA 1XF2B 1BV8A 3QYNA 1UQSA 1D2PA 2ZX8A 1U8QB 5T5FA 3WG7B 1L4IA 3TM6A 3GSWA 1DR9A 1KN2H 3WUWA 1HXYA 2EIEA 2QPFA 1T89C 3F64A 2VWEE 4JPVH 4ZDHB 5DD1L 1VPOL 3MV9A 4X99A 4LSVH 3HAEH 1GS6X 3DROB 1XDTT 4PJXA 5DC0A 2VZTA 3VMOA 5E4IA 3QPQD 2EDNA 2ZT9C 3FUIA 5EBGA 4OJFL 4KK8C 3SGEH 3GMRB 5EDSA 4ZMLA 3QIUC 3V79C 5C0AE 1R75A 1RZIB 2Q7NA 3EBAA 2LLGA 3MKKA 2ITCB 4KX7A 2AJSH 4XN9A 3LPOA 1YEIL 3MHZA 1E5UI 3LD8B 1USZA 4UV4H 5JIQA 4Q9RL 4LNRB 3C60C 1XSOA 3HB3C 4RMUA 4AYFB 4XXDA 4U6VL 1XGRA 1MH5A 5K59F 5BZWB 1TJIH 1H19A 2YSTA 4HUMB 4MD5A 1I1CA 4K3DL 3RNKB 2CSPA 4MVBC 4F9PC 5MHSE 4QXUL 4YQXH 1EANA 1HXMB 1QX1A 3MRMA 4NN7C 5TK2A 2Q86B 4V1DA 3KPRD 4ZW5A 3CN1A 4GG6B 2DIJA 5LQBL 5ACZA 2BSTB 5KTEH 1ZDQA 3ARZA 3VFMB 4DW2H 1NINA 4JFPA 3PWNB 4IKLA 2UWEB 3AAZA 4JFSA 1F56A 1U9KA 4PREB 5D2NE 3T8MA 5CZVL 2X9ZA 3K72B 4NZRL 5JXAL 2CGZA 4TLKA 4EUPB 2F15A 1UHVA 1X7TA 4ZQKA 1A7OH 2DJMA 2IH9A 4P2CG 3IDIA 1W0YT 5FW8A 5FYJL 3PARA 2C1OB 2ZWYA 5C8JB 2YXVA 5KBDA 2C1PB 4FN0A 3T3MF 1BPLB 4HWEL 4YDMA 2B1OA 2H1XA 3EO0A 1NFDF 4O2EA 4FJYA 3GEFA 3SDCC 1Y1DA 4GG6E 1JRHI 4P23B 1GCYA 4TVPD 4M5TA 1DSFL 2ICEA 2W9DL 4LL4A 5ITFB 2FBJH 3BW9B 4WSGA 2Z31C 3PQYD 1JOIA 4X2UA 4OT1H 1HT6A 3VXSE 5D1XB 4KKNA 5IQNA 2UWEE 4FTVD 1CLYH 4RMRA 3GBNH 4TSCL 5EUOB 5F1SA 2O26U 3UYRH 4YIQA 3UAJA 4WFGD 5GGTA 1XH3B 5FV2A 1PKOA 3RIKA 3IJ9A 5L9DL 1FVDB 4Y2DA 4TNFA 3TT1L 2WLNA 3V6OC 3WNOA 1NTDA 4UBDC 4P2AA 1NGWA 1EFXA 4HV8B 3HN3A 3O8XC 2WN2A 4KXZH 1N18A 4IIQB 3KS0J 3WS6A 4OFYD 5JPMC 1QABA 1OALA 5F0MB 2ZOKA 2EE2A 3S34L 2OMNA 2X38A 1G6RA 4Z76B 3MVSA 5CZXC 3WEBA 2AEIT 5IVXA 2NY7L 1ECZA 4MD4B 3NG5A 5EUOE 5EEWA 4GSDH 2J56A 5FHAH 1WGOA 1D5ZA 2YAPA 4CSPA 5IJCC 4OF5A 2WJ7A 2HMID 3LN5B 1HWGB 5CP7A 5FKAB 2K4WA 1MPAL 5EIVA 5EIIA 3WGVB 1RZKC 3UGEA 2CA4A 3QEHA 4MAYD 2PW2B 4WKZA 4ZX6A 2F19L 3MR9B 3OTTA 5FGCE 2NZIA 4HJEA 4EJ1C 3KPLB 2WKOA 4HFUL 1E2VA 1WFTA 2BVQB 3VVVA 3VJ6B 1XZ0B 1NCJA 3HZMA 2R0LH 4WTZG 3U0WL 4CADB 3O3DA 5GS1B 3TPUA 4N2MA 2DQFB 2OJZH 3KBEA 3QDJA 3DX3A 3UADA 5L4JA 2I7OA 5EBMB 4A7TA 3BRDA 3JUYA 3MA7A 4YS4A 1AS7A 3FOLA 3VMNA 1MRFH 3DO3A 1EGJH 3DX9A 4AH2A 4L18A 5ICXA 1SJHB 1PQZB 43CAA 2GGXA 3VGDA 1AMXA 4MNHA 4MNQE 3DX6A 1DQKA 5E6ID 1EZSA 2OZ4H 4S0HA 2Y06H 5DFVC 5J12C 4QLWA 3QG7L 4IRJD 1KBGH 3WDIA 2MMXA 1ZS2A 3ISYA 4UM8A 3FB7B 4GP4B 4P5KB 4CVUA 5C0JA 1OQXA 5AYTA 3BP4A 4NO5B 4L1HA 2IWEA 3KHQA 3VFTA 1RP8A 3DA0A 3MLYH 2MCG1 3EGDA 5DQJB 5FB8A 3MNZB 4DERA 3NIDE 4ETYA 2CXGA 2JKNA 1VKXB 1AD9A 2VDQL 4LHJB 4WU7B 5EBLA 3TT3H 4MA1C 3RZWA 3BZDA 3I50L 3VXMB 4F2EA 4PJ9A 4PD4K 4YHOH 2UXGA 2F18A 1P5VA 3RWIB 5HYJA 2ARJA 2XV6B 4UTBA 5EUKA 1WRFA 2E0PA 2P5PA 3N85L 5GZNA 1KUMA 4KGLA 2ZAHA 2OBGA 1KBWA 5J1SC 5AAMA 2ORKA 4B9YA 5I16B 3P30H 3QQDB 4ZFOB 3HE6A 3MRKB 1W72L 4YHPB 5DUJA 3RJQB 1P2CA 4I18B 2ZP8A 3CZEA 4DKTA 3UACA 1KMB1 1TQTA 3SE6A 2VO5A 1NLBL 5KYXA 4WO4D 1M71B 2HPTA 1CLOL 4LDEB 4LOUC 5JMRA 2V7NB 2WO4A 5ALCL 5MEPB 1KGIA 4G8GA 5AENA 3UBUA 4U31A 1DYZA 1CICA 3KW8A 1F13A 1J8HE 3OD3A 1PNCA 3WXVL 1IGYB 3QRGH 5J5EA 5GJSH 5KSBA 3HVNA 2QQLL 1Z9MA 1RY7B 2V0AA 3BVDB 2A9DA 1QPKA 4GUOA 4KTGA 2YEQA 5KUMA 3V0WL 4U1NA 1D6VH 3P4OB 4DEPC 4KZDL 4OQTA 5L2KD 4KVNH 3PWUA 3VXME 3QJVB 2B0SL 4HOMA 4G3YH 2CM6A 3TA3A 1MVFA 2J44A 2VT0A 3WWKB 2YAFA 4R0LA 1D7BA 5HGBB 1PAZA 4ODWA 5T1LB 3IJHA 3NSJA 2PKDA 1IFRA 2ICCA 3O2DL 4NQDE 2ZCKH 1BVZA 4ZFFA 4FKEA 1YUHA 5J1AB 4YO0B 3M1BA 4RETB 5T1MA 3OLDA 5FCSH 5AW4B 1OSPL 2PR4L 5AW2B 1WCQA 2W91A 5GHWL 4AG4L 4M7ZC 4HWNA 2Q6WA 4IQHA 5IHZB 4XR8C 5MEND 2DY2A 1TZHB 2WANA 4WV1C 1F58H 1GKEA 2VQ4A 5BRZD 3VRIB 2L4OA 3V8CA 1IC7L 5C70A 4K2UL 4HIQA 3UBFA 5C0BB 3MO1A 4MYPA 3T8XB 1IJ9A 3UDWC 1Z3GH 4PLJC 1SDYA 4PS3A 1C8PA 4Y1AD 3MGOA 3GMLB 4J6MA 3IU4H 1G7HA 3U4EB 5KANI 2EYTB 1IJNA 2J6WA 4L9LA 4WNQB 3T0ED 4GP8B 4O5LH 1Q9OA 3PWLA 2HT2D 5I74B 2E75C 5FEBA 3QJFB 4OZFH 1GC1C 2NX5E 2E59A 5TGBA 4QRSB 4EBQH 4I1NB 1MY7A 1C3AA 5AKTA 5HHOB 3P77B 1ZLVH 5C0NC 2LABA 4IEFB 3TYFA 5LGJA 3A23A 5DEFA 3N43B 2K3HA 3K2KA 5K8YA 1UEXB 1OAZH 1PLGH 2NY6C 3GSUB 1ZT1A 1DQDH 2QVMA 5TF1H 4LVOC 4DGYL 1OLZA 1IAII 1QDDA 3ZU8A 1LEIA 2A83B 4XP9L 1AI1H 4YHIB 1I7TB 4L05A 3BRGC 1RUMH 5K9KA 1OP5K 1AXIB 4FXKB 2XN9B 3ESMA 1OGAB 2XIDA 4X8JB 3TNNB 3ULVH 5LKNA 1HXKA 1MHPL 2OLDA 3BWUF 2QJDA 3RJDA 2R56H 4B41A 4GKOG 1QI3A 3EFOB 1W8OA 2DQCH 4P0DA 1I85A 1R5WA 3KYKL 2WOBA 2XYCA 4E41D 5IUCA 1KIUB 5T1JA 3TONA 1AO7B 2PTTA 2X4TA 2H3NB 1ZPLA 2VH5L 3MJWA 1DVFC 5F21B 2CLRA 3RI5K 3MREA 4UM9D 4GI0A 2MJWA 4G7SB 1HSBB 4BRVA 2BIMA 4PJEA 3DECA 2CO2A 3WKYA 2BPBA 4LEOB 3P7GA 3MLVH 5EU6A 4Q9BA 5EOCL 1I9RH 4P57A 2R0WH 4P04A 4R7VA 3CVIL 5J9PB 2K78A 2IDUA 3EJUA 3DBXA 2HCZX 4MB4A 1JPGB 2PETA 4ODXB 4YC2B 2WSDA 1X4XA 3R1GH 1KJMA 4GP5B 1F02I 3VRLE 3WD5H 4HSCX 5SWZA 2YD4A 4G1EA 3PABA 3RIAK 2XN9E 3LKNA 1OGAE 4DN4H 3S5LA 3KEHA 5T1KA 2W9EH 1O7DC 5AVUB 1JZGA 4A2EA 4PLNC 3VXOA 4UDUA 1FLRL 1NCBL 4ZUWB 1KZB1 3TCXA 2Z4QA 4P2QA 1QWHA 1V55B 3MBED 5AZUA 5HY9A 3D08A 3CFMA 2NPLX 3VW3H 1CFTA 3EYOB 1DO6A 4NAJA 1ZGLB 2B77A 2FQFA 5C0AD 1KX0A 1I9JL 2WO3B 4Z95H 2H32H 4XPHL 2XKNB 1NGXA 2EC9T 3AXLB 4JJ5A 4GO8A 4L8SC 5B1JC 3ALXA 3BO8B 2AAAA 3IM1A 5F7DA 1XQ4A 2D3VA 2YPVL 4G43A 2CGRH 1IGMH 2PO6A 2VDRL 3P3SA 4GW4B 4NM8H 4UUJB 5MHSD 3CXHK 5I1CL 3EJJX 5IMMA 1A66A 1UCTA 3WDHA 4F37K 2DLFH 3DIDA 5EC2A 3L1OL 1MCHA 1YUKB 4A39A 1UA7A 3QJHB 4JRXB 4M9PA 2MQ0A 4IBYA 4P2RB 3DMMB 3OKOA 3WIHH 2E9WA 4ISVA 1N8OE 4JVPA 4L3CB 4DAGH 1OVZA 3VWKC 4N38A 3RWDA 4LE8A 5CP3H 5D7JA 4YJZL 3QCUH 4JY6A 2CU9A 2MPAH 1A9BB 2DQIL 5FK9A 1Q0YH 2NY2B 2ODIA 1PG7L 5CF3A 3LOWA 3FMGL 3HCVA 1AXSB 4JZJB 1ID5I 1RTM1 3JV4A 5EB9A 4FYQA 5EEXA 3HR5B 1KWKA 1MFAL 1QSEB 2EDTA 1SBSL 1SLUA 1A7PH 2BXYA 2WLMA 3B6SA 1YJDL 3L4ZA 4JRXE 4FYRA 2X2IA 3DHPA 5I30H 3VXSD 1NKRA 5HGHA 5I0WA 3SE4A 3BI9X 1MCQA 4NJ9H 4AKPA 4XZ4A 4L1LA 4GRMA 3B7RL 5K9JH 2VR8A 2FJHB 4OCYL 3MOAL 5AYUH 2AQSA 2MHAB 3OG4B 1NFAA 1AQKH 3FU0A 2KLSA 1T83A 3ZIMA 3HC4H 3STZB 4MRCA 3OMNB 2WUCL 2ZPKH 2WCPA 3I75B 3DX4A 5AVYB 3DYMA 4KK9C 4PMEA 4KV5F 1BGXL 1KOAA 1HKLH 4OM0H 2O30A 3JWNE 3CFWA 3NESA 1JF1A 1M7IA 1BOYA 3FH5A 2X9WA 1QSEE 1YYLL 4P23D 1TN3A 5LBGA 3M8OH 2MOQA 1ADQL 3RPIB 4QDGA 1BXAA 4UB0L 4MXWH 1OLLA 1RZGA 2OMWA 3D18A 4IRJC 3A21A 2GUYA 3IDXH 4P06A 1KFAH 1BFVL 5BQDA 5FDYA 1I8KB 1G7QB 1A6WH 4JHWH 3TBVB 3MRQB 3ARGC 4YXLH 3KLAB 4FNLL 3NCYS 2JJSC 3FTGB 2D2CC 3JWDL 3D9AH 3QUZC 1SJXA 4K23L 1WEJH 2AJZA 3UPAA 3DOSA 3ZKXB 3EO1B 4HK3N 5I18L 1E8XA 3AS2A 1DCEA 4KFMA 1C5BL 3SKNB 3Q8CA 2D9QB 2EE6A 3VTMA 2F53E 1T3FB 4ICXA 5DUML 5E9AA 1EXHA 3NZ8B 1TYRA 2PTUA 1NCTA 2XBDA 2G9HB 4X5WB 5FPIA 1FNGB 1UASA 2C7UB 2XVBA 3IDYC 1TEFA 3U9PL 1FN4B 1UVQA 1MHHB 4LFHD 2D03H 3L17A 5HDLA 2YOAA 2H2PD 3QHFL 1UD6A 4PRIB 4QJ3B 5IEHA 2OSYA 1KSRA 3Q8BA 4GPVA 1C5DA 1RFDH 1UOVA 2EKSA 3O6ML 2HX9A 3G5XA 3JTTB 5I1HH 3QG6A 4MNQD 5ID1B 32C2A 4XXCA 4BHUI 2X88A 4AT6B 4KXBA 2YLHA 4KNSA 4WJKB 1NWPA 1QLEH 4PGJA 3DXAB 1I7ZB 3O41B 2NR6D 2ORBL 2AXHA 3UTTA 2YKKA 2XWEA 1P4UA 3ILDA 5CLXA 1Y6MR 2CPCA 2A6IA 1OT1A 2JCWA 1BQLH 5DD5H 5CEZE 3GFUA 3CZFB 2LW3A 3JBG7 5K69A 4XAWH 1CG9B 1U8CA 3RNQB 1ZA3A 1RIHH 3D2UB 3CZGA 4GT0A 5JDJA 5GRJL 4YXHL 1MCSA 2CK0L 5IMKA 1PCXA 3RLSA 4Z7OF 1O5DT 3V4PB 5I1DA 1EEYA 2AQTA 2KDGA 1HINL 2YMXH 3ROLA 3CADA 2CCLA 3DXAE 3EADA 3PWPB 2J6EH 3UO1L 4A38A 1F4YH 2DM3A 4HQQL 3V5KA 3NJGA 1ED3A 2UVEA 1KPUB 4JFEB 3CG8A 1LYQA 2X7LB 2CUAA 4XMKH 4Y8AA 5B39G 1CGVA 2OK0H 4WTQA 2JKJA 1I8LA 4GKNA 2ZZUT 4U6XA 4NT6B 3WTTA 4P8QA 3BSHA 3VXMD 4GKZB 3D6GA 1H3GA 3IXTB 1CWVA 4V2CB 5I1EL 3C09C 15C8H 4GJTB 5DZPA 2BK8A 4I85A 1FNAA 4NIKB 1NC4A 1ACYL 3HG1E 4NS0A 4Y9BA 2PCFB 1BCJ1 3F7YB 1OF2A 1W15A 4NQDD 3SDAA 1E87A 2BNUA 2Y5TA 2HTLC 2QQKL 2Z8SA 1FL6B 3NIGB 4AUYA 1NM4A 5I2IB 1CXLA 4ZTEA 4IBQA 3QXVA 5DYOB 2WUBH 3DTDA 3BE1H 3PWPE 1XARA 1E7UA 3L7FB 3SBWC 3LN4B 2GB2A 3WFDH 3LZOA 3WFBL 1GGTA 3LAFA 4ECNA 2QSTA 4M29A 3K8KA 4QY8B 4R7DB 1YN7A 2FGZA 1B0GA 4PJGF 2Q20A 3F5WA 5FUZL 4BHUA 2F0CA 2GJZA 2CR6A 2NLJB 5K33A 2MSPA 3UEQA 4QRPA 3KWXA 5EF0A 3WSQH 1F3JA 3MDJA 1X5GA 5E1IA 3LZRA 5IBTH 3ZTNL 4WRCA 1JV5B 4X7SL 2CXKA 1OOAA 3EAKA 3T3ME 4APQB 3ARUA 3G6AA 1IEAB 5PCYA 4CSTA 1FVUB 1WK1A 1R33A 2BNQA 3PDDA 2ZUQB 3BUPA 4X42A 3R06B 2H47C 1CFNB 1TCRA 4R7XA 3HE7C 4Q6YA 5IOPB 2JI1A 1RDM1 1EQWA 1XD0A 3RTQB 1WIPA 5HHQB 4D94A 4PYHA 2ADFL 3VXTA 2GYSA 3C6LC 2NX5D 3MAWA 4BJLA 4AM0Q 3ECUA 5DUPH 1CFBA 1EGJA 1G7LB 2HLAB 4MD0A 3AM8A 2QHRL 1KN4L 3NRFA 5E9DB 2OXGA 2J2ZA 4ZRVA 1A6TB 2OZ4A 2ID5A 3ZE2F 3CHXA 1B2WH 2AV1B 3V4UL 1M6UA 1HEJC 4HFWB 2XG5B 3RFZA 4PB9L 4YNYB 5ACLA 3AG1B 3OLIA 4MA3A 4K5OA 3RILA 2XWTA 1OANA 3D39E 1E4WH 3EF4A 3D48R 3AABA 2VXVH 3VXPB 3PUCA 2D8KA 4NNXB 3MBEC 4YLIA 4FI7A 3O6LH 3OZLA 3VDBA 3DJRA 3QEQA 2XXCB 5GGQH 5I1KH 3ZL4H 3KJ4B 4AQ8A 1WH0A 4Y4HD 2C34A 2OYLA 1EIBA 3QZNA 5KTIA 2HKFH 1ZXQA 5LGHL 5F6IB 1L9MA 5EG6C 2BX5A 3PPSA 5I5IA 2HJKA 1D5IL 3QXDA 4WUUA 1CQYA 1QLRB 5CIPB 4F7TB 2BOCA 1EMTH 2WXHA 5E24E 5BV7H 3FO0L 1NMBL 4GMSH 2VAAA 4OZ4B 5DJDB 3D4YA 4U2YA 5DHDA 2X4OB 4XT1C 4BA0A 3L3OC 4GRLC 3GI9L 2DMCA 5HVFB 3W9EA 2BFGA 2V2WA 2XN9D 3LVEA 5HBBA 1OGAD 1LO4H 5C09A 2VDPH 3MLWL 4F92B 1RZ8B 3V6FB 4LMQE 5FFTA 4M56A 4CGUB 2W92A 1N5AB 1V3KA 3D07A 2IXQB 4I88A 1U3HB 3PE9A 1DY1A 3M45A 3NA9H 4U0RB 1FBIH 4IBVA 1CD1B 2YBRB 4XPFH 4IOFD 5I8EB 4AE1A 5D2NC 4FFTA 2AZAA 3UOAB 4DPCX 4N8CH 2GK0B 1W9XA 1UC6A 1TYJA 2FAUA 3MZGB 1A3RL 2R9HD 2ICWA 4XCNB 4Y19A 1KPVB 1QKZH 4HIEB 2WZ0A 2WXKA 5HI4D 3MLSL 1AGCB 3F85A 1ZLUK 2H2TB 2PPAA 2ORJA 3PAQA 1I9IL 1XO8A 1TEGA 2A74B 1Y6NR 4M7LH 4KY2A 5CN2A 5FO2A 5M94B 1KWVA 2AQ1A 3OB8A 1U8PB 2WLHA 1B4JL 4GEIA 2QZQA 1F3RB 3WFHA 3LMJL 3QCTL 4FFYL 4K7FB 5I1IL 1R9FA 3ESUF 1JWIB 5HVHC 3C5ZC 4DZ8B 3HC3H 4IGBB 5MEOB 2C8NA 4R3SB 3QIBB 4PRPB 3CMOH 3UTSE 5KVFE 4C83A 3Q6FA 5CEXA 2WVSA 7FABL 4YDNA 1NEZB 1EX0A 5FR3A 4BKSC 4N6RB 1MSPA 3PHQA 4WCOA 1ZE3H 4DUXA 4OLWH 5C97A 5AVRB 4OZFA 4YDKL 5EULV 2VC2H 1TETH 1TQCC 8PAZA 3WBPA 1NC2B 3H9HB 1TQBC 2V8LA 4ZG1A 4PGZA 3X12A 5JW5B 3AITA 3C2AL 5CLTA 2E27H 4XO8A 4QHMA 2EKJA 4KQ3H 1YCSA 4N0FB 1BBDH 3O6FB 3ETTA 5DRXB 3F84A 4UIKL 2IPUK 2G60H 1XB8A 3LKOA 3TIDB 2DLGA 2CHNA 4R2GC 1JZDC 5C71A 5DWUL 4AEIH 4RAHA 4JRXD 1RK1A 3VFNA 1N6UA 3DMMD 5KJ4A 3H55A 4AVJA 1G7MA 5D7KE 2WNWA 5MP6L 4PRPE 3IS1X 3SPJA 5DSCA 3LB6C 5J4MA 4XE0A 3I9AA 1ZCRA 3ESOA 4RZCA 1OM3H 4TUKL 2P8LA 1NCGA 3IETA 2D7MA 5KSBB 2NY2D 4HK0B 3H9SB 5DQ9B 4HWUA 3MLZH 3V7MA 43C9B 4JRFA 4ONGL 2I26N 4XP1H 3AS1A 2JI3A 3TH3T 1IBHA 4O58H 1Y18A 1P4IH 3FW6A 4Z5RB 3P5DA 2RAMA 3Q9PA 4M4RB 2A9ML 4NKIL 2ZKXA 4ABQA 1NMAL 1QSED 3TVMC 3CSYA 3NACL 5KSAB 1UT9A 2FX8L 3ZLQC 3IFOA 1XEDA 4P9ML 3F12A 1OGTA 2JMRA 3INUL 2QV4A 4IU2B 5E4EB 3TLRA 2EDDA 1DQLL 4XBEH 1SVCP 1ZVYA 5AOJA 3D25B 1FZKA 3ZR6A 3WEXB 4BZ2H 3ZGHA 1Q94A 1FZOB 4I0PC 2LS8A 4QGYA 5ERWB 2YQGA 4F58H 4ZO9A 1SL4A 2VJ8A 4OLUH 2PP7A 3BYYA 1CFQA 1GGBH 2F53D 1RZKH 3APDA 1MIEH 4MAUL 1ZLUH 4GAFB 4PW3A 4GXUM 3AFLA 2OL3A 1SY6H 2BPDA 4DPAX 3B43A 1IXXB 3U9WA 3V95A 1CFVL 2VR4A 3MU3A 3BIAX 1FSKB 4JQXC 2L7EA 1J8RA 4ZW3A 1YJDC 5FGRA 4BCZA 1ITCA 5F0JB 5IUSA 5IW6A 2KZKA 1A2YB 5C0EA 2VO8A 4FE9A 2Z7ZA 5DA0B 4ZYKB 5DI8B 1OW0C 2Y2YA 3FT1A 2GTWA 2QGDA 3EYFA 1XGUA 3LH2L 2BNRE 3DETC 3D3VB 2BHUA 5C0IB 3OKYA 4ZD3L 3S97C 1IMHC 5E8OB 1BZEA 3KPQB 3NSFA 4W9CC 5GRVL 1JNHB 2FUTA 1A6ZB 1O6SB 1C16B 2X4UA 2GSGA 3WL9A 5CP3A 4XHQA 1PPIA 1CBJA 3KMDA 2C6UA 4IOPB 1L3WA 2R2BB 1SJMA 3KQGA 1E4KC 1OARH 5CEZD 4XO4A 3QEUB 1F45A 4LRNL 4AZ8B 4XRCB 2FE0A 2H6PA 4OLXH 4DGWC 3BZ5A 5DK2A 4YSQA 3ARYA 3M17A 1DJXA 4OZGF 4FLRA 4KZWA 3EOBB 2WVVB 5ABZA 4DP9X 1JTPA 2IAAC 3CXDL 4O9HH 2A6KA 1MWAL 3JWDC 3D3VE 2LU5A 3CDYA 3DXAD 5TPWL 4LSTL 1G9NL 2YGQA 2H6OA 2J1KA 1XF4A 4X9GA 4JB9L 2VSCA 1YMMB 4BWWA 4NHUB 4CC1A 1N9PA 2VDKL 3EFDH 4WY7L 2RBLA 3GSRA 1G4RA 4X6CA 4NWTH 5KANG 4ERSL 1JHLH 4HW6A 1MF2H 2F61A 3ATEA 4Z77B 3OHMB 1IUZA 2MQ3A 2J25A 5HXMA 2W60B 3HG1D 2FWUA 1KLGB 4FI6A 3ARFB 4DGIL 3B9KD 5DF0A 2YPLB 4JG5A 1FO0H 1KLFB 2AXJA 2QFRA 5A2AA 1U41A 2X6UA 3QUXC 4PCTA 1NKGA 1L0YA 1BJ1J 3PWPD 1JNNL 2FLRT 2NYYC 2DAVA 4P46A 4XPGH 4UTAL 5KUKA 4N2FA 4QRAA 1YMME 3O4LE 3Q44A 3SE8L 5EEZA 5E94B 4LU5A 5J6HB 4OVVA 1BZQK 5EU3A 4AMWA 2E4TA 2F8OA 1ACXA 3MUGB 2FWOB 3CFEB 3PGCA 2R29H 3BDXA 3I6GA 2O61B 1TR7A 1ZK9A 1JPST 5MEQB 1FH5L 1LL1A 4PGBA 3IPFA 2ZKMX 2CRZA 3PFQA 3W9DA 1MDAA 1XF3B 4YSOA 3QNZA 5IMOB 1XCTA 4I77H 4Y4HC 3BHBB 2MQCA 2HVKB 2OJEA 3P54A 5D7HA 2FYYB 4JL1A 1UOWA 3MQIA 1TKWA 1MVUB 1R3HA 4JDTL 1LVEA 5C0FB 4JZNA 1QR4A 4FQXA 5KVFL 1G1YA 3A24A 3GMMA 1KCVH 4J4PD 4N0RA 5D7IB 4YZFF 2P24B 3Q7JA 4OZIA 1T66D 1A5FL 1U8NB 1GC1H 4ZFZB 3VXUB 4XI5D 3IJEB 2NNRA 4Q9QH 3EJPA 1HYSC 4ODHH 3ATBA 1N2RA 3KXFB 4PJIF 3H8NA 4N2HA 1KCUH 2HB0A 4Y4KB 2YAEA 2WIMA 3D39D 3O3UN 4APQD 3I2CL 5BZDA 4PR5B 1SL5A 2NCMA 2JTDA 4IBWA 3OKKA 3ES6B 4MHHG 3F7PC 3E1ZA 4WDIB 4NPKA 4PCYA 2Q10A 5KZCD 2H26B 2J21A 1DE4B 2BCKB 3KH4A 5FX3A 3LXBA 1E3ZA 1H3WM 3HZ3A 3UPRA 1RJZB 3IJ7A 4U3HA 2GJ6A 1M53A 3BIBX 3SPVA 5LB1A 2IPKB 3K4AA 1FRGH 5TE7H 1RK0B 3EYQD 4LP4A 3K71A 4YHYC 3SY6A 1FORH 4H13C 4NZUL 3CBJB 4DK3A 1HHGA 4X6BB 1OCWH 3ZDZB 4OCXL 1YTTA 4YFDB 4JFDA 3RPKA 1KXQA 1I1AB 3KM2A 4LSPL 1JUFA 1FYTB 4JRYA 4P07A 1Q1JH 1WWCA 5F9WC 4HUVA 2BOBA 5I1AA 1SMDA 1U91B 1KB5H 3FCUB 3HZYA 2W0KA 4M3JA 4KTEH 4O51B 4ESKA 5KW9L 4J23A 1QA9A 3K7UA 1CN4A 5HPMA 3PHAA 5EO1B 4ANWA 3MRRA 4E2OA 4F57L 3F7QA 2CBQA 1V3LA 4GK1A 2H45A 1ZA6A 4ZUTA 3WY4A 4ZAKA 1LK3H 4RH4A 4YH6A 3FQRA 2AABL 3Q43A 4PP1C 2ZKHL 3ZMRA 3EJSA 2OCFD 3TBSB 5INCA 5LGYA 3A6CH 3S88L 3VFVB 1HHJA 2CBOA 2VXUL 1RU9L 1U3NA 2OMXB 1S9VA 4PJAF 4RISL 5GGSA 1RKRA 4YHKL 3ZDZE 2CKBL 4B7IA 3SKOA 3V0EA 2ZCLH 3B8YA 1ZV5A 3WTUA 1SPDA 1HHHB 1T0PB 4PDCA 5MI0B 2WVUA 1FYTE 3PAYA 1S5HA 4KKBD 2CIKB 4NNPH 2EDFA 2LLLA 2JELL 2QSCH 3D1MC 2RR3A 2C3VB 1U4EA 2RJMA 2BVOB 5ITBL 5EEVA 4YBLB 1WFMA 4M7KH 2QEJA 5ADOH 4ZXBD 2E6QA 4TVPH 1YPQA 3QNYA 4LPYA 4QRRE 1S8DB 3H6AA 1WBXA 4EMZA 4NPJA 2AS5M 3JYCA 5KYWB 1QFWL 5C7XH 3RWCA 4X5LA 1RV6X 1S7XA 3S3SA 3HPLA 3OKEB 1A0QL 3UTSD 4NCC2 1M1SA 4AM0B 3VSUA 4HKJB 5F96H 2FQDA 2YRLA 3SDDB 4CSSA 3KYNA 3PAKA 1CF8L 3B2VH 5ESAA 3QQNA 3IU3A 2AEWA 3JYBA 3OXRA 3NRQA 4PGDA 1R34A 3S4SB 4NIYE 1J11A 3ARDD 4LLMA 4WENB 1BCIA 3UTOA 1KY6A 2BSBA 3EBIA 4F7PA 1N26A 3CPLB 3GK8L 2VQ1B 3MV7B 4NSKA 3BUQA 4AEHH 1IJKC 4PWJA 5IROA 4DHLA 5DJ6A 3I84A 2DWEA 1DBKL 1H0DB 3GB7B 1KG0C 3IKNA 2CHWA 4HBCL 5DD1H 2J73A 1VPOH 4IGBD 3QZWG 5H37G 1OSZA 1LO3L 2XQYK 3VD7A 5D7KD 1JZIA 4ELMB 3VI4B 3QIBD 4PRPD 1U0QA 3HLAB 1JHTB 3FQTA 4OJFH 1BAWA 4ZX3A 4ZTPL 3FCTA 2V33A 5FM5O 3ZKND 4DUVA 1YC8A 5B8CA 4LLDB 1YEIH 2XSKA 3D69A 3VO0A 4Q9RH 4PV9B 4RGNB 3UH8A 4MLSA 2VITB 4U6VH 5J06A 2D7PA 3QORC 4FFVD 4HGMA 5J3HD 3L4CA 4Z3HA 1DJZA 1BA9A 3VD2A 4K3DH 3O6FD 4QXUH 4G6AC 1T7WA 4JQVC 3IAQA 1RPUA 3QZBA 2VABB 2OR8A 3D4GA 5LQBH 4Y0GA 5HJGA 1WUZA 3BWAB 4MWFA 3SGDI 4L3AA 3B34A 4UOJA 1X9RA 1M57B 4ELME 5A40E 5AW5B 5GS0D 1XCQA 2Y3NA 2ZUUA 4QRQA 5SX4I 3L5XL 4OGYL 2RIDA 4OY9A 5K9OA 3WEAA 1ETJA 1JN6B 4NRYB 1ZMYA 5CZVH 1GCFA 4NZRH 5JXAH 1UYWL 3I02B 5CFHA 4YPGB 1E9PA 1SM3L 1SUJA 4YX2L 2FZ3A 1OD9A 1S9YB 3D8MA 1F5WA 4LEEA 4RGNE 2HLFD 5FYJH 3NFNA 4UQ3A 3E0GA 5HGAA 4HWEH 3U0TB 1DQJB 2GKIA 4JM2B 4TVSa 3RGVD 3TFKD 1HNYA 3KZ8A 3QIUA 1XL4A 4PPTA 2YUWA 5FYLE 2V9QA 1VF5C 4PRHA 3TO4B 1DSFH 2W9DH 3C60A 4EZMG 4YSPA 3SIKA 4N87A 3R8QA 4JDVA 5G4MA 3MLUL 5GSVB 1XR9B 1P7QD 4F9PA 1KTDB 2DYPB 3KPSB 1QAWA 1KJ2B 4TSCH 4X5RA 2IAMB 3ZDYB 3S7GA 3U36B 4X0KA 4NQSA 4AQ1C 2KKQA 4HEPA 5L9DH 4BSWA 3OKLA 1KGYE 2IH1A 3TT1H 1U3JA 1OPGL 9CGTA 4N0UA 4XMUA 3U1QA 2AEPL 3CLEL 5T3ZE 2BM3A 5INDA 1BVNP 1JK8B 1QSFA 1U8MB 3QISA 4R7NB 3VGGA 1CTOA 3B9KC 3JVFC 2ZP9A 4L8BB 3RGBA 2AJXL 2CPUA 2KQNA 4FXGB 4L4TE 2UY6B 1WFOA 4J3VA 3UPCA 4ZMOA 3CFJA 3S34H 1NICA 2YGPA 2GI0A 1A4CA 3MRPB 2NY7H 1SZNA 3ZDYE 3TC9A 3D3VD 3SDCA 1M2VB 1FI8C 5DEGB 5HP5A 4OU3A 5MERA 2D7NA 3LRSA 1ULVA 4EI6B 2J8UB 5LDUA 1L0XA 1MPAH 2Z31A 3GRWA 4IW4C 2F19H 2HJFA 1V5JA 3U82B 2OZNA 3JVGC 4CC4C 3GPSA 4ICWA 4BUHA 4U6HB 4HFUH 1K2DB 1WT9A 3FAWA 3FCSB 3SKUD 3U0WH 1TF4A 3OJDA 4LLWA 1HAUA 5ELIA 3HS9A 3KVDD 3KGSA 1VZHA 4UZGA 1PG7W 1CFMA 3C8HA 3V6OA 4S1RL 1KCBA 4CILA 5H8DA 3T1WA 2YC1B 1U58A 1T66C 3D0VB 3MMEA 1KMGA 3O8XA 2I07B 4DKAA 2VN5A 3A6OA 2EVGA 5DD6A 3VWJB 3QG7H 5E2TL 5IW1B 1KCKA 5JPMA 1WZ1L 3SGKC 3QWRD 3WGUB 1W0WA 1YMMD 3P9LA 5IOKA 4FG0A 3BXNA 2Q5BA 3HBGA 1XGPB 3OKDA 4BZ2A 2GCYB 3VD9A 4N33A 2JLLA 2ZSVA 3GTNA 2E5EA 4TNEA 2AQ3A 3CZLA 1KT2B 4AVHA 3S36L 2VDQH 3I50H 1JPEA 1AZRA 1KBKA 4NN5C 3ECQA 4XWOC 2NTFA 1SY6A 4EPSA 1YAIA 3ARFD 5IJDC 5FKPB 3LH9A 1AZBA 4NI3A 1LE5B 3B7SA 3N85H 4HMDA 5B1AB 4JUSA 5TD4A 4ONOA 1GTFA 2VSMB 3G5VB 4CBPA 4CGTA 5SV4A 1W72H 5FYKU 4NC1E 3RX7A 2BP0B 4PRBA 1G9NC 4GEJA 4LLUB 3QJRB 1RDO1 5LXGL 1NLBH 1TQSA 1MCWW 1CLOH 2JQAA 4RMSA 4ZW6A 1A4JA 5ALCH 3BGMA 5CBEB 4HXAL 5DVLA 2ZXCA 1IKNC 4XE5B 3GBEA 2V5MA 5E6YA 5JPNC 3WXVH 3GJFB 3HUJA 4PQXA 2QQLH 1LNUB 4M1GL 3NFPB 3VH8G 1BBJB 1VAHA 2TSBA 4P5TD 1XGQA 2JSFA 4XH2A 3V0WH 4KZDH 1FWXA 4LLVA 2WQWA 5A2IH 5DMYA 2D0GA 5C2BL 3IDNB 2B0SH 3MCKA 3IFPA 4WJ5A 1QZ1A 2WD0A 2FO8A 4JS7A 5ANMA 2H3XC 4NO0B 3FB5A 4NPYB 4FQQB 3ZGIA 2CDGB 3FF7C 3O2DH 4NFCA 2PXYB 3M86A 4IBLT 4EEEA 1MKFA 4R5VA 5D4IA 1NAML 4QKHA 3VFOB 1CI5A 1MI5B 3RQ3A 1OSPH 2PR4H 1IGFL 4G8FA 4J3OF 5CJQL 2R83A 3IF1B 4LOFA 3W0WE 4YHNB 5JYLA 4AG4H 5BUAA 2KL6A 1E28B 1E8WA 1VFBB 4OM1L 3WBQA 3RDTD 3DUUA 4ZXBC 2ZF8A 1QQDA 5IFHH 1Y17B 3WOVA 1H8NA 1IC7H 1ZD6A 3AUWB 2O6FA 3NPSB 3LNDA 4K2UH 3SQBA 1PIFA 3ULSA 3HS0B 1MEXL 4MDJA 2Q8BL 1XGZA 3PYCA 4BINA 4JFXA 4L2YA 1RZ7L 4KX9A 1BNLA 1JA3A 4FFWD 2Y36L 4HF5L 4CVWA 1NL0L 2ZCHL 1FL5A 2B5IC 5C0CA 4PJDA 3L2NA 4GW1B 3T9WA 1MI5E 2CK2A 1ZWIA 1EDQA 3S0PA 3OR7A 2E8YA 5CMAB 3O11A 4AGQA 3SN6N 1QEWA 2X70A 4OJYA 3BD3A 5CZKA 1BG1A 1SYSA 4P48A 3P3RA 4KROC 2EH8L 3WKML 4HOWA 1FO0A 3ARDC 3T2QA 1I1AD 4H25A 2X1WL 1FYTD 4DGYH 4ETQA 1YNTA 1P5UB 4XP9H 3H7BA 1PZDA 3GSOB 5H4ZA 3BYTA 4JFFA 4XTRD 2C9AA 3TBCA 1FQ9C 1TZOA 4HJIA 3RDJA 9PCYA 5JQ6L 4JN2A 4PJBA 4KWUA 3OL2A 2HFTA 1G0YR 2P9RA 4HZAA 3P73B 4QRRD 1MHPH 5CCJA 2EUWA 4NO3B 1BQ5A 2NT1A 1HOEA 2R29A 4PVMA 4WV1A 2NXYB 2XKSA 3KYKH 1EH9A 3ZHNA 3RWFA 5D2LB 2VH5H 2XWBA 1U3YA 2EIKB 3UDWA 1UXSA 4U1KB 4HHGA 3MYJB 3OF6D 3FC8A 5CCGE 4MZRA 4WW2B 1IAMA 3KLLA 5EOCH 1D5XA 3CVIH 4O02L 1F6AB 3DSNA 2AJYL 1ZIAA 3QQ3A 5F2QA 3SD5A 4XCCL 3CZS