1E5UI

Nmr representative structure of intimin-190 (int190) from enteropathogenic e. coli
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
187
structure length
187
Chain Sequence
TLTIDDGNIEIVGTGVKGKLPTVWLQYGQVNLKASGGNGKYTWRSANPAIASVDASSGQVTLKEKGTTTISVISSDNQTATYTIATPNSLIVPNMSKRVTYNDAVNTCKNFGGKLPSSQNELENVFKAWGAANKYEYYKSSQTIISWVQQTAQDAKSGVASTYDLVKQNPLNNIKASESNAYATCVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTIMIN
publication title Structural Basis for Recognition of the Translocated Intimin Receptor (Tir) by Intimin from Enteropathogenic E. Coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Intimin
total genus 27
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2000-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF07979 Intimin_C Intimin C-type lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1e5uI01
3.10.100.10 Alpha Beta Roll Mannose-Binding Protein A; Chain A Mannose-Binding Protein A, subunit A 1e5uI02
1UMRC 3CADA 3IKQA 1JZNA 4GK1A 3G81A 3WH2A 2E3XB 4N33A 1U0NC 1YPOA 3C22A 1FM5A 1DV8A 1ESLA 3C8JA 3P5DA 1E87A 2VUZA 2IT5A 1UMRA 3IKRA 3VLGA 3P5EA 5F2QA 1PW9A 1HTNA 3G83A 3CDGE 4ZESA 1RTM1 3BDWB 1KG0C 1F02I 1MSBA 4CSYA 4N34A 1G1QA 1BUUA 5FFRA 2GO0A 1JA3A 4LU5A 3ALSA 2XR6A 4LQFA 2I83A 3WBQA 4WUXA 3DBZA 1BYFA 1Y17A 1CWVA 4IOPA 1RDJ1 1HUPA 1YXKA 3ALUA 4E52A 1BCJ1 1UEXA 1X2TB 1XARA 4J6QA 3WH3A 3C8KD 4GJXA 1UV0A 4PP8A 1G1RA 1T8DA 2MSBA 3VYKA 3ZHGA 1H8UA 2OX9A 3P5HA 1MUQA 3FF7C 1KZD1 4N37A 1BV4A 2GGXA 5M62A 1RDO1 1YXJA 1KWUA 2M94A 3VYJA 1C3AB 4WRFA 1O7CT 1KZA1 3FF9A 2LS8A 1QDDA 4J6NA 1F00I 4J6MA 4G9AA 1Y17B 1HYRA 1R14A 1B08A 1J35A 1PWBA 3UBUA 1RDN1 1KWWA 3PARA 3FD4A 2GGUA 4M17A 1UEXB 3PBFA 1P4LD 3RS1A 2RIEA 4DN8A 1V4LA 4KZWA 4KI1E 1HQ8A 1FVUA 2ZQKA 2BPEA 3L9JC 2IT6A 1TDQB 1WK1A 3WWKC 1UKMA 1LITA 2RIBA 4WR9A 1BJ3A 3ZHGD 4C9FA 1K9JA 5B1WA 4WCOA 4QKHA 3PAQA 1KZC1 2OX8A 2N40A 1J34A 3P7HA 1WMZA 2OS9A 3K7BA 1IODA 1BCH1 4MTHA 3WWKA 4CAJA 3WBPA 4KMB1 2E3XC 2PF5A 4GI0A 2H2TB 1J35B 1QO3C 4M1GA 1T8CA 1YPUA 1V7PA 1YPQA 4J6PA 1WT9A 2ORJA 2BPDA 1SB2A 1OZ7A 4WREA 4KZVA 3WHDA 4S0UA 3WSRA 4M18A 1G1SA 1V4LB 2AFPA 5B1XA 1G1TA 2C6UA 3CDGF 5FFTA 4EZMG 1IXXA 3P5GA 3G8KA 1EGIA 1E5UI 1U0NB 3NCXA 1JWIA 3KMB1 1O7BT 3P5IA 1UKMB 1KZE1 1IJKC 3M9ZA 4G96A 1BJ3B 2XR5A 3ALTA 1KOEA 1RDM1 3P7FA 3GPRD 1AFB1 1KWYA 4WQQA 4AQ1C 3VPPA 1AFD1 1KCGA 3IKPA 1EGGA 1SL4A 1MPUA 2N7SA 4J6JA 3PAKA 1UOSA 3KQGA 4IOPB 1YTTA 1V7PB 3IKNA 5B1RA 1WT9B 3T3AA 1SL6A 4ZRWA 1SB2B 1KMB1 1OZ7B 3BX4A 4AQ1A 4ZETA 3GPRC 4N32A 4AK8A 4YLIA 1IXXB 2BRSA 4N38A 1DY2A 3P7GA 2MH4A 3WBRA 5J6GG 1JWIB 1FIHA 4WUWA 1XPHA 1U0OA 3CCKA 4QKGA 1AFA1 1X2TA 3GPRA 1X2WA 4UWWA 1B6EA 1TN3A 5K8YA 4HU8A 4ZRVA 1IJKB 1UOSB 4UXMA 2ZWKA 4GJ0A 2YHFA 1P1ZD 5FFSA 5KTHA 3UBUB 1TLGA 2KV3A 1FIFA 2H2RA 1KWVA 3BX4B 2RIAA 1C3AA 2VRPA 4WRCA 3CFWA 2RICA 2L04A 2PY2A 3G8LA 4GKOG 4YMDA 2CL8A 1WMYA 3NCWA 1FVUB 4C16A 1U0OB 3FF8C 1R13A 1RDI1 4N36A 2MOGA 1RDL1 3GPRB 1KX0A 1KWXA 1X2WB 2MQGA 2ZIBA 3HUPA 4QKIA 1BNLA 1KWTA 1E8IA 2VUVA 2KMB1 4QKJA 1GZ2A 1J34B 1KX1A 1KWZA 1IODB 4PDCA 3WWKB 1K9IA 3BDWA 5LGKE 1RDK1 2ORKA 4N35A 4J6LA 3G84A 1SL5A 5KTIA 1DY0A 2MTIA 2RIDA 3P5FA 4J6KA 1DY1A 1KZB1 2BPHA 2VRPB 1RJHA
chains in the Genus database with same CATH superfamily
2NY6C 5FYLH 4PJCE 5JXAL 3DBXB 3H7LA 2BNQA 4Z18A 1INEH 1GPOL 4D8PA 3QO1B 1DANT 1RUAL 1ZLWK 4KV5F 4OZGB 2ERJB 2AJYL 4PWIA 2NXZD 3T0EB 1DO6A 1JPEA 4N1CA 1F58L 1VCAA 2ESVE 2P7TB 3L3JB 3P4OB 5DJDB 5CEZD 4J2QA 3GXMA 5CF3A 1KIQA 2R83A 2BIHA 1B2YA 3P5DA 3CFMA 1PTZA 2E76C 4UQCA 2AMGA 1EX0A 1MCWM 1I1RA 2E9WA 3B6SA 3BUTA 5H35A 1ZGLM 4R97B 3ZTDC 4OLUH 2OSWA 2EO7A 3BE1L 3IGAA 5CN2A 3L9RB 3MMEA 4PLNC 1VZGA 4AEEA 3C60A 5JDSA 4R26L 2OMNA 4M3HA 4PCTA 5D7JA 5EOCL 3TBVA 4GAFB 1L9SA 5FO9A 3RX7A 4JPVH 5A2FA 3KJ6L 4QOKB 4YDMA 5C0AD 2OL3B 3STZA 3IDIA 1V8HA 4ZESA 5SV3A 3V4PA 1NGZB 4HBCH 3VSQA 3WG7B 5C0CA 4FRWA 1TZGL 3WMQA 1I1AA 2ZOLB 1Q1JL 1Q9LA 1WTGT 1FO0B 1MSBA 2XPYA 2VLJA 3RI5K 1U2HA 4U31A 4P3CH 1WIOA 4IOIA 4XXDB 1QRNA 2XQYG 4EN2A 4FKHA 1MCKA 5IB3A 2D7OA 4EIZC 2WV3A 3FQRA 1JA3A 4PV8A 4LU5A 1I8IB 3MRCA 1JWSA 5T5FH 2YC1B 1BW8A 1ZSDA 1MJ7H 2A1WH 2E7DA 1E5BA 2PCYA 2W0KA 2Z7WA 2J8UA 5I66A 3U79A 2X4SA 3DA0A 5D2NC 3W57A 1BM3H 3WIFB 3NJIA 4LMQE 4LSVH 1EAOA 1BD2B 4N0YL 2WWOA 4F8OA 2CA3A 3G5YA 4PLOB 2C3GA 2GJZA 3PL6D 2FGWH 1HQRB 3QIWB 3BAKA 4K3JH 4TVPE 4ELME 2AEWA 3GRWH 3ALUA 2VTFA 2JCCF 1GC1C 2ENPA 3WU1A 2AHIA 4E52A 3Q8FA 3MREB 3VFMB 2Y07L 1ANUA 2I7OA 32C2B 2VL5B 4TYUA 2Y7OA 4EI5C 4HQQH 4OGYH 4APQA 1LEGB 3S8FB 1J12A 4U4BA 4Y5XB 3IAQA 3PXHA 4BM7A 5CEZL 3CSPA 2PYEA 2XWTB 3IM1A 1VPOL 2CPCA 4LP5A 4YHKH 5J6HA 1TUPA 3BZ5A 4GUOA 4G6ML 5GRWA 4Y7MA 1ZANL 5JO5B 1C8PA 1BFVL 4JFOB 3PWVB 5DUPL 2BWQA 1E6JH 2FATH 3T2OA 3HB3B 4G8GE 3P77A 5I23A 1NLBH 3PQYB 5D4IA 1NCCL 4PBWD 1Z66A 4X80H 2E59A 3BESR 3GO1H 3VGEA 1CUOA 1MDTA 4FYQA 2J8HA 1QWNA 5AYUH 5C3LD 3H2PA 2JI3A 1UA3A 4XNQB 4AGNA 4L3EB 1SMDA 1LEIA 3DSNA 5J8OA 2CO2A 5I0ZA 4A2GA 1ZGLA 2A74B 2XN1A 3MNWA 4YE4L 4O51A 5DJ6A 3Q2VA 2AJ3B 1HE7A 3REVA 3WD5L 4Q9RH 1NCNA 1T7YA 1GS8A 4P5MB 3PWLA 1PKQB 5IWLC 2AEQH 2C34A 1FZJA 1EO7A 1NFIB 1UJTA 4P5TC 2X41A 5KVGL 3NN8B 4FYRA 4I0CC 4LFHD 2P5EE 4OU3A 4LOFA 4U1GB 2CU9A 5CGMA 1J35A 3QUXC 3UBUA 3BZEA 4Q6IA 2YOCA 4IJTA 4F2ME 3EO9L 1IM3A 1OWWA 2H2SC 3MUHL 3X12A 2G4GA 1HL8A 4F5CA 2BCKB 4X6CA 7TAAA 3C8KA 2VDMB 1UM6H 1JHLH 4KITB 1CD0A 2WQVA 5D1QE 2G75B 3B7TA 4J27A 1E4KC 4OF7A 4RFEB 1L3NA 4WRLA 4PBXA 3RLSA 1CICA 1FN4B 2R7EA 1TVDA 2ESVD 4LSUH 2AI0L 1A0QH 3OKNB 1V3KA 1P7HL 3GS0A 4CL7A 4P8QA 4QI3A 1TJHL 3IEAA 3IJYB 1KCSH 4UUJB 4YHOL 4HEPA 4DCQA 1JXJA 2YJLA 3NFSH 4WR9A 5DSCB 3QIBD 3I9GL 5HDBF 5E4IA 3ZHGD 4C9FA 1DP0A 1QSVA 4ABVA 1F4YH 3Q8CA 2J8UF 4JE0A 4XC1H 3QXAA 1BXAA 1NOLA 1GJUA 2FH8A 1KIPA 1FWXA 1EXGA 2ZUQC 5CCKL 4H26B 5KJ7E 1JTOA 3EGSB 1OZUA 4YGVB 4U0RB 2WTRA 3QNZA 1QNIA 4KMTL 1CDIA 5B21A 4MA3A 4ZD3L 1RJYA 1JNHA 2H9GB 4NQSA 1RERA 1ONQA 1O5DT 1A02N 4GRMA 4XE0A 1TKWB 5AW3B 4ZFOA 4S0SD 4TVSa 2XLLA 3WNPA 2DLFH 1WMZA 4KTYA 1ZXKA 2AABH 3QNXB 2ED7A 3GXNA 1M6UA 3R7QA 4KMB1 4GSUA 4PUBH 1XZWA 3IMVA 3PWNB 2QELA 3UPAA 3GLEA 5DVOA 3QXUA 3AXLA 4EEEA 1MF2L 1YPZE 1J86A 1RZQA 1RZFH 3LXAA 4OFKA 5FR3A 3F5WA 3EH4B 1OZ7A 2I69A 1JG9A 4WUUB 2XRAL 2XG4A 1I9JH 2JTYA 4HUXB 4XMZA 1CT8B 3FO9B 2O72A 5EIIB 3QRFM 4WUKL 3HPLB 4P3WA 2AFPA 4OGXH 1EZVX 5F88A 5B1XA 2ZKMX 1P5UA 2F54B 4TVPD 3R06A 2B39A 2Z8VC 5DJ8A 4BCXA 5I8KH 1ED3B 3AREB 5IJKA 2H45A 3QJTB 2AJUL 5GJTL 2PW2A 1EHXA 2W60A 3KVDD 2C5DC 2HP4A 3FO2A 2GFBA 3LB6D 3LXCA 3VFVA 1X5MA 1NAMH 3AMLA 2V8LA 2XR5A 4DETA 2WW8A 4FA8A 3P3SA 3SE8H 1I3GL 1BQSA 4BZ2L 2CJUL 3L6FA 3K6IA 3MUJA 4FQIH 3BWAA 3U4AA 1C5BH 3LKPA 2OTWB 3K2IA 4IIZA 5B22A 1HWHB 5F9OH 4YXLH 3VD3A 4G8GD 5ID0B 4MNHA 1BHGA 3IVKB 1QQDA 1WEJL 3GS4A 4B96A 1AQDA 1YDPA 3RUGE 5CJQL 4IMKA 4XB7A 3LEYH 3L45A 1BWWA 4NNPL 2WJ7A 4XNAA 4LL1A 1LK3L 3RVTD 1ORSA 4H0LC 4U7SA 5KYWA 3UCRA 2EE2A 3UCQA 1GTFA 3HG4A 1YJDH 3TA3B 4IOPB 1A6TA 5KSBA 5D7IB 1WAEA 1JVOA 3FQXB 4I8DA 1LO0L 2VABB 2B2XL 3GYRA 3EW3B 3UTTA 5F7BA 1BQUA 4NKDB 2QGEA 4YVUA 5C7XL 1KMB1 1IM9B 4KOCA 4AQ1A 2NT1A 5J11B 1R5IA 1N19A 2J25A 2P5ED 1EGJA 3CN1A 4UV4H 3VFTA 2X40A 5E6ZA 4F91B 3OKEB 2V7HB 1U21A 2WINB 4PJXE 4PS4L 2D7MA 2HN7A 4JLRB 1A2YB 3RAJH 5I1EL 2VIRA 4CU8A 1MWOA 4NN7B 3P7GA 2MH4A 4JCLA 4NSKA 2E74C 2ICEC 3H9HA 2N3JA 4OLXL 4F8PA 4MMZC 5D1QD 1GIGL 3QEHA 3HB3C 2BRRH 3GGWA 4FJ6A 1F2XK 1SMOA 1G7JB 3EBIA 3MGOA 2K45A 4NNYB 4F7PB 3CCKA 4ORZC 3ISYA 1T0PB 1FHGA 4JM2A 4L2LA 2PPAA 4XVJL 1AFA1 2RALA 3QJHB 5CKGA 1B4JL 5IMMB 1NA8A 4G59C 2BINA 3WTWA 4AJVA 4GG6E 2VLME 2P46B 2J88L 4M61A 5E6UB 3VD5A 4XZUB 4K7PX 4TQEL 4XH2B 1OGTB 4N0FB 5I6NA 2DLTA 3RILA 1DYZA 1PSKL 4UYQA 1G7QB 5JPMB 4UU9B 1BMGA 1CFQB 3QJFA 4NKIL 3HMWH 3MDJA 1N9PA 4JN2A 3LQMA 3A3YB 3NK3A 3ZL1A 2AS5M 3NVQA 1SFDA 2ZJSL 1CU4L 1MY5A 3JYCA 3RDTB 3G7TA 1BGXL 3L16A 4M7KL 2O6DA 1S46A 2CO7B 3RKPA 2WN3A 3SDYH 3B9EA 2NX5A 3QEUA 1KJ2B 4CAGA 4X4YB 4K3DH 1RIHH 4LXFA 4P9MH 5AVRB 2IIJA 3BIKB 4AGQA 4AIEA 4KQ0A 1WIUA 1OP4A 1MN4A 4MVBD 3NRPA 3BX4B 3HAEA 5KS9E 4IRJA 2MCMA 4BRJA 1GYCA 3ETSA 2O4EA 2WLZA 2LQRA 2F5BH 1EAPA 2IBZY 4XO9A 2RICA 2YXWA 1JGEA 1PNDA 2X9ZA 3UFIA 2XICA 3CC1A 1UM5H 3RPIA 1T6BX 8PAZA 1KLGA 1IJ9A 1QA9B 4GKOG 2W0FA 2CL8A 4RISH 4NNXB 4NXSA 2BP8A 4NRZB 4DEUA 2VDPL 5TD4A 2DWXA 3TFKC 3QXDB 1HQ4A 3BDXA 2JK5B 4G8FA 1XGZA 5FUZL 1HOCA 4HYTB 2BSED 1G6RL 2C26A 4PB0L 1ZGLP 4UBDD 3PNWB 2WZPD 1YMME 3GQFA 3NIGF 4UIKH 5FGCE 2PTTA 3GPRB 3EGXB 3BP5A 2BMKB 4NUJA 3KEHA 1H8OA 2XOTA 1MWAH 4UOW1 5EF1A 1J0YA 1NCGA 4FCHA 4PJGE 4H25A 1YECH 1X5FA 4S10A 8FABA 4OLZL 3O8XB 3F64A 2Q3AA 3Q5TA 4K9JA 1P7QD 1Z7JA 4AKQA 1JF6A 4JRXB 3S37L 1YQVH 4JCMA 2YMOA 5L9DL 4Z9KB 3WY4A 3HBQA 4TV3A 4A1RA 4Y19E 1VEMA 5B3NA 5FFGA 4MB4A 3HW7A 4KDWA 1F1DA 4OQTA 12E8L 4UQ9A 4POUB 1ESOA 5JXEC 1S7XB 1MLCA 3RVXC 1OAYL 3LKNB 5EZJB 4G7SB 3O4OB 3GSRA 2R69A 4ZFGL 1D5MB 3D4CA 4B3VA 1NIAA 1ZV5A 2DH3A 3ETTA 4QHMA 4XOBA 1WICA 3HG0A 3DJ9A 1VACA 4O02L 2P80A 3VM7A 4F7KA 5KVDE 4WW1A 4FLOA 3KDMA 2KLSA 2JLLA 5E2UH 1JGUL 3O45A 1LE5B 1FYTE 4AW7A 4BA0A 4HJSA 5DD3L 2XI9A 2GIYA 3V5HB 1S9WB 3C8DA 1ZHNA 3G5XB 4Z7NF 3T0BA 4PGEA 3KLDA 2Y4SA 2WZ6A 3APDA 5F8RC 1OGSA 1OSZA 2BH0A 2OX5A 2YRZA 2W91A 2OP4H 3B2VL 5GGUB 4G8EB 4CDHA 1E87A 2EIZA 3QUYD 4XNBA 1A4JB 1B3JA 4OGZA 2BK8A 1QLEH 4NUGH 4ODTH 3EZJB 3DX8A 4D8OA 5B38A 3G04B 4LSQH 4X6DF 5DZOA 3VXRB 5LHDA 2OK0L 4WI4A 2VXQH 2Y1ZA 3BT2H 4ES9A 1IGML 5EN2B 3QRBA 5DD6B 2HT3C 3MOBH 5B1JC 1X5HA 3HZMB 1PDKA 1D6VH 3CDGE 5D2LF 2DQGH 2X0UA 4KRPD 5I1JL 2OFQA 1EJFA 4R4ND 1XF4A 4YLQT 2VLMD 3K81A 1WTLA 2JCWA 4GRWE 1SXNA 3BLPX 3JWDC 4NT6A 4QTIL 3WTUA 3WLWD 4G7VL 2X4NB 4QXUL 3TA3C 3RA7H 4L3CB 1BAGA 2EC8A 3IJ7A 3LV3B 1GZPB 1EIBA 5DUBA 3LEVL 5D5MF 3ARDA 2BERA 2J55A 4A55A 4MJ5B 4D0BB 1A64A 1FG9C 2GO0A 4GQPH 2NW2B 4JEGB 4XCFH 5KJRL 3HRZB 5AZUA 4AM0Q 3PWPB 4Q0XH 1BXXA 2E4FA 1T89C 3RRQA 2ALWA 2I83A 2XR6A 4LQFA 4XXCC 1E4WH 3BT0A 3QR1A 3RWDB 3T1FA 3RYMA 4HUWB 5I8EA 4BXSV 3MBEA 3WJLA 5ILTL 4PJBB 3KVPA 2H6OA 3DBZA 3QWOA 1Y1UA 5DZNA 5BRPA 1XSIA 3VB8A 4AITA 1PZUB 4HPOL 4Y4KA 4CMMA 1B9KA 3OSKA 4NRXB 3BWUF 4KU1A 4L9LC 2F74A 1P53A 1JYNA 1EZLA 4K23L 2ODHA 4PJ5B 1LQSR 1E0OB 2FB4H 5DJAB 1BLIA 2X6UA 3M1CA 3QDGE 2EDXA 1ZA6B 3BW9B 2YBGA 3KH3A 2ITFA 4WK4B 3VXUE 1D5IH 1F3JB 4JPIB 4OIIL 2B1HH 4ADGA 4NX0A 4JG1L 4PMEA 3ES6A 4OF0A 1J8HA 3VRJB 3F00A 4LGPB 2CE6A 4JFQB 4NZTL 4K94C 2UX7A 5JPMC 4G9FB 5CP7A 1YMMD 2XY2A 1E30A 1WWAX 3RTQB 5CIPH 3ALXA 3U1QA 4HWEH 3KPRE 2IGTA 3KPPA 3DMMD 1T1XB 1AGCB 4BEIA 3NYKA 4PJ7B 3QZPA 1A7QL 5CP3A 1P4IL 1A6ZB 4JGMA 1SN0A 1QNZL 5EU6B 4P2RB 3MRGA 3SYPA 4WEBL 4E9YA 1TFHA 4APXA 5DHMC 4JDEA 1ZHLA 2Z0BA 1SLWA 1FI8C 4P23A 1MIEH 2MCG1 5HHPB 4Y19D 2CCWA 4P5SA 4ABUA 5MEQA 4BK4A 5HGBA 4TRPH 4DGIL 4NQCE 3M17B 4J6NA 4LHUG 5DR5H 3FB8A 3DPBB 3Q8BA 1ZMYA 5AD0A 2X7LA 4Z95H 1MI5B 1XF5A 3VNYA 3OJDA 3BAYA 5GGRB 1XAKA 3JWOC 5L0QC 4FQXD 4N4YB 1I3RA 3NJFA 1F97A 2UWEA 3BO8B 3Q9PA 4KUCD 2QKIC 3FTVA 2JQZA 4NKMA 2WLYA 5BXFA 1AS8A 3V4PH 5IQLA 3OLGA 5MENA 2NUTA 1RUKL 1MLBA 2PF6A 2ZXEB 3DV4A 5E2TH 2DAVA 1OW0A 2EIMB 4OTXL 3PCYA 5HGAB 1FYTD 1KFAL 4LASL 3MA7A 4U6HB 2QQKL 3GD1C 1VA9A 3N43B 4ONFL 1NOFA 1E4XL 1N8ZB 1YEDA 3O8XC 3BGFC 5AW7B 5T1LB 4HPHA 4LU5H 3KBEA 1FCCA 43C9A 4CN1A 1CLYH 1JV5B 3FU6A 4MA1C 3S88H 2BY0A 3PWJA 2DW5A 1FZOB 3FTYA 4NJAH 2Z1PA 5K9QG 5I1LB 5C0IA 4R0LB 4JPQA 5DTFB 2ZD0A 3VXNB 2YD7A 7PAZA 3KGUA 1OCWL 4WTZG 1C5CH 3GMMA 3MRBA 4C55A 2HKHH 5B1WA 1AZUA 3BP4A 3UBXG 1NEZA 1T21B 2XU9A 3W3BA 5IW1B 2OULB 1CR9H 5JZ7D 3MV9A 1J0ZA 4JO4L 1QFWH 1P1VA 3ZYJA 4DKEL 3BZ4A 4WWKA 1OLZA 1OIOA 4PRBB 3MROA 5I30L 2MNWA 2NQCA 1XGTB 1OGAE 2VRAA 3C6LB 4M93C 4AK1A 2FYVA 1NKRA 4HHGA 2A9AA 1O7SA 3HN8A 3A6BL 2ICWA 3FUIA 4W93A 2H0FA 2L7UA 3DDFA 2I07B 1ADQA 4NIYE 4X99A 4X83A 4M1GA 3DX3A 4ONHB 1V7PA 1WT9A 2A7BA 4NKQB 1J7VR 1S7WB 3L4TA 2CH8A 5DUJA 4PGZA 4NN5C 1XR8B 2ADIA 2YPLA 4YQXL 1FC2D 4YDZA 5FC9A 2R23A 1JK8A 4J3OD 4MJ6B 3QYMA 4M4RB 2JWYA 2WYZA 4IJ3C 4N2KA 5CM1A 4FG6D 5DJCA 2IV9A 3ZZLA 5E6ID 1AAJA 1MDAA 2EH8H 1JXKA 5EUKB 1U95A 3DJSA 5KVDL 3P5GA 2WKOA 3G8KA 3BEVA 5ACZB 3QDGD 3HG1B 4UOJA 3VDCA 1MAMH 3VXUD 1EA9C 3IU3B 4E0RA 4OCYH 2CLZB 3GSWB 3Q5YA 2ZICA 1QTPA 3UG3A 4DPAX 4P2QA 3ULAB 1AD9B 3N50A 4JFYB 1KJ3H 1LE9B 3FRPB 3SYQA 3ZE2F 5TFSL 4HSAC 3STLB 4U6VH 1CD1B 5IVZA 1F6LL 1PLCA 3RU8L 3KPRD 5TGBB 4N2OA 1FZKB 3DVGA 5F1IA 3FUDA 3HRZC 3DIDA 2DLIA 3MNMA 3CH1A 2HA1A 3US9A 1JL8A 2F5AL 1PX4A 2XZCL 1LWJA 3F7YB 2PTVA 3DIVA 4M9OA 5I6XB 1NANI 2FD6H 4P46A 5CILH 3TEYA 3HR5A 2BRQA 2IH1A 1UYWL 2N7SA 3ALPA 3AS2A 1MPUA 1Q1PA 4Z7UB 5IW3A 3FTZA 1BQHB 3UJJL 4ZFFA 3QT2A 1UH2A 1PF3A 2EINB 4A63A 3IJHB 1LO4H 3QUMA 1TQUA 3AS1A 4FFZL 1S2EA 3I85A 2XZQL 4QYAA 4YDVA 3WXVH 1YTTA 4X6FB 5GGVH 3PJNA 4X9YA 1EHNA 5F1SA 1PZ2A 3T3PF 5B7MA 5DHYA 4NQCD 4DPBX 4OZHE 2Q7YA 3VM5A 4KHTH 4RDQF 3OV6A 4TLTA 4KPHH 1IT9H 1U93B 2HUHA 1GRWA 1IAKB 1ZAGA 1NGQL 4UT7H 1DJIA 3UAJC 4L4TB 1CIUA 1PZBA 1IXXB 3I6KB 3WBRA 2PN5A 4PJFB 4HIIB 4WI0A 3RTQC 5A2BA 3LRSB 1RHFA 5A40E 2YMXH 4LPUA 1X7SA 4EKJA 1W0WA 4ZO8A 1AO7E 1KPRA 1VLXA 4HXAL 4U3HA 2NCMA 1IL1A 4YC2C 4N2NA 5D2NE 4LOVA 2FZ3A 2R29L 3F65A 1FPTH 1X2WA 4QXTA 3QCUL 2JKNA 3AQYA 3WEOA 2P42B 3POHA 3SE4C 1KJMA 4POZD 1CXFA 1XL4A 4NQDA 5KYUA 4H8WC 1HL5A 5ALBH 5LAXA 4NO0A 4HUVA 4FQHB 5E1QA 4N8VG 2XA8L 4R90H 1NCAH 2G2PA 1U91A 3EAKA 2EXYD 3RX9A 1IEHA 1F11A 5CLZA 5MEOB 5D6DA 4XNUH 3ZIMA 5AKSA 2WLIB 3ULVL 4FERA 3FXIC 3UH8A 5CCGE 4GO6B 1NAMB 4R7DB 4P57B 2WIMA 2C3XA 3J7HA 4KHXH 1EFQA 4GKZB 3ZLQC 2A99A 3GBDA 1FGVL 1A14H 1DSWA 2Z8WC 1IFHL 1OGAD 1G7HB 2H3XC 2H1LM 2WKOF 1HEZA 4MNGA 4UB0L 3ZX1A 5HVHC 3BRFA 4WKXA 1C3AA 4GQRA 2WZ0A 4QY8B 1YAZA 5I1HL 4DZ8A 3DUUB 5I1AB 3ASOB 2PY2A 1AKJD 1OT1A 4CW1A 3VD9A 5SX5H 3E6HB 4HS6A 1BZ9B 4KZEH 4M29A 3RWJB 4S1SL 3IDGA 5BRZB 2YA0A 2NY0B 2ZKXA 4FI6A 3MRHB 5IB4A 3T2QA 4AV5A 3FQTB 3MC0A 1WSST 4OCWL 5BNXD 5EF0A 1OCZB 4JO2H 1RZKL 3F8UB 5LQBH 1MVUB 2LTQC 1X6LA 4JDTL 4M6NL 4AT6A 4TTDD 4RFNC 5C0BA 3CDYA 4N36A 3CFIC 1OOAA 3MRQA 5CZXC 4NZRL 1OQOA 3O11A 5J9PA 4I3RL 4N85A 4NN6C 3IAPA 2ATKB 1CVSC 1I7UB 2Y5QA 5KN5A 4QKIA 5C0AA 2AAAA 3VI3B 1YEIL 1NGPH 2WXJA 1FNGB 4PJ8B 1E9OB 5FM8A 4MDIA 2VUVA 1JPGB 4Q14A 5ITBL 4L8BA 2X09A 1FQ9C 2QADC 3QDJB 3SDCD 3P9MB 3QH3A 3E8UH 1P84K 3B9KA 4XVOA 2D8KA 3CMOH 4RDQG 3O4LB 1LP9E 1ZKAA 2LFEA 2QQLH 5E23A 2OA9A 2VXTH 2P43B 4D0CA 2N0MA 4N35A 2CCVA 5I18L 3HNVL 3EOTL 2CBQA 2D2OA 3SCMB 1G1KA 1KWKA 4N0UB 2WBJA 4B27A 4N0CD 4JY6A 2XKUA 4S2SB 1H3WM 3Q2CA 5HGDB 1ZHBA 3WUZA 3B1UA 3ARWA 3AG3B 1S9VA 5I1GL 5IVXB 1FFPA 1AI1H 1CDYA 2HPTA 4JHAH 1MAKA 3V4VA 5EO9B 1KIUA 4Z6AT 2HVKB 3LZLA 1FLRL 3T0VA 4N8UA 2A73A 4I48B 1SDDB 5BO1H 2CBTA 2AITA 1IBGH 1NINA 2J44A 2BW4A 5GRVK 2E3XB 4DKDC 3GUTA 5I24A 3NRFA 1KCLA 1EUUA 3GSVA 2WVVB 2XVBA 5E2JA 3UADA 1FM5A 2G9HA 1FBIH 2CRMA 2FX9L 1WFNA 2GQHA 3FHAA 2F53A 4MYPA 3HFFA 2YSTA 4ESKA 3FJTA 3C8JA 3BJ91 4GKSB 5ELIA 5E6SB 2DM2A 3ZR6A 2GJ6B 4AC4A 1YG9A 2ZNXA 4QHUB 2ICWI 2WTPA 3RNKB 5JW3L 1N6QH 2B4CL 3H9SB 1RULH 1WBXB 4LSPL 1AO7D 1Z3GL 2HVJA 1WAAE 3FKUS 4HMCA 3G6JE 3WDJA 4BZ1H 1NM4A 3IFPB 2EUXA 4IU3A 3VACA 2ADJB 4YSAA 2LW3A 3G83A 4IHBA 3AB0B 4HUUB 2WWNA 2NY5H 4NQVA 3RGVD 4L4JA 5AUMB 5BQ7B 1LL1A 4MAYD 1DUYB 5T1KD 4ZAKD 4X98A 4YBLB 3MTXA 3QHZH 4WSGA 3DIFB 3MUGA 2XZZA 3IETA 4RBPK 1H6EA 4I18A 4CSYA 2CIIB 5GS2H 3U7YL 1JF5A 2RCSH 5BV7B 1K8IA 2WSDA 3GSOA 2B0SL 4I5BA 1ZWIA 4EDWH 2CKNA 2C9RA 3BGAA 3ZDZE 4F3FB 1I8KB 3CH8A 1Q0EA 1QSZA 5D6CA 2A6JB 1U6AL 4R7LA 1T1WB 2HFEB 4PJCA 4CDGC 5AAMC 1E40A 1YEGH 4P2OD 2BOBB 4B7IA 4TSCH 3AS3A 5I0XA 1SQMA 4WY7H 4JGJA 1AOZA 1FHNA 2F58H 2DI8A 2ZSWA 5I76B 1M05B 2ZUVA 4L1TA 4K7PL 4OQTH 1JMXA 4QRRB 2ESVA 2X4RB 4FD0A 3ARXA 2ZIDA 1ID5I 2ADFH 3IDJB 4ORGA 5IOPB 3K2UH 3P4LA 5EBMB 2E6QA 2OMTA 4XP5H 1A1NB 3N55A 3IAGC 2EE0A 3K0YA 3QSKB 1L4IA 3U4BH 3LQZB 4B9JA 4LHJB 2YEQA 3X1BA 4PP8A 5E6RB 4RA3A 3VWJA 1KWGA 3LX9A 2AV1B 2ITCB 3QIBA 3QULB 1DHKA 4KI5C 3ZHGA 1XVSA 4NPYA 2Q6WA 1XF3A 3RX8A 2YAPA 5JPNA 1IBZA 2XBZA 3BI9X 5KOVC 5CEYA 4EBQH 4NDMA 1DDTA 3N44F 5FYJE 1GCFA 4JY5L 4WW2A 5DJ2A 1U8HA 2B1OA 1AGEA 4HPYL 1KCVH 5DMGD 2OZNA 3BP7A 5AOIA 3CK0H 3FF7C 3L3IB 1BX2B 3ALWA 4LSSL 2Z31C 1ZOXA 1MCSA 1BVOA 1QLEB 2H2SD 3MYJB 3L4ZA 3SPVB 2GGXA 2IWKA 3LVTA 2VXVL 3W11C 1A4AA 2NQ3A 2EIJB 5FM5O 1YLBB 2AJXL 1V7NL 1P6FA 2APTA 1NANH 1A65A 4H0GA 2Z91B 4ANKA 2VDOL 3LPOA 5I71C 2Y6SD 2WUBH 1IAMA 3WAKA 1N12A 2Q8BL 5DJXB 2NY0C 1MCCA 4PJEE 5L4MA 2HJKA 1Y17B 1NMBH 1YJDC 2GCYB 4ZW5A 1SOQA 1B08A 2NMSA 5H37A 3THML 1FRGH 2A9NL 5D1XC 3Q3GB 1B4RA 1Z6JT 4XWGH 5HP5A 4HDIB 4MX7B 3B3IA 4Y8DC 2CWRA 2WP3T 3O2WH 3UZEA 2H7WA 1HSAB 3N91A 4IOPA 3PBFA 1C12B 4ELMA 2H26B 4M43H 1VFUA 2UX6A 4LLVB 4MQTB 2G2RA 3O2VH 1V4LA 4KI1E 4PJ8C 4PG9A 3CVBA 5CINH 4FXTA 3TYGH 2WBKA 3KPMB 3DROB 2G3XA 2FX7H 4LQFH 2QPUA 2P8MB 3ILPA 2YS4A 4BFNA 2JCCB 3W56A 3AADB 2MSPA 4E41E 1ACCA 5L4IA 3WUWA 5JLZA 5HI3D 4V11A 3EHBB 3RKDD 2Y36L 2NY3B 2W94A 4LEXL 2AMUA 3G08B 3AY2A 1BJ3A 2X1PA 3MJ9H 4QJ4B 5ADPL 2WKGA 4G8GA 1IV8A 4KTDL 3EYQD 1KGYE 4TQPA 2I9LB 2NCEA 3VWKD 3NJLA 1C1EL 1MUJA 4Y9EA 4QKHA 4PJCF 5T5NF 1O6SB 1JBJA 3UZVA 2ZTBA 2QJDA 5DJZA 1BF8A 4IGBC 4AXWB 3QK0A 4MYWB 4HWBA 2YGPA 2OX8A 5CIPB 5B1CA 1QBML 3GMQB 5GSRB 3PGDA 1NC2B 1Q72L 2ICWJ 5ANMA 3BMWA 3I3DA 3QUHA 3PREA 1MJJB 2E3XC 1NGWA 1CD8A 4AKOA 3HBGA 4JQXC 3VA6A 2H2TB 3MRLB 2OMBA 1J05A 4UT6L 5A43C 3D25B 5CU5A 2BVQA 4PJIE 1JPST 4XWOC 5DWUH 4BJLA 4UAHA 2VSDA 4YHPA 3DVNA 5HY9B 4MQSB 4F2MA 3WSRA 5DURD 5DT1L 1A5FH 3ARGC 3NABL 1XGRB 1JPTL 5H35B 3BKJL 4XN4A 3IGAB 5D1QA 1QX1A 1LD9A 5JOFB 5C92A 1KC5H 4IRSC 2BHYA 2JI1A 3MLXL 1CO1A 1QVOB 4JO1H 4ZSOE 4HK3N 3EF7A 1URIA 4ISVB 2Z92B 1X5ZA 3GZQA 1JWIA 3IDIB 3AB0C 4I7ZC 4LRNL 4R2GC 2R1WA 1TQBC 2X10A 2BPBA 2DMGA 3SKOA 3CFTA 4DFIA 2XTLA 1YEJL 1S7SA 4JY4A 4XO3A 5K93A 2E7MA 3HC4L 4PJAE 3BZFB 1WYJA 5E4AA 3C2SA 3FQYA 3DGCR 3GBNH 2Y5TB 5IB3B 1D5XA 5FYJD 5EH1A 3FQRB 3OPZL 3VD1A 3NPZB 3MRCB 3WMPA 1TJIL 4U3XA 4QT5B 3ZZ1A 1SN5A 3WFDL 3BDYH 2V5TA 2J8UB 3IF1A 4JFZH 3FQ2A 3SDAB 5I66B 4OI8A 3IKPA 3NJGA 4XPHH 2X4SB 1NIEA 2I5YH 1MFEH 4QHLB 2FQEA 4V1DE 4ELMF 1KCBA 1I7ZB 5FUCE 3OMIB 5FGBA 3QWRD 3ESMA 3EJUA 4LBAA 4DUVA 3QCTH 3SY0B 4Z8FH 4NFBA 2ED8A 1SL6A 4Z3GA 2HB0A 3WSQH 1EDQA 2K4WA 1SB2B 3EFDL 4U49A 1XGQA 5F0JB 1JRHI 2OPCA 1YPZA 1UWXK 2CGYA 2OL3L 3RZCD 3V6OE 5CD5C 4TUUA 3DHMA 2JMRA 3K1KC 4APQB 4I9XA 3E9UA 2BSEA 3GSXA 5EOCJ 1IBYA 5LBSA 1KGCE 4N2MA 2ITDA 4LNRA 3MCKB 2C1OA 2WZPA 1QSFE 3FFDB 5T5NG 5F96H 2DWTA 1DQLL 4U1MA 1JDDA 1GAFL 2P8PB 5J6GG 1UD3A 4WJ5A 3VRLE 3LN9A 4ZXBD 3MACL 1DL7H 3MKGA 1XPHA 2NNXA 4WO0A 4RWYH 5AG8A 1GMIA 1C5DB 4B9PA 1TZOA 4I89A 1DLFH 1TNNA 1FYHB 2HSIA 4PWEA 5E08L 1P7QA 4LL9A 1BOGA 4OFDA 4UWWA 4TOYH 1ADQH 2PW1B 4M1GH 4RETB 4J3XA 4U2ZA 1LEIB 4DGVH 1KTDA 3DSNB 3DX4A 1YEHH 4E41D 4PTUB 3VXPA 2WNGA 2LVEA 4W9FC 2W65A 2AJVH 3C5SA 2AJSH 2YD3A 2BNRE 5HJGA 5MERA 4A2LA 4KOBA 1E43A 4JQVC 1Q8MA 3II3A 2DS4A 4F2FA 3FFCE 1FZJB 3D0VB 5C09A 4XX1E 5GIRA 2APXA 4P5RA 3G6DL 1R6VA 3FULA 4KDTA 4LPWA 4QYOB 5MI0B 3OF6D 4WHYG 5F1NB 5F7EH 4CRPA 3UBUB 2LLNA 4X8CA 5ACMA 2DMBA 3BZEB 4Q9QH 4Q6IB 1AGBA 1WZAA 1IM3B 4LLDB 5FX3A 5D96B 4O58L 4X6CB 5L2KE 2VRPA 1JHTB 4HLJA 5ALCH 4RIRB 6TAAA 2A9CA 4ODHH 4ILDA 2XTJE 2YFNA 3T4AA 5HHME 4O2EA 4PRPA 4L4VE 4F15B 5JA8B 2R7EB 4NQXB 4OV5B 1OARH 2VZOA 2V7NA 5GRYA 4PJXA 5HJ3A 1YC8A 4NKOA 3QUYA 4FABL 3GJEB 2FT7A 4YR6A 3HBZA 5JXAH 1M56B 1U0OB 5AVQB 2KBGA 1KZQA 1YN6A 2NY3C 3D9AL 4JREC 2G60L 4BDVB 5C2BL 3GLAA 1QEXA 1RUAH 2FQDA 1UATA 4QIRA 3RVXD 1QTYT 5DZAA 1JN6B 1QBBA 2F2HA 3QXAB 4F7MB 2KQMA 1BNLA 1F58H 4M1CC 5GGQL 3P4NB 1SHXA 9PCYA 5I6KA 5L7XH 2Q10A 4GG6A 1IGJA 2DKMA 3K0WA 1JNHB 1JI2A 2HUEA 3QIUD 5EZPA 1GKEA 4NHCL 4Y4FB 4ZFOB 1Q94A 2KZKA 1L6XA 1VRSA 2FO4A 1TQTA 1SM3L 2R0ZL 5EF3A 4WFHE 3BE1H 2GPZA 3SPGA 1YPZF 3TX4A 1CFTB 3T0AA 4LEOA 5FEBA 4R26H 2V9UA 1EPFA 2XPGA 1IILE 4RGNE 1IE4A 3CZUB 4UTAA 5EOCH 2HH0L 3KJ6H 3S97C 1LTXA 5TDNB 4OBSA 3L1OL 1SY6L 3DDGA 1USZA 2FX8H 2HKFH 4RBPH 2ROXA 4HWUA 1DY1A 1YAIA 3D69A 4F7CA 3QRLA 1E42A 5C3IA 4BV1A 1TZGH 1M7DB 1T03L 4V1DD 1JGDA 1Q1JH 1ZS8A 2P5WA 5DD1L 4CU6A 5KS9A 1I1YA 4RMRA 2EC9U 3CADA 4EIGB 2YEZB 4UQEA 5EUOF 4LDCA 2WD0A 1P5UB 3KWUA 3C60C 3MLUL 5BS0E 2XC8A 3CVCA 1DJWA 2HT3D 3D87B 2WXHA 3HE6D 4WENB 5D7JC 1YPOA 3M1BB 1YY9D 5IQ9A 4JK0D 3RL1B 5DI8B 1KULA 4HEMA 4OLWL 1CF8L 1GW6A 2KLRA 3VFVB 4JFUA 3QP3A 1U58A 1L0PA 1I1AC 2L7EA 5E00A 3QRGL 1KGCD 3PU7A 4OFQA 3L6FB 1QSFD 3MLWL 3QJRB 3BWAB 4JMXA 2WOYA 3RUGF 3D18A 3DMMA 1HILA 4LARL 3KLAA 5I82A 3CG8A 3NCBB 1WWBX 4PJGA 1PW9A 5AQ0A 3NIGB 5HHVL 3V6BR 2Y07H 3HE7D 3V0FA 1CXLA 3AC0A 3TCLA 4AYSA 1HHIA 3C87A 4A7QA 3WHE0 3KPNA 1C16A 1W16A 5CEZH 2NY4B 4TQHA 4Y19A 3KLHC 1CK0L 3CHQA 4G6MH 3FC8A 4Y7OC 3FH7A 1ZANH 2BNRD 4ZUWB 2BVTA 1BUUA 3II1A 3UTTB 3CFKB 4PJXF 3WY2A 3H8NA 4ZDHB 3N85L 5J7CC 3FFCD 5HJBA 4AQ1B 1BMWA 4HX1B 1NCCH 1R5IB 4CN4A 3VFTB 5FW8A 4FFVC 1YO4A 4FQXA 2FQGA 4APQC 5H4ZA 3NJJA 4Z77A 4AGLA 2APSA 4F33A 5C9JB 4J5VA 5HD8D 4F92B 4XCNB 5IFJB 4JQIL 3AMKA 3SQBB 3NTCL 1YUHA 5L2KD 3WD5H 2H2PC 1IEBB 2IH3B 2HRGA 2WB1A 2DM7A 3CFBA 3F84A 3Q44A 5FO8A 2XTJD 5BCAA 2UXGA 5JIKA 4XNMB 2CDEB 5HHMD 5KWYC 1D7FA 5KVGH 4L4VD 4WV1A 3WKNA 4M8QB 2XZAH 3TYFB 5KZCD 1T3FB 3I50L 3BHBA 5I2IA 2FRGP 4Z7NB 4M61B 5IHZB 3EO9H 2PPCA 3GXIA 3JWDL 1TFPA 5J6SA 4IK7A 1DVFA 4W6XB 3A6OA 1RLWA 4QD2E 5HHOA 1FNLA 1QPKA 3QVAA 4JN2B 4HGMA 4AUYA 4LHUB 3P5HA 4AZ8A 2ED9A 2C4FU 1YSOA 3DYMA 2VL4A 1WC7A 5MI0C 3BLKA 4GW1B 3KL3A 4J6IA 1E4JA 4X6DB 2NX5B 5IKCA 2V2XA 3OKOA 5CAYB 5D71L 4LLYA 4DH2A 4Q6IC 1KYDA 2CGRL 1TJHH 2YJQA 3MLZL 5D96C 5H94A 4WJKB 1HX0A 3RJDA 1G1YA 4YHOH 1UB5A 4LLQA 1V05A 5JHLL 5IQ7L 4U1JA 4WFHD 2CMRL 3I9GH 5KSVA 2ATPA 3E2HB 2FIKB 1AG6A 1Y6KR 3M8OL 4RGND 5CCKH 1LO5B 1KLGB 5J1AB 1CICC 3D06A 5GSVA 4GSDL 5D5MB 5EC1B 1OANA 2PUQT 4KMTH 4X0NA 3UOAB 1UD8A 4BH8A 5DFAA 4E9VA 1ECZA 1HYRA 4ZD3H 1PY4A 3IS0X 4XRCB 1E3XA 25C8L 5BRQA 4FTDA 4OV6F 1RIVL 5M95B 4DVBA 1RDN1 1HOCB 3PARA 5JQIB 3CSYB 1L9OA 4LF3B 3WNLA 2FJFB 4XPFH 5LJYH 4PJGF 5C0RL 5E6IA 4G6JL 4IBQA 1I4FA 2NNAA 5JIDA 5BS0D 3N5AA 4NUJB 3QEQA 4PJ9D 1ZVYA 2V2TB 1XMEB 3UPCA 2CXKA 2G3ZA 2Q3XA 3VXUA 4LLMB 1DE4A 2OJZL 1MF2H 1JWMB 1MFCL 2GJPA 4M6ML 8FABB 4ZPTB 3TN0A 3U48A 4PG2A 1KJ2L 5MP6L 4FDWA 4B9FA 4GINA 2XRAH 4XPTL 3DXAB 2C8NA 5C0GA 2HJLA 3X13A 3L7FA 3VE0A 3LSOB 2CO3A 4OAWB 1WBZA 3IPBA 3KPRA 1HCVA 1P7KB 5D1ZD 4HGWB 4GMSL 3DX2A 5BZXA 1H5BB 3I75A 4GP5B 4AV0A 4A6YL 2GABA 1MHEB 2P4AB 1MLCB 5IVOA 5B4MC 3MRRA 1IAII 2AJUH 4F9PA 5GJTH 3VX0A 2C4FT 2V3EA 3ESUF 2YRLA 5I9QB 2WLJA 4CMHC 3MNVB 3JWOL 4PY7A 3F04A 3AG2B 3K8MA 2OSLB 1TG8A 4JFHE 1PY9A 4BZ2H 1I3GH 3WTXA 2CJUH 1CDUA 3MJ7B 3MPCA 2EUZA 3FS9A 3O6FA 1U8JB 2G5BA 2GAZA 5FW6A 4LCWB 5K9OA 1P5UC 2H4EA 3S4SG 3H3PL 4BWTA 2NNCA 2N59A 4HW6A 4NQCA 4LPYA 2FSEA 3NFPB 3MRKA 3BAJA 4MWFB 5IJKC 4FHBD 5CJQH 2QHLA 1DUZA 3H0TA 2OX5B 4Y9BA 1QI4A 4WHYH 4YSRA 4WREA 1C9SA 1PU0A 2DWSA 2V37A 2LGNA 4M03A 1X9QA 2IF7A 1UWXH 3UZQA 5B38B 4OLVL 2B2XH 4E68A 3FCBA 3CDGF 5CN1A 3STBA 5C7XH 1NFKA 3GHEL 4YHIB 2DIJA 4GRWF 3LY6A 4PTTA 3KWWB 4IMKC 3NCXA 1PDKB 2XJKA 3CZFA 2XA3A 2DMKA 3UROR 1R9FA 1XF4B 3FB6A 3UP6A 1A8ZA 5I1EH 1G0DA 2NY4C 1MVFA 4AEIL 3QUZD 2QL1A 1WWWX 4ZQTA 5AVSB 1E4XI 1D9KB 1P6AB 5FA3B 5GJSL 1B0RA 3FONA 4EZKA 4OLXH 2HX9A 4TNEA 4WKZB 2AK4B 3V6ZB 3SBRA 3A47A 3D05A 2CLVB 4AQ1C 2Y2WA 3D51A 3BRGC 3VQ2C 4TVPH 1DBML 1CLZL 1KENH 3QZWG 2XV6B 1B4JH 3ELAT 3QORA 1KCGA 1EGGA 1UWEH 4JM4L 4Y16A 5JDJA 5F3BB 3CVDA 3FB7B 2J88H 4XNDA 1Q0XL 5HI5D 3M88A 4TULL 1SJHB 4TQEH 1UXLA 4FP8L 1UOSA 1AC6A 3UC0H 4J2XA 5ICXB 5LGHL 3HG3A 4DK5A 1I8MA 4GBXD 5H2BA 4FLQA 4AQAA 1BBJA 3VI4A 2VDRL 3NH7H 4Y4KB 5B1RA 3II2A 4H88L 2F74B 1CU4H 1DJZA 2AQNA 3MNZA 1RIUL 4LOUC 3BQUA 4MJIE 3CQQA 3NT0A 5DQDL 4XBGB 4M7KH 4AJYV 2V3DA 4HOXA 1M6OA 1T5KA 1JK9A 5C0JA 1N0LA 4TLKA 3ULVF 2YZ8A 5I1IL 2MHAA 1NAKL 1J8HB 4YLIA 4CVZA 3QPXL 5IEHA 4N8VB 2AKRA 4Y4HA 2COVD 3TO4D 2BRSA 1I7TA 3MOAL 3LH2L 2A6KA 1S3KH 1NPNA 2EH7L 3G5WA 3QR2A 3VJ6B 1XB6A 4JFDE 2GVYA 3BUQA 3KPPB 4FNRA 1RJLA 1CBJA 1FIHA 3ROOA 1DQQA 1T0MA 4ODWB 4ZPVA 1N8OE 3MCLL 2R2HA 3WIHA 4KY1H 2X2IA 4FADA 5K9JL 2VDPH 2E8ZA 3G6AA 5AG9A 4APXB 3P2DA 5FUZH 3TIDA 1SJXA 3VFUA 3SDCA 1TCMA 1G6RH 4PGCA 5EIQA 5GRJL 4PB0H 5ANHA 3FN0L 4IRJC 1YCSA 1B6DA 4LLUB 1XTMA 1I8UA 1KB3A 2BDNL 5E70A 1T1YA 2OMUA 3CSBA 2FLMA 4ZTPH 5TQ0L 5AENA 5EU5A 4WI8A 4GAYA 2WXNA 4N90E 2H5UA 1ZVNA 3BVDB 5E94B 3TBWB 3ZE2B 3FT1A 3FB8B 5E4EC 1GYAA 4XMKL 2VSCA 3ZDWA 4OLZH 1XF5B 2Y7MA 4GAJL 4YHZH 2R0WL 2W95A 2NZIA 4B0MM 5A3IC 4MXQC 2DBJA 1I3RB 1INEL 1SF3A 1L9QA 3S37H 1YNTA 5L9DH 4JFHD 3FUHA 3FNKA 1VFAA 3W39A 1YVLA 5BOJA 4NKMB 2NUTB 5KYXA 3NP4A 1G7MA 4PGJA 3ZIYA 1PAZA 4CSZA 4YIQA 12E8H 3CN4A 4MKTA 3X3FH 4HALA 3KNBA 4X7TA 5FCSH 4W6YB 2HRLA 4PQXA 3TBYB 5I5RA 5AKTA 2EDHA 3L48A 4LPXA 4YMDA 1OAYH 5IUSA 3DX6B 4KRNA 1YEDB 1TYJA 1UXWB 4FXKA 1P2CA 2CD0A 3AACA 2OMXA 2QADD 4HIQA 4FG4A 4ZFGH 1XCTA 4L0ZA 5SWSA 3PWJB 2O5ZL 3MBXL 4O02H 4DK6A 1XEUA 4JG9A 5C0IB 1G9MC 4H8WL 1HS6A 1JGUH 4BWUA 3CFEB 2OMWB 3MRBB 4GIPD 2MFNA 4IEFA 1AO7A 3B43A 5DD3H 2ZX8A 3WMSA 1Y0LB 4GW5B 4HHAA 1HINL 5D9SA 4HBCL 1KELL 2CDFB 4D7BA 3NFNB 5I9QC 1BFTA 1I31A 5INCB 3PGFL 1LO3L 1FA4A 3RGVA 5D1XE 2ZG1A 3B2VH 3WNKA 1BFSA 1K4CA 1XR9B 4YXKL 4WWKB 2BVOB 1OTSC 4MAYA 4ZAKA 1ZTMA 3MRIA 3IMBA 1KX1A 3UAFA 2Q87A 2N1KA 4GUQA 3KJ4C 1HH9A 1RQ5A 5ENWB 3VGDA 3RVWC 3IPEA 4YN3A 3QQ3B 1BVLB 5LBSH 4AGMA 2LU5A 4FTVE 5KBKA 2IXQB 1ETJA 3MJ8A 4FG0A 2V2WA 2A1WL 4DPRA 3QQNA 2ICWB 3PWUB 2OK0H 4XPAL 3T1WA 1J8SA 4O4YL 3UACA 5DS8A 2UZYA 3SPHA 5L8LB 3RY5A 5DVPA 35C8H 2YGVA 3OG6B 5EZOL 4A7GF 5I1JH 3Q0HA 4UNTA 2V9RA 4BFIB 4L9DA 3ZO9A 4QTIH 2UZIL 1IIIA 1TLMA 4G7VH 5SX4H 2R23B 4QXUH 1JK8B 1L9TA 3HZVB 4P2OA 1P7BA 4KJPC 1DN2A 4PS7A 3GRWL 2OR9L 2GTWA 3LEVH 2PWGA 1TLKA 3IKCB 2A4ZA 1BEYL 2JKRM 2F0CA 5FLVA 4DKFL 1OV8A 3KPLB 4MJID 3RVUD 4NQEA 4NO2A 3CFDA 3L3OA 2XNAB 3NDYE 1TTRA 1ZLVK 1FV1B 4FFYA 1U30A 4R5VA 5AYTA 4PLKC 1MCRA 2X4UB 4O2FB 2RACA 4YHKL 5TH2A 5F7UA 1BFOB 3BPOB 3MRFA 1Z0NA 3H1ZA 2IGFL 2QGCA 4KY2A 4UYPA 3BOVA 2ADYA 2VUZA 2DYPA 4P3DA 4Y9FA 4HUNB 4HPOH 4MCYA 3ARDC 3IMRA 5KVEE 5IG7B 1NLBL 1KYFA 2XWJB 3MX0B 3V6FA 4JFDD 4MJHA 3DVGB 3GB7B 1MH5A 1QYGL 4K23H 4WFGE 4XT1C 1M7UA 3UERA 1DJSA 2VLKE 3O3AA 4R8WL 5F6IB 1Y1DA 2VDLH 1YNTF 3GIVB 1E5YA 4OIIH 1OT2A 4KTEH 2Q2LA 5A2IH 4OSUH 1PCXA 2GKIA 3CXHK 3MBEC 3WJLC 4NZUH 2IH1B 1DQJA 1F4AA 5ITFA 3QPQD 4P9HC 4AEFA 1GKOA 4HS8L 2XN9A 3D39B 4QRAA 1IAIH 1WISA 4OZHF 2IFFL 4NO3B 3ZPDA 4Y4KC 1NDGA 4QRUA 4QNPF 1GGTA 1ACXA 3WGVB 5DD5H 3N1MC 1RZ8B 4N90D 3X11A 1K6QH 4ZW6A 2WTOA 3ARRA 1A7QH 2CK0L 5L8JB 1T22B 1QNZH 2WO4A 5ICZB 2WANA 3QO0B 4YMPA 1M7IB 4WEBH 3WNNA 1KIRA 1NMCB 5HJDA 3AM8A 1UM6L 2X4TA 4ZUUB 5LG6A 3BUYB 2H1PH 3ILQD 1CDJA 1DQTA 4WI0B 5E9NA 5F7AA 2DF3A 4JKMA 4DGIH 1PYWA 1W0YT 3VYPA 3IU4H 2IBGA 3MLPA 1KPRB 4ZFZB 1EEYB 3ZMRA 2YPVL 1IL1B 2Z31D 1TTAA 1ZT1A 3EDEA 1RZIA 4YFDB 3W11D 1OM3L 3PDOA 4UTAH 2HX8A 5HDWA 4NEHB 3VD4A 3F6JA 5KSAD 3WH3A 3H56A 2CUMA 3NFSL 1KJMB 4P23C 5KYUB 4S1DC 1XX9C 4M8RA 2IBZX 4UV7L 1C08A 5LAXB 5TJWK 3IGFA 1NCIA 3L3KA 4NO0B 1T8DA 2IV8A 2X2YA 4OTXH 3BZDA 2VYRE 2OX9A 2FECL 2QQKH 1LWRA 4XVUC 4ONFH 3VQMA 2M26A 3CZNA 2Y3NA 3VWKA 3G6JA 4UTBA 5HSFA 1E4XH 2Q20A 5AVUB 5G2NA 2VZVA 3A23A 1YY8B 1MSPA 4KO5A 3RFZA 1KZD1 3RBGA 3SHSA 1MCOH 2EIBA 3DJRA 5D1XD 1PZSA 2AABL 3GNMH 1JHKL 4HJTA 1GZQA 2BWIA 2OXHA 3O3DB 2QPFA 1JIBA 1S5HA 2ZUWA 4MNGB 1A6PA 2E8YA 3OAYH 1OW0C 1C3AB 4L5FE 1MJUH 4DIXA 3HN5A 4JG0L 4HMEA 4FTVD 5JYLA 2NPLX 4JO3L 3FMGH 1NJ9A 2NXZB 1QATA 2WHVA 3MRNA 4Q2ZB 3AWEA 1M2OA 3MO1A 2VGLM 1FVDB 3HI1A 2C9SA 1CN4A 3QDME 4J6MA 5IB4B 3QDAA 4JO4H 1QHQA 2C9PA 3VXSE 1RU9L 1TTFA 4BQ8A 4DKEH 2D7NA 1Z9SB 3PP3H 4P4RB 3HS0B 4OGXL 5I30H 2WXFA 2QDWA 5LBGA 1QI3A 4LQ1A 4PRNA 3ZT7A 3ZYOA 3N1PC 5GGSA 4BGDA 2QVFB 2CCLA 2YQ2A 3ZYIA 1AR2A 3IT8D 3JWNE 3CX5K 3T4YB 2H0EA 3RS1A 4F8NA 2KKQA 3H85A 4DN8A 4KJYA 3V52L 3LRKA 3QC5X 1LP9F 4WWKC 3FCTB 2WAQA 4L8BB 4ZMYA 5JMRA 4UZGA 2BPEA 1BREA 1XDTT 1Z9OA 3NDZE 1UCBL 3Q8AA 3MV7A 4QWWC 4XPBL 3QH3B 1TEYA 4TUOB 1QEWA 2IWEA 4AC2A 4QF1B 2O5YL 2I7SA 3EBGA 5DZJA 4D0CB 1FH5H 1E28A 2LR4A 3VDBA 3ZTJG 4NJ9L 4GO8A 3IDMB 1A7NL 5KVDH 4WFGD 2UYLA 1R3JB 4KXAA 4L18A 3BISA 3LEYL 3A4DA 2VLKD 2CLRB 4V2CB 5CO1A 3EJTA 4JY6B 1I7RB 3KPOA 4IHOA 3N44B 1G7LB 1T6WA 1IGYA 2QTEA 4DKAA 4XAWL 1U92B 1YJDL 1KZC1 4WCYL 3ARGD 3POCA 1NCWH 2DPKA 1PD1A 2JB6A 2VLRE 4LCIL 1YA5A 3GI9L 4MGXA 4MD4B 3OGOE 2OS9A 5FKPA 1OD9A 4L8DA 2DWEA 3RU8H 4P4KB 3PL6B 2OI9B 3HUJE 4C4KT 5C07B 3P2BA 2WLHA 2F5AH 2X2UA 2XZCH 2JF1A 4PJEA 2G9HB 1KB9J 2X3AA 4HS3A 4R2GD 1M71A 1MAJA 3SDXA 3ARTA 4Z7QE 3BPOC 2BPDA 4NLAA 1E8WA 5ICYA 1V7ML 1UYWH 3SGKA 3P73B 4KBPA 3DX7B 1DDHA 1CXEA 2L4OA 4ODXB 4F24A 4KZVA 4KC3B 1ET7A 4LSRL 3U36B 1WAAF 2V17L 2DLEA 3GSNA 4FFZH 2QR0A 4OGQC 4JRFA 4H1LG 2XZQH 4GRWH 2DV6A 4F80A 3BN9D 3ZK0A 1UHVA 4ZXBA 2TAAA 4W9JC 3ILDA 4RMSA 3RJQB 3JV4B 4MA8H 5F6IC 4U3CA 2X88A 4KI1A 3DSFL 3KG5A 4KROC 4EOWL 3UJIL 4YNYB 3KR3L 3AXHA 3GMLB 4P46C 1UKMB 1NGQH 5GGSY 1HTYA 1ZT7B 4L0PB 4G96A 1MKFA 1YRKA 1CDCA 2GSMB 2E3VA 3HMWL 4JDVB 3B83A 3O81A 4E2OA 3RHWF 2NTFB 2Z7UA 2WIIA 4B9ZA 2J1YA 1NFAA 1KXVA 2R4SL 3IETB 4I18B 3ZDZF 2FEDC 2CHDA 1J11A 3VFPA 3ZJAA 3VYNA 1D3CA 3SDYL 4U1HB 5KVEL 3MFFB 4N8PA 4P9ML 5CD5D 3JBG7 5C0CE 4QGTA 2J1XA 1M2VA 2R29H 1W6WA 5K69A 2WB7A 1NMCC 3BXNA 3QCUH 4WU5B 2H6PA 1KJVA 2VLJE 1WAPA 2GYSA 4TS6A 4GIAA 5JW5A 3L1GA 4AJWA 1H0DB 1QRNE 4HCFA 2V5MA 4PJCB 4FLHA 1I75A 4HC1A 2XA8H 1UM5L 2HX7A 3CHPA 3FU0A 1PIGA 3EGDA 3T2NL 3K5RA 4OD3H 1JF1B 4RISL 3FQ1A 4F7EB 5HYSA 3ULVH 2E7LA 1T5WA 1B0GA 3LN5B 2V0AA 3AGVA 3MRDA 3ZKXB 4M62H 2A9BA 4PJIA 1NBZA 2W8CA 3DHJA 2ESVB 3BSZA 3E6FA 1A22B 1RJZA 2QPDB 3QDMD 2WYHA 2B59A 3VXSD 4RAHA 3OKKB 4N6RB 4NENB 2OMTB 3NCJL 4NUPA 2BOCB 4AH2A 4XCYB 1FGVH 1RHHB 1MJ8L 4AQZA 1NFDF 2QSVA 2HT2D 3KE0A 4UIKL 1IFHH 3T0EE 3PHQA 4ELDA 2ILLA 4WI6A 4Z23A 3BYTA 1DY2A 2K3TA 3QIBB 5FM5M 1MWAL 3WTVA 2HFFB 1HSBA 4TQIA 3D12B 1U3HA 3RPKA 5JPNB 1UZ8B 3FO1A 3QUGA 5D6DC 4Z7IA 4WUWA 4H0IA 4HCRL 2FR4A 4S1SH 5TDOA 4E42B 2HFTA 3CE1A 4X4KA 4PRHB 4Q89A 4G6KH 4MB5A 3OL2A 2PYEE 2B1AL 3OHXA 4HKXB 4LLAA 4OCWH 4U1SB 1A4BA 5BUPA 3D85D 2IPUG 3QIUA 2WO2B 1CGWA 2YRBA 3S5YA 2J7LA 2VKXA 5EMYA 1B6EA 2KLTA 4JDTH 4M6NH 1KYAA 1LILA 4KVCL 4DO6A 3LNIA 4YDKL 3GSQA 1RK1B 3MV8B 2NXZC 4GFTB 4NZRH 3PIQA 4BFFA 4BH7A 4I3RH 1GMEA 3N6YA 2C1PA 4UILL 4QRSB 1HCZA 1YEIH 1AZBA 3BVXA 3RPBA 1F6FB 5HYQA 1BMZA 2AW2A 1FIGL 4ZMVA 7CGTA 5ITBH 5AAWA 1P1ZD 3CPLA 3HKFA 3QNYA 4V1DA 3LN4A 2VMDA 2OTUA 1HESA 3LZOA 5JORA 1SYSB 1GSKA 1F5WA 2VLRD 4WI9A 1EFXD 2H2RA 4EN3B 3FSOA 3V4UL 3HE6A 4JDZA 4UOW0 5FHAH 3HNVH 3REWA 3EOTH 4ELMB 1IJNA 5I18H 5GS3A 1PG7L 1K8DA 2OP4L 4OD1L 5IHUL 5EZLB 2DQUL 3W0WA 3V6OA 1BZ8A 5C2UB 4N2IA 4F5CE 3BMVA 3JTSA 2NXYC 5IQOA 2HLFC 3FT2A 3ILPB 3LXBA 4PRIA 4WWOA 4K9EC 3QS2A 1FLRH 5KVMC 2Y1VA 3RWCB 5BZDA 3TESA 1U8OA 1ZLVH 1DN0A 4HK0B 2C7UA 5D4JA 3MOBL 1IQDA 4NWTL 4G8GB 3B2DC 1U3NA 1X5XA 2DQGL 4DEPB 1NUGA 2WBJC 5I1KL 3PY9A 1YEKL 2JKJA 3HE7A 1KF9B 2FX9H 3ECUA 5E8OA 1FG2A 4XNZB 2J8OA 3P4MA 5DJZB 5KAQF 1WHOA 3FQUA 4NGHL 4PGBA 3RA7L 4AV4A 1PG7W 3TVMA 1ET5A 3A4EA 3PQYE 2WXMA 1GGYA 2Y22A 2GC4C 4ZUSB 3PGDB 4AYFB 2H8PA 2BNRA 2BS9A 2YKLL 2OI9C 4P5KA 4EJ1C 2GEEA 1WWCA 2B4CH 1NGWB 3FU9A 5JW3H 3FT3A 4OZIE 4LSPH 3OQRA 1Z3GH 4L3EE 2VDPB 3FFCA 3LTVA 5JUEL 2EVJA 4J6LA 3WJMA 1J05B 2HG5A 2P5EB 2IANB 1FP5A 1MREL 1USQA 3NEOA 2L7JA 5C0CD 2IH8A 1G6RB 4YZFF 3LPFA 4YDJA 1I1AD 3IDNB 4AGPA 4I0PD 3VRIA 2VLJD 2EXWD 2WNXA 4N2LA 3WIHH 3W1ZA 1ZY9A 1QRND 2GTZA 4F2MB 3B7SA 1FC1A 1TYRA 5J3HD 4B97A 3AROA 2P24B 4MJ4A 4JFXA 3DC0A 2D4DA 4JE4B 2QZ5A 3BPNB 4UDUA 3RGHA 4ECNA 1D5IL 1ITBB 2IBBA 2B1HL 5AW0B 4N33A 1SOSA 3RG1C 5FM4A 3H55A 4L4VA 3C22A 5B7FA 1WZKA 5ES4B 4PWKA 4RX4D 4L0YA 3B56A 3MUY1 1FLTX 2ZE0A 3IXTA 1DV8A 1R24B 4PJAF 1CYWA 1IC4L 4YUEL 5DWPA 4E9LA 1ESLA 1RCYA 2IO5A 3KLHD 2CBOA 4JRWA 5DHEA 4GB9A 1U8KA 3T0ED 2NY2B 3QQ4B 1ZHKA 4JUTA 4JY4B 2YAQA 3CHSA 4I18C 4U6YA 4DZBB 4KJWD 4TNWK 3UDWA 3JVGA 3C5XA 3IKRA 3I2CL 4RAUA 5F3HA 1F90H 1ODAA 4X8XA 1DBJH 4PJHA 2J21A 4LCCB 4TUKL 2XWBB 4TTGA 2V9QA 4N20A 3OX8B 3L5WA 4UT9L 1HHKA 4O02B 1X6NA 2AERT 2PYED 2ZKHH 3U46B 3QI9D 4X6BB 3FU7B 4XP4L 3B2PA 1SJEB 1IC5L 1BZ7A 4HGKC 5HGHA 3TA4D 4N34A 5CLTA 1A3LL 5HYJB 4MJ2A 4JY5H 4Z95L 2D73A 5IW6A 2XFXA 5E5UB 2GK0A 4HPYH 3ZTJH 3D30A 3D52A 4X9GA 1XGQB 1EMTL 4M7LL 3W5NA 4HJEA 1YPZB 3O0RH 2WNWA 1RPUA 5G55A 7FABL 4N2BA 5FIEA 3V4PL 1S78D 4MA7H 5DEFA 2OSXA 1T80A 4WUXA 1KY6A 2VXVH 3VRLF 3GSXB 1KG0A 4YHNA 2GB2A 1EBPA 2AJXH 5IM7B 1DVTA 1V7NH 2EDKA 3QIBC 2NW3A 1BYFA 2IQAA 5KAQG 1Y6MR 2BHUA 5JPNC 3U6RA 1HUPA 1AGDA 4KXBA 2V4LA 2VDOH 2Y69B 4U1NA 4WJ5B 4PJ9A 4WW2C 4X0KB 4KH2A 4R3SA 3Q06A 5D7LA 4LU5L 5K1NA 4CVWA 1AHKA 4FXGB 5EUOB 3VUAA 4HKJA 4JFSA 2DKSA 4WK2B 1UEXA 2R1XB 2YQBA 1XHHA 3OR6B 1BOGB 4ZO6A 3FHQA 3THMH 3P02A 2A9NH 4OKVA 3DHPA 3C8KD 5EWIL 5C86A 1Y7VA 1QFHA 5F9JA 3ZDYE 3ZGIA 3C5ZA 4KXZH 5L2JB 2HKHL 4FKKA 5A6IA 3BPLB 3MLSL 3VXPB 4ZUVB 2Y1YA 3C5SB 2CPUA 2BY3A 1UACL 3EZ8A 5D1ZA 2ED6A 1O6TA 4H1LH 1G7PB 1UENA 4YBQC 2FE0A 1EERB 4G5ZL 1JSYA 4AEHL 3I9IA 1I53A 1TDQA 5B39A 4LAQL 1XGPA 3ARBD 5DHVA 4YDIL 1X7TA 2KS0A 4G6FD 3RUGB 1UB6A 4YFLF 3ESOA 3L4WA 4G8AC 4Z76B 2WY3B 2ARWA 1KBBA 4BUHA 1YEFL 4JGUA 1KPVB 3D4GA 1DBKL 2PETA 5K39B 4FFYH 2UV3A 3IE9A 3PQYD 3UTZA 3OXRB 3ZT6A 2M94A 1LLAA 4BFKA 3UZEC 2A6IA 2Y36H 3APFA 3DGGA 4IIQB 3KM1A 2VDLB 5ADPH 3ZXAC 4DJMA 4FI8A 4MMYA 3OTTA 3SJVB 2BXYA 4KTDH 1JD7A 4HJGB 4L3ED 2VRKA 3T4AB 4YAQA 2LS8A 1C1EH 5EPMA 4FYSA 4Y5YA 2BFVL 2V7NB 1OQXA 1E2ZA 4QHPA 4PJXB 1U4EA 3V5DA 1VGKA 3ZDXE 4ABQA 4HAGA 4EAEA 5CD3B 1AGFA 1VAHA 2VR9A 1QBMH 3OR7B 3L9EA 2RFXB 4MQXC 1Q72H 4GQZA 5LGJA 3HVNA 2GY7B 3KLKA 1X5AA 2WBXA 3IE4A 1OO2A 3BVUA 1OT4A 5DFWH 4DEPC 3W2DL 4EXKA 4OCYL 1E3ZA 4YHYC 2EDTA 5DEGA 2VM9A 2YN3A 3ARFD 4XNZC 2EEBA 3WHXB 2FT8A 2DWYA 4KRPB 5D7HA 1IGJB 5CZVH 1FVUA 2ZWZA 3E9TA 4UINL 2ZQKA 3KH4A 3WOVA 3FBQA 3K4DA 3KYKL 3QUZA 5DT1H 4QCIB 3EUUA 1B2WL 5A2KH 1NL0L 4XN5A 1WK1A 1JPTH 2FO4B 1AYOA 3S4SB 3BKJH 2BC4A 4ZMZA 2M83A 3K4ZA 1OAZH 4P49A 1MCWW 4HCIA 5DZLA 1KEML 4LEOB 3DNKA 3MLXH 2CDGB 2AQSA 3TV8A 1ZIBA 5IIEB 1U8QB 5EIVA 4ZOEA 4KGLA 1DVSA 3GMPA 5B3JE 1H3TA 1MFDL 4IBWA 1DEEB 1T1ZA 2KYIA 4YPGA 1NBQA 2XYBA 5ESQA 1ZVSA 1G43A 1O75A 4GBXA 2WO3B 5KS9B 3HC4H 3TBSA 1I1YB 1MCNA 2JJTA 3FHEA 2XWXA 4WWPA 5D1QC 1BJ8A 4MTHA 5EC2A 2XIBA 5AW9B 1QG3A 4KHTL 2C9QA 1S9XA 2PPFA 4KPHL 3OPZH 5F9DC 2CKBL 4I3SH 1TJIH 1UZ6E 4JJHA 2H32A 1R1CA 4UT7L 1T8CA 3V8CA 3WFDH 2EIDA 3QA3B 1KDIA 1HHHB 1PLAA 4X5XA 4CC4C 4IS6A 5DK0A 2NT0A 1IARB 5E95B 1A7BA 1F4WH 5E00B 3TO4A 1MQKL 2YMXL 4ZFOL 4CNIB 1YMMB 2DQFA 3MNDA 5FGCB 4E9XA 3VGGA 2J72A 3DMMB 1R5WB 5KTEL 2SEBA 4EUPG 3EFDH 4MBRA 1FPTL 3S48A 1S9YB 5ESVB 3ZKND 2CRYA 3WENA 1W8NA 1BLNA 4ZOAA 5F71A 4PJGB 3DI3B 5GS1A 4M6OL 1EGIA 3H9YA 4N2CA 2B15A 3O2DA 1U0NB 3HC0B 2HLAB 2MIZA 5EU3B 5ALBL 1HHIB 5DRZB 5GRZA 1KZE1 4R90L 3QJZA 3MQIA 1NCAL 5FGBC 4JZJA 1DQLH 5C8JA 5I1CL 2XIIA 3ZR5A 4LOUD 1UJ3B 4ZMLA 3RY4A 3MACH 4JM2D 1F2QA 1KWYA 1TU2A 3GJFH 2FJHB 1EEZB 5E08H 3OAZK 1BVZA 2LOEA 3A24A 3A22A 3NZSA 3KGSA 4LVHB 2IJ0C 4XN9A 3FTGB 3EYOB 2AVGA 4UM9A 2YBRB 4AVKA 3AU1B 3SD5A 2NDGA 3KPQB 2BW5A 2C9AA 3BPCA 3HC3H 3BKCL 4KZ0A 4X9BA 1DSFH 5ICUA 1XD0A 1FYTB 3TBBA 4DP1X 5KG9B 1BIIA 2HAZA 2ZP0T 4HJJL 5KBMA 2NZ9C 3SGEI 3L8QA 1FL6A 2RB8A 3Q5OA 1UA6L 1OE1A 3VG9C 4NYLA 4TNVF 1J1OL 4PWHA 4QR7A 2XHNA 1GW0A 1MIML 2HJFA 3BUIA 5FYJH 5HPMA 2LAGB 2BZ7A 1VFMA 2GSGB 5LQBL 4AUUA 2YLKA 5CLYA 2W92A 1HNYA 1NCHA 4AQEA 4N8CH 5FOBA 2RIKA 2DTSA 3KPTA 1PL3A 4O58H 4X4XA 5T1MA 1IGFL 1JYXA 1GVIA 1R3HA 2M2DA 3Q6FB 3SYCA 1BV8A 3MSPA 2WLMA 1QO3B 1WCBA 2JI2A 4A2FA 5HVGB 4UQIM 2R0KL 4AY0A 5DEJA 1CQKA 1GHFL 4JZNB 2J4WL 3HLKA 4HJ0C 1H3GA 1A4CA 4N28A 5DVMA 3QG6B 3TO2A 4KDTC 4A66A 5A3ID 4MXQD 1EGJL 2OYPA 4A04A 3VCLA 5IBTL 3CDGB 4PJ7F 3E8UL 3LKQB 5F7DA 2JQAA 3OKOB 1ORQA 3VXRE 1BOYA 2EYSA 4GRWB 1VFBA 4EF3A 3PHOB 3O9WA 1QWUA 2IDTA 2VXTL 3D5OF 2VAAB 3CJJA 4FABH 1UGKA 3HRPA 3P3TA 4Y1AA 1ZIAA 2A77L 2PWEA 3D9AH 5CCJA 4Z0XB 5KBPA 2G60H 2DQMA 1TN3A 3DLQR 2ZWYA 4HWZB 4FA7B 2X6BA 2BVPA 2OZ4A 2VMCA 2ZX7A 3CU1A 2Z64C 1VADA 4MXVF 4YO0A 3T4AC 3E7JA 5CHNA 3T65A 4BFOA 1N18A 4B6ZA 1JJUA 1YEEL 2YD4A 2Z4QA 2F61A 2BJMH 5GGQH 3QG7L 2NSXA 4GQ9L 4GLRI 3QPKA 1IGTA 4JHAL 3ZN6A 3BP6B 2CUIA 5EBLA 2YHFA 5CLWA 3QUYC 1P5VA 3TCTA 3P1VA 3RDTD 4N9GA 3UYPB 5BO1L 4NHCH 4KNSA 1A7OL 1IBGL 1DQKA 4YDNA 2K78A 4HJIA 2R0ZH 4JUSA 1A6WL 4Z0BH 4ACTA 5D1ZI 2W07A 1H15B 2VZSA 4WRCA 1M1XA 5CBEA 2H3NB 4KO9A 4MJIA 5KSUB 2Z8SA 43CAA 1BJMA 4F58L 3QDGB 4QDGA 2HH0H 3WNMA 3VAEA 3VXUB 3L1OH 1DE4B 1SVZA 4QTHB 2NLJA 2UWEE 5DK2B 5EN3A 3TF7C 1OTSD 4HKBB 3FCSA 2P80D 5E8EB 3VFRA 1MPAL 3DGDA 5MENE 3WLWC 4I2XA 4JPKH 2NQDA 5EBGA 4BQ9A 4HFWA 4Z3TA 1T03H 5EEZA 1BPVA 1QR1A 4JFPB 5D70L 3HI6H 3CU7A 3TBTA 5C0GB 4O5LH 2ZP9A 4W9HC 1WBZB 5AEAA 4OFYD 4JFDA 3KPRB 3MLUH 3N40F 2ARJA 4RNRA 4DTGL 2MQGA 3VXQA 1HIML 4UM8A 3V7MA 2CA4A 3GIZL 2EQDA 2FNWA 3LIZA 2OMYA 3B9DA 3BVWA 4OLWH 1N59A 2ZONA 1CF8H 3CNKA 5B1AB 5GZOD 2PCXA 4KJPD 4CADA 3CV5A 4WO4B 3BEWB 3QRGH 3NEXA 4ZS7L 4BK5A 4QKJA 3MZTA 1HXYA 2X4OA 3IPFA 3VTTA 1ETA1 2XKNA 2D3VA 3MLWH 2DN7A 3PHAA 5GISH 4ANXA 3LYRA 1TZIB 1AIFA 3BDWA 4BXVA 3MV11 3QBTB 5BO0D 4Z5RA 4LARH 4XHJC 5IESL 4NQCB 4HG4K 2FSEB 1X5KA 2P48B 3GLDA 3MV9E 4N24A 4XMLL 5AW2B 4GI8A 3VGBA 4A2DA 5I73B 4PM1A 2UXTA 3CHRA 1WZMA 1MG3C 1LNUB 2BSSA 2W38A 4G7YL 4BUGA 2RIDA 1ERNA 2E86A 2EYTB 3H0TB 4OF5A 4WDIB 1IUZA 2Y7SA 2X9WA 4U6TA 3ARDD 1JZEA 3OGCA 3SGJA 3KGRA 1JCKA 4G42A 1CK0H 1HH6B 3BCDA 1MI5E 3TH2T 4ENED 1G9ML 3DMMC 3MRPB 1YYMH 4OQTL 5MEPA 1T6VN 3BIBX 3WN5A 4E9RA 2ADFL 3N85H 5I6OA 5CFHA 4MQ7A 1U0NC 1GH7A 4PIRF 3NCCB 1HDMB 1LO2L 4IDLA 1FJ1A 3VXMA 3G5VA 3MBED 4PTTB 1AS6A 1WT5A 3Q2WA 3LAFA 3CZFB 3OKDA 2VSMB 2R69L 3EFOB 5KVFE 5KSAA 5F97E 1U8CB 2CO6A 4AYMC 4J1UA 3WXWL 1BVKA 2RHEA 1NIBA 3CLEL 5F9WC 1CFSB 4JQIH 4U1KB 3DYPA 2HZHA 3NTCH 2XN0A 3JT0A 3FONB 3KPSE 1PD6A 2FBJH 3KXFA 1G84A 3L4CA 2VE6A 3ZL2A 1TCRB 3NIFE 4U3SA 4XGZB 1X7QA 3UG4A 2O61B 4OJEH 2M8XA 4M02A 4U33A 3TNMB 2VRQA 4RGMB 4P2QE 4FQXC 3LDBB 2BIOA 3SPCA 1DQMH 3P9LA 5DJYA 3VXRD 4ONOA 2W0PA 1ITCA 1KNOA 1OGAB 1F1GA 1BCIA 2Q76A 3Q1EA 4JO5A 3LKSA 5D7EA 4BFGA 2WUBL 1I8MB 4WLCA 3AFLA 4WGWB 1XIWD 1BBJB 2K7QA 4O00A 2ZUYA 4FTVA 3WN6A 3QQ9D 1AKJB 2BCMA 2GITA 4LLWA 1THAA 4PRAA 1WJ3A 4UNUA 1MVYA 1ILSA 1Z5HA 2FL5A 4WV1C 4JHWL 2C3VB 3N41F 2DOCA 3GBML 1JK9B 4BZYA 1RFDL 4LAJH 4PY8I 4S1DD 4XWGL 5D71H 2VN4A 1HJBC 3NZ8A 2N1TE 1ZD6A 3TEZA 1FFOB 3MLZH 5TF0A 4CVZB 3QFJB 1T0NA 2AKRB 3HPJA 4LE8A 1DVFC 2C9XA 5JHLH 5IQ7H 5AVTB 1DFBL 1OP5K 1OTUD 2CMRH 1OXYA 4UQ2B 3VH8G 2OW7A 2GT9B 3O2VL 4M1DL 4XVUD 3ULSB 5K9KA 1IFRA 1MCLA 4GSXA 5F0PB 3M8OH 2N7AA 3TYGL 4RRPG 5K33A 4X7EC 3FOMA 4ZPVB 4YJZL 1D5ZA 4GSDH 2R2HB 2VLLA 1A9BB 5JZ7C 1HHJB 1GGCL 2UY7B 1RKRA 3QZBA 4UMSA 3VD7A 1L9MA 4RMQA 1N3NA 1X9LA 25C8H 5MEND 1RIVH 4XMVA 1E90A 1FNEB 2JXMB 4PP2A 4P9HL 3QJSB 2FEJA 3UP1A 2J12B 5E03A 1T04A 5C0RH 2WSKA 4G6JH 2OMUB 4JN1L 1LWHA 2FUTA 3EJZD 3CZJA 4NUMA 2VLKA 3EBAA 4EUPH 2OJZH 1MFCH 4M6MH 1BF5A 1Z9NA 3L7EA 3MN8A 4IBSA 4NQDE 4U1IA 5IB1A 5BUAA 1WRFA 4JG5A 5MP6H 3OD3A 3ZHDA 2VQTA 2OSYA 4J3OC 4XPTH 4UDTA 1YNTB 2N56A 4FG6C 1U3YA 3W39B 5E6IC 3MCG1 3PE9A 2FTAA 1MHCA 1KZA1 2FO8A 4YIQB 3WNIA 1FGNL 2AEIT 4GMSH 4DUXA 4A6YH 3MV9D 4OZHB 1EJ8A 1DLHB 1O5PA 2Y7NA 4ODSL 4OR1A 1AJ7H 3TN0C 4EZMA 2AAVA 4QHNA 3F01A 4PG2C 4PHXA 3TASA 4FEIA 4QWWD 1A3RH 1THCA 3N1FC 3O3BB 4GSRA 3HI5L 3JWOH 3SGEH 3W9EA 4TM9A 2FJUB 1HI6A 5GHWL 3PXJA 4EIUA 1OB0A 1JXDA 1WGOA 1MI5D 1ZLSL 1YUKB 2ZX5A 2OKMA 4MB1A 4HMDA 4Z7WE 2Z35B 3VFGL 1CFNA 1MHHB 2YPKA 1FDLH 4R7NB 1K85A 4NC2B 4BSVA 4PYGA 2PCFA 4G1EA 3P69A 1A6AB 4HHAB 5CSGA 5D9SB 4B53A 2J5LB 4ZX5A 4F9PC 5D2NB 1OP3K 4HAKA 2J1ZA 4HUMB 3D4YA 4JL1A 3RGVB 4FL4C 3ZMEA 4G43B 2DEWX 3EF4A 5T1KB 4ZAKB 5C0BE 3VI3F 3D2UB 3O6FC 2VDOB 1OWRM 4X6EB 4MSWB 4PBDA 4P48A 1CD9B 5T1LD 4OLVH 3KPSD 3MR9B 4EI6A 3T8VA 1IC0A 3GHEH 3VXOA 1NUDA 5E9AA 4AQ8A 1K2DA 3JT2A 4JRYA 2OMVB 4I85A 3EFFA 1FZMA 1H3PH 4P2QD 1Z9PA 4NAQA 5DQJA 3OM3B 5DLLA 1ILUA 5EO1A 4KMQA 1F18A 2ZG2A 2P3YA 3BH8B 5CJ8A 2OYLA 5DDHB 3QCTL 4AEIH 4X5WA 1EBAA 3RIFF 4H1LB 1PKOA 3C5JB 5DRXA 2X0WA 5E1AA 1HNFA 5E4OA 4GS7B 3WSQL 5GJSH 5K59E 3LH9A 1SEBA 2J56A 4NUQA 4LKXB 2FBRA 1U8LA 2K1MA 3CXFA 3IYLW 3EG9A 5IV2A 4NO2B 1OP9A 3C6LD 2MNJB 1DBMH 4P46D 4AQAB 5IROD 1AZRA 1CLZH 3QDMA 1ECYA 5CWSA 2OM5A 3TGXA 5DZ9A 1YPUA 3VXSA 2E7HA 1XF2A 2YSSA 4JM4H 4GJTB 1XZ0A 4POZC 1CXHA 5DHVH 4HT1L 1Q0XH 4TULH 3WY1A 4FP8H 4R4BA 3GDBA 5DJ0A 4JANA 4CILA 5LGHH 2FEDD 1DL7L 3M86A 2VDRH 2WQSA 5I6MA 1W15A 3DV6B 4H88H 2ZXDA 3KYNB 4PV9A 5IB2A 1RIUH 2B14A 2X4PA 5DQDH 1AG0A 4LSDA 1ADQL 4M1GL 2APFA 2JKTM 3QORC 1RZJC 2KL6A 4Y16C 3QZNA 2EE9A 3DETC 1WUZA 1NAKH 2O5XL 3D85A 3UIYA 5B8CA 5CXPA 3QPXH 2FWSA 5KVFL 4F37K 2AV7A 3MOAH 3LH2H 1LP9B 1L9RA 4DVRH 1NDGB 3SY6A 1JZ7A 4OVUA 1QKZL 1BWMA 2A9DA 3BQUC 4D0DB 1OTTC 3QW9A 3VD0A 2PCPA 3MCLH 5ECJE 5JNYA 2IG2H 4WQQA 4Z7VF 3O4LE 5FK9B 4HLZG 4AL8L 2UVFA 4W9DC 3BC9A 4NQDD 3MA9L 3WEAA 4UIMA 1FVCA 2HTLC 3D0LA 5DRWB 1P1ZA 1C8QA 2OR7A 3EOAA 3DO4A 2X4TB 4JR9L 4Y4HC 5DO2D 2BIQA 2VLRA 4L3AA 1KLFB 5GRJH 1EFXA 1AZNA 2A83B 4N0UE 3FN0H 3M1OA 4ODHL 4TTDC 5BVJB 1KXTB 2QFPA 5SWQA 2BDNH 5DK3A 4K3GA 2CUAA 3OMZA 3UX9B 4MDJA 5TQ0H 2DY2A 4KKQA 2ZUQB 1ICTA 2DWDA 3HUJA 3SE3A 5GXBB</