1E5UI

Nmr representative structure of intimin-190 (int190) from enteropathogenic e. coli
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
187
structure length
187
Chain Sequence
TLTIDDGNIEIVGTGVKGKLPTVWLQYGQVNLKASGGNGKYTWRSANPAIASVDASSGQVTLKEKGTTTISVISSDNQTATYTIATPNSLIVPNMSKRVTYNDAVNTCKNFGGKLPSSQNELENVFKAWGAANKYEYYKSSQTIISWVQQTAQDAKSGVASTYDLVKQNPLNNIKASESNAYATCVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Recognition of the Translocated Intimin Receptor (Tir) by Intimin from Enteropathogenic E. Coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Intimin
molecule keywords INTIMIN
total genus 27
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2000-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF07979 Intimin_C Intimin C-type lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1e5uI01
3.10.100.10 Alpha Beta Roll Mannose-Binding Protein A; Chain A Mannose-Binding Protein A, subunit A 1e5uI02
1BYFA 2BPHA 4J6JA 1SB2B 3P5IA 4UWWA 1SL5A 2LS8A 1T8DA 1K9JA 1CWVA 3GPRC 1DY1A 1RDL1 1V4LA 1KWXA 2ORJA 1YXKA 1U0OA 1DV8A 1RDI1 4AK8A 2IT5A 1U0NB 1J34B 4KI1E 1SL4A 1K9IA 1G1TA 4GI0A 4GJ0A 4E52A 1KX1A 4N33A 3CADA 3BX4B 4GKOG 4WUXA 4QKJA 2BPDA 1KMB1 1LITA 1UOSB 4N36A 1R14A 2IT6A 1KZA1 4QKIA 4KMB1 1IXXA 2RIEA 4HU8A 1KWUA 4IOPB 1HUPA 3WWKC 3G84A 3ZHGA 3GPRB 1KZC1 2H2RA 2RIDA 2VRPA 2ZIBA 3ALUA 1AFB1 1TLGA 2MSBA 1O7CT 5FFTA 4J6NA 1BNLA 3WWKA 1JA3A 1RDM1 4AQ1C 2OS9A 1RJHA 2PF5A 4S0UA 4WUWA 1RTM1 1Y17B 1WMYA 1R13A 3IKQA 4G96A 1FM5A 2BRSA 4ZETA 3UBUB 1XPHA 3P5DA 1U0OB 1V7PB 1IJKB 3G8KA 4MTHA 2N40A 3P5GA 3VYKA 3WWKB 5B1RA 1AFD1 5F2QA 4WCOA 5B1WA 5FFRA 4J6QA 2ZWKA 1BCJ1 1HTNA 3P5HA 1UEXA 3FF7C 3GPRA 4G9AA 1G1QA 3ZHGD 3FF9A 1WT9A 4IOPA 1KG0C 2XR5A 4N35A 1IXXB 3FF8C 1QDDA 2YHFA 4GJXA 3P5FA 3CDGE 1IJKC 4J6LA 4YMDA 1FVUB 5J6GG 4N34A 3WHDA 2L04A 1UKMB 3ALTA 4GK1A 4PDCA 1J35B 1WK1A 3G81A 1AFA1 1UMRA 4M1GA 1F02I 1P1ZD 5K8YA 4CAJA 3PARA 1F00I 1BV4A 3VYJA 4PP8A 1MPUA 1KCGA 1WT9B 3DBZA 1O7BT 1P4LD 1KWTA 3PAQA 1DY2A 1G1RA 4N38A 1EGGA 5B1XA 1SB2A 3C22A 4CSYA 2OX9A 1X2WA 1KZB1 1TN3A 2PY2A 4C16A 1YTTA 4M17A 1KWVA 1YPOA 3FD4A 3CDGF 3WBQA 3ALSA 3BDWA 2BPEA 3IKPA 3NCXA 1U0NC 3CFWA 3UBUA 2RIAA 5FFSA 1E5UI 4ZRVA 1PW9A 3IKRA 1YXJA 1BCH1 4ZESA 1EGIA 2KMB1 2RICA 3VLGA 3KMB1 1X2TA 1T8CA 1JWIA 1UKMA 1KZE1 1KWWA 1C3AB 1FVUA 3WH3A 4J6KA 1FIFA 2GGXA 1RDJ1 2XR6A 3P7FA 1E8IA 1PWBA 3K7BA 1DY0A 1BUUA 3PAKA 3IKNA 2ZQKA 1RDK1 4N32A 2I83A 5KTHA 3GPRD 1UEXB 4WRFA 2KV3A 4M18A 3PBFA 1SL6A 3WBRA 1UOSA 2VUZA 2H2TB 1V7PA 2M94A 3L9JC 1KWZA 4KZWA 1C3AA 4QKGA 3G8LA 1B6EA 4J6PA 4QKHA 4ZRWA 2MOGA 2C6UA 3WSRA 1UMRC 1Y17A 4YLIA 1J34A 1HYRA 1KZD1 5KTIA 3C8JA 4AQ1A 5M62A 1YPQA 2MQGA 2ORKA 1RDN1 4C9FA 4N37A 4WREA 1X2WB 3P7GA 3G83A 4DN8A 1XARA 2VRPB 2VUVA 1B08A 3WH2A 3C8KD 4LU5A 2OX8A 1G1SA 4WR9A 4WRCA 1BJ3B 2N7SA 1KOEA 1FIHA 1ESLA 3CCKA 1YPUA 1TDQB 1OZ7A 1UV0A 4EZMG 2CL8A 1E87A 1QO3C 3KQGA 4KZVA 3HUPA 4UXMA 1IODA 1J35A 3P7HA 4WQQA 1HQ8A 3BX4A 2E3XC 3T3AA 1MUQA 1JWIB 3RS1A 4J6MA 1X2TB 1IODB 1GZ2A 1OZ7B 2E3XB 2GGUA 3VPPA 1JZNA 3M9ZA 2MH4A 2AFPA 3P5EA 4LQFA 1H8UA 1KX0A 2GO0A 1BJ3A 3BDWB 1KWYA 3NCWA 1MSBA 5LGKE 1V4LB 3WBPA 1WMZA 2MTIA 1RDO1 2RIBA
chains in the Genus database with same CATH superfamily
1Q0EA 3GKWH 1V3KA 5C0IB 1BVNT 2ALAA 3STLB 4CU6A 4F7TB 4P9MH 3TPUA 1CE6B 4JG0H 3UGXA 1GGIH 3NA9L 4M1GH 4PBXA 2YOCA 1ZVHA 1FLRL 5MEQA 3NJIA 1ZIAA 4O51B 4ZX4A 1NAMA 2B9AA 3MV01 5EUKB 3RVWC 1U3YA 2ZIDA 4X7SH 1DVZA 3VDAA 1N12A 4PGCB 4DPRA 3OLEA 1QTSA 1T83C 5I6MA 2A74B 4QHUA 4V33A 1NGXB 4YZFE 3LNFA 4LEBA 4DERA 3RX5A 2VN6A 3DURB 3T1FA 4L4TA 2NW3B 3QIWB 43C9B 4RAVA 3DK2A 3AY4C 4YNYB 1P7QD 4MDRA 3W2DL 2HVJB 1W72A 4J23A 1YECH 2QELA 1VCAA 4UUJA 1KJ2H 1E28A 5D8JH 4QHLA 2XJKA 4TUKH 4C83A 1J5OL 1G4MA 3GIZL 4XBEL 3ENEA 5BS0E 2PTTA 2CXGA 1E0OB 3SBQA 5HVFB 1I8UA 2PYED 4XNMA 3CVHH 5DI8A 3ATFA 3DDGA 2VDML 1OTUC 3OAUL 4JDZA 2IOMA 3RBGA 4DN4L 5F6IC 5IW6A 1MHCA 1B2WH 4GUPB 4KH2A 1EFXB 5EO1B 3N0PB 3PV6B 4ZFQA 1PG7X 4K73A 4AEHH 4U0RC 3FBKA 3X1GA 2DYRB 3O6LH 3ALWA 4F7CB 2YN3A 1R14A 5H94A 2H8PB 2VUOA 4HLZG 1QSFB 3O81A 1J86A 1N68A 1DTUA 5E6IB 3V4VB 4TUKL 3V52H 2IFGA 4OM1L 3U9WA 1DFBH 2WXOA 1Q9OA 2OSLA 4HUVA 5DVNA 3CFBA 4G1EB 5K59F 4LNVA 4DN4H 3T3MB 3TO4B 2W65B 1KF9B 4G1MB 1RZKC 5E6SB 4PGEB 3ZX1A 2YD9A 1U8OB 2I83A 2ENSA 1MJJA 1MVUB 1PTZA 1S9VA 3P9LA 1NCWL 4M5ZL 3BZFB 4Z7UB 1TLGA 1ACYH 3GI9H 4MMXB 4BZ2H 2K1MA 3L4ZA 4FAAB 4J6NA 1JA3A 3HHMA 4A6YH 4Z7QE 3TT1L 2VYRE 3ZTCC 1S7QA 2AABL 5BCAA 2NRDA 4TNWK 3TJPA 4LGSB 4K94C 2EDMA 3H55A 4WFHD 1BBJA 4GB9A 4XCEB 3FQUA 5J4MA 2OK0H 1QLFA 1UURA 3RG1C 4HJ0D 2NTFA 1KIPA 3WTSA 3QHZL 4NEHB 1UACL 1QA9B 2YRLA 4NO0B 1FC1A 4LF3A 4G83A 1IC0A 4O2FA 4PJ5E 1CURA 3OKMB 3DXAB 3PWUA 4P06A 4TSAH 5F7UA 2KKQA 2KH2B 3MBWA 2CSPA 4PWIA 2GTQA 1BBDH 1H6TA 3TCXA 1EWHA 2B4CL 2QZ5A 1OIOA 4LOFA 5FGBA 4XPFL 4LF3B 2BRSA 4UIMB 3EBHA 4A2HA 4Y2OA 1RHHA 3GBNL 4U1MB 3RUGF 1EHXA 1T7YA 3COOA 3RFRA 1O6VA 4UAHA 4AI7A 2ZTBA 2PYFB 3ZZSA 4HKBB 2EUVA 3QHZH 5AOJA 1FZKB 2C3VB 3STZA 1S8DA 3HZYA 3KM2A 1MFBL 2YAOA 2FK9A 4R2GB 1HI6A 2XG5B 1SHMA 1XBDA 2YPKB 3LZQA 2Y36L 3HR6A 5C09D 4D7PA 5MEPB 1NIDA 4I87A 4LBEB 3MV7B 3R7QA 1KCBA 2Z93B 4EIGB 4S1RL 3H7LA 4ES9A 3I50H 1BCJ1 1SYSA 5E7BA 4JRXA 2VLKB 2CE6A 4OGYH 3FTYA 4JY5H 2CJSA 3FF7C 2DH2A 4FQ2H 4X6CA 4ECNA 1UASA 3DO4A 4BA8A 5F0PB 4FKEA 5E2JA 1XH0A 4ZJ9A 4B0MM 3QZBA 2X09A 4IOPA 2ROXA 4ETQB 2YC1B 4BZ1L 1RURL 5CJOL 4K9EL 4FTVE 1IMHC 4JZJA 4KFZC 1YZZA 2PPFA 4U6VL 4Z0XA 4AYGA 1W8EA 3MA7B 1CPUA 3VGBA 4JY6A 4P4RB 3GHEH 2BNQA 1OO2A 2YHFA 1O6SA 1PPIA 5DZNA 5F6IB 5JTWA 5EU6E 4X80L 2ZPKH 1A22B 4W93A 1CGYA 2XDHA 1VA9A 2QPFA 4XAKE 3GGWA 3CZLA 3FU5A 3K72A 5I8KH 1BQKA 4EMZA 2V3FA 2JQZA 3P4NB 3MV8D 2MPAL 1BECA 4AQ8A 3KPNA 1RSFA 3ETTA 5H37H 4LKXA 5D6DA 5DO2C 1G9EA 1CC3A 1ZV2A 4HSQA 3S3JA 1UYWH 3BIBX 3T0VA 4FC3E 4P48A 1RUKL 5AB0A 3SE8L 3O4OB 3ARED 3BVNB 2X89D 4JY6B 4ZAKD 3VSTA 4RAVB 2OA9A 4EDXA 2PCFA 4OKVA 3ECUA 4UTAL 1NINA 1U21A 3CFTA 4LHJB 4ZX3A 2J1KA 5EOTA 3D06A 3OKNA 4PGCA 3KJ6L 2RH0A 4QD2E 1KN2H 1ASPA 1QATA 4JW3A 4XVUC 5GRWA 1KY7A 3PAQA 3B9KD 4G8FB 3HLKA 5SV3A 2IAMD 2WTRA 4I0PC 3T65B 2X4SA 4ONHA 3S97C 1IB5A 1H0DA 3UPCA 5IBLC 4EQ3A 5E6ID 5D1XE 2LABA 4PH8A 3E2HB 3O45A 5C0IA 5KG9B 4R26H 1MVFA 3NRPA 1U33A 2AGJL 2OTUA 5F3HB 2GTWB 1TR7A 4RAHA 4H0GA 4H4NA 1MWAA 1B9KA 4PGBB 3UTSE 1NPJA 3SYPA 3LNHA 1GC1L 5D5MA 5TQ0H 1WWWX 1KLFA 3MA9L 5IP4A 4XC3H 3ZYOA 1CLVA 3GKZA 1IC7H 3BVVA 4Y2OB 3ZKNC 1R3HB 3VSUA 4F58H 5ANME 3ZVVA 5LBVA 3DO7B 2OL3A 1KCUL 4HIXH 2CDGB 3LXAA 4ELKB 5KVDE 3VD4A 2PWEA 2AXFB 1P84K 4CSPA 3WDHA 2XN9B 3MJ9H 3GM0A 3Q44A 4XNUH 4DN3L 2DEYX 5AOKA 3ISYA 3O3BA 3MLVH 1AJ7L 1EGJL 1KBKA 1WA2X 4HFWB 4GPVA 1XIWA 3FO2B 4XVSL 3PQYB 3DV4B 4YL9A 1XGTA 4MMXC 2YUWA 1WD9A 3I9GL 3M8OL 1GC1H 2C1OA 1KWWA 2IGTA 2VZOA 3GIVA 2QKIA 2DIBA 3DHMA 1BBJB 4XN4A 4QOKD 5EOCJ 2OQJB 1NBCA 1LK2A 1OP9A 2K8QA 4FN0A 5FO8B 5JDJA 5E9DD 3RVUD 5T3XE 5E5LA 1RKRA 2EH8H 4L8BA 5E5UB 3WJLC 3WNNA 2ROYA 3QCTH 4K23H 1KGIA 4AEIL 3MXVL 1J7VR 4F91B 5IMMA 1KCKA 3O6MH 1SHSA 3NG5A 2DWYA 2WQ8A 4NRZB 5EEWA 4M6NH 5HHMB 1AJ7H 3VFNB 5B1JA 1E5CA 3U2SA 1WS8A 3KL3A 3CFBB 4LQFL 3LQMA 3G9VA 1T1ZB 2V33A 5DHVA 5AVTB 1SBBA 3L4UA 4Q0XL 1UEXB 3BPNB 4N9GA 3P0VH 4A6YA 3CE1A 4LE8A 2Q2EB 1EZUA 2EH8L 4K3DL 1MXDA 3GXMA 3D87B 1TQVA 4Y5YC 3MXVH 5DJ0B 1IAIH 2AJZB 1JPSH 1ZAGA 2AEQL 4YDLC 2WHVA 1IU1A 3REVA 1HQRA 4DK3A 1ZTXL 1WCBA 4IKLA 4RA0C 4G43A 4NJ9H 1RULL 4PLNC 5B3JF 5CCGE 2CK0L 1UQSB 2GFBB 2PCPA 2W94A 1FFPB 5DU7A 2WGXA 3WKQA 3FO0L 3QHFL 2AI0L 3VXSB 4ZZFA 3HUJF 2C9AA 2A9ML 2PTTB 4XPAH 2D2CC 4ZPTB 1HYSC 1X3DA 3NPSB 4GXVH 4D0DB 4FABL 1AR1D 5J6GA 3GSRA 4UYPA 4JGMA 3QJXA 1M42A 2GAZA 5EU6A 2HAZA 1S9WA 1EHNA 3RWCB 4URKA 4FHJA 2WC7A 1I4FB 4NWUH 1FORL 1E3XA 3IT8D 3U46B 5ICUA 2A2QT 1ONQA 4FP8L 2OW6A 1E5YA 4OGZA 4QHUB 2WIMA 5I82A 4AW4A 1ZTXH 5ECJE 5D7JC 5FFGA 1SJVA 3ARPA 2DW5A 4N26A 3EYQC 1XTMA 4FF9A 4KROC 2WBJA 3WEMA 1NAMB 3H3KA 3QSKB 4WO4D 1CFVH 4ANWA 1S46A 2YR3A 4LPCA 5C6PB 2WQXA 5JMOC 4Q9RH 4N37A 2ARWA 4XX1G 3UOAB 1EX0A 3CFJA 5TPWL 4MZ2A 4I85A 1A8JH 4S1SH 5DD0L 4A2GA 2VTFA 4F7TA 3NZ8B 3L7EA 4NO3B 1I3GL 4WI0B 5AW5B 3UBGA 4BRVA 3ABLB 1G6RL 2XU9A 4NQTA 4DP5X 4DN8A 3PNRB 1FGVL 2VRKA 4D8PA 5D7SH 1XB6A 2CLVA 1HDMA 3D9AL 5MP6H 1IAMA 3QI9B 1TETH 35C8L 5DURB 4JANA 3BFOA 4Y4KA 3ZLQC 1WP6A 5F1NA 2Q76B 3H9HA 4TVSa 4Z7WF 3MUJA 3EFDL 2X4RB 4NKMA 5DQ9B 3SD5A 4OZ4B 4TLTA 4BUGA 2DQUL 3BQUB 3P73A 4PJHE 2LLNA 4KDTC 4PJXB 1BIHA 1H8LA 1ZMYA 3CN2A 5TPWH 1HINL 3DX2A 2FDBP 3QWQB 4L23A 3U25A 3CX5J 4Y16B 5HD8D 3MV9A 3OAYH 5KVDL 1T0MB 5E6IC 5CZKA 3Q01A 4B60A 1AD0A 2ADGA 3QR0A 1TQBB 2JJWA 4WQQA 1HQ8A 1I1YA 5IFAL 4L3FA 4YZWA 4LCIL 3P2BA 5JA9A 3EFDH 5MI0B 3WE6A 3DIFB 4MZRA 3QZWA 4UBDC 2VDOL 3CUPA 3CSTA 4S1QL 3OZKA 1EEQA 1GZ2A 1O9WA 1MJUL 4OZGA 4WW1A 1UJTA 2CDEA 3ALPA 2YEQA 3RPBA 3SEPA 2NCMA 3T2LA 5BPPA 4M9OA 1W8NA 2EEXA 2ZG2A 2VLJE 1RHFA 1FVEB 3E1F1 1Z5LB 5HYJA 1QWUA 1CD9B 4LDEB 2XICA 1HU8A 2DLFL 5AVVB 4NC1E 3RTQD 1QTYT 3QCVH 1IQDB 5D96B 2V2WA 5FHBH 5CJXC 4GO8A 4PGJA 1NFDF 3E9UA 4C4KO 1FYHB 3N5AA 2IJ0C 5JLZB 4BFGA 2ZSWB 4Z23A 4M48H 1A4KB 1BAWA 1HSBA 1P6FA 2UYLB 1Q1PA 3E8UL 3F12A 4PJCE 1RLBA 3LY6A 3THMH 4F37F 2RIBA 1OAZH 4OCWH 1P4BL 1XZ0B 3IMRA 2JKXA 2XA8L 4HUCA 4KQ3H 5AWNH 3ZMRA 1JK9A 4N20A 4IW4C 1HKLL 3ARSA 5ICXA 4OAWA 4KTDL 2XCMC 2XVLA 4HWUA 5D1ZB 5CM1A 5MERA 4PS8A 4YXKH 2R56L 1QTPA 3MX0A 1CBJA 5DJZA 3QW9A 4WFFE 3IJEB 3FQRB 4LFHD 5K9KB 1GC1C 4M4RB 3BKYL 1PCXA 4WWKB 1MREL 5HHXL 3SDCC 3WFEL 2SODB 1GZPB 3K71A 5E6YA 4LASH 1A7NL 2O5ZL 4TUOA 3UZVA 2D4DA 1FCCA 4FQLL 2XZZA 3EKCA 3U83A 2ATKA 1Y07A 5F70A 4D9LH 2BFVL 4ODVH 3QDJB 3EYQD 3UIZA 4D9QD 1DN0B 4AW7A 1DZBA 3GSWB 4HJUA 1P84J 5A43C 2AFNA 4Z7WB 2FBRA 1JN6A 1IT9H 5EZLA 4QKJA 3VI4B 4LP8A 1T0OA 1U8CB 4QXVA 3SDYL 3WTYA 3FT0A 1W80A 2L7QA 4LK4A 1XSOA 4PWJA 1ZA3B 2VLMD 2WVUA 3CHSA 4HV8B 2N0MA 1JRHH 4FXGC 3S4SG 1T7ZA 2R1WA 4OFVA 2VC2L 3FTZA 3GSQB 4QRAA 1TZGH 2NNAA 4KTGA 3QWOA 1QRNB 4HU8A 1Q9LB 2XWJB 1E8YA 1W0WA 3QIUD 2J6EH 3RGHA 4KBPA 1BEXA 4UQIM 1H3PH 1NGYA 4JM2F 4LPXA 3JVGA 3L5IA 2PWFA 3V95A 2C9UA 1EV2E 4DQOL 3QJUB 1EMTL 2DM2A 3PHAA 4M6AA 4AE1A 1L6ZA 4OR1A 3GSQA 5JIIA 5DJ6A 1CQYA 3HG1D 4XO5A 4PJ5A 1OK0A 4KOBA 1TEFA 3LNIA 3LRSA 2IEPA 2DI8A 2AKRB 3AU1B 5D7IA 2EYTB 3DBSA 1AXTL 2WPGA 1E9QA 3BEVB 5CUSL 3GBMH 2OULB 5DHEA 2JJTC 1A21A 1KJ2L 4KXAA 5GRUL 3LEYH 1YY9D 4WUWA 4QKXB 3T4AC 1MQ8A 1J5OH 2CHWA 3E1ZA 4IRSC 1IUZA 4UM9A 4ODSL 4U1HA 3IPEA 3UZEA 4KK9D 3VXRD 4A1RA 5EUOF 3QUMH 4M5SA 2J4WL 4ABWA 1CXFA 1D6EB 1USQA 4M4RA 1LMKA 4I0PA 3ZRFC 3UBUB 1S6NA 5HVHB 4KHXL 3WL9A 2ENJA 5C9KA 3HS0A 3TFKD 3O2WL 3O6LL 3GMOA 1UJ3A 5IG7B 3D2UA 4WTZA 5C0JA 2HMIC 4HGWB 4QJ4B 2WLZA 5I1CH 4IMLA 3IDIA 3LDBB 4OAWB 5K9OB 5DFVC 2LVEA 5HDOA 4CSSA 3FT2B 1KCVH 4UQAA 4FA8A 3VMOA 4JO3L 4NAJA 1LO0L 4NC2B 3FFCD 5DEZA 3X3FH 2PABA 2EVJA 2QVFB 3RIAK 3UH8A 5K9QG 4YSPA 2VUKA 2C9SA 2UZYA 2QDWA 3SSGA 5LCVH 3UTQA 2EECA 1Z0NA 1GYCA 4HZAA 3QRGH 1S9YB 4DP2X 1G9HA 5DJAB 2JTYA 4POUB 3KPOA 3TJEH 3PDOA 5C71A 1YMHA 4N35A 4U2YA 4JUSA 3AXLB 3BPCA 1RK7A 1WTLA 4TQPA 4AMWA 5D96C 4POYA 3FCUB 4KO9A 4N6QA 4XNDA 4KXBA 4KITB 4F93B 2XG4A 2HWZL 4KKRA 3LVTA 4DKFL 2N56A 1A6WH 1MI5E 1FAKT 3IGFA 3ZSTA 4WK2B 3QIBD 1W16A 4WK4B 4AX3A 4PG9B 2PW2B 1EERB 2FCBA 3L3GB 1UCBH 3R06B 4MJ6A 4KH9A 1ROCA 2EE0A 4XOCA 3IJSA 3V0IA 3BUDA 1MCQA 1IJNA 4FNSA 5JW3L 2B4CH 3N43F 1OCOB 4H2CA 4OGQC 4R84A 3MRRB 4M7ZC 3D85B 4HKZA 5FC9A 4OJAA 4JZOB 4XMZA 5L6YH 4JREC 5FK9B 1E42A 2P5EE 3I9AA 5F9JA 5AZEH 5FV2A 2VITA 3FL7A 1W0VA 5CILL 5JOEA 3MRHB 3BLPX 5FM8A 3IM1A 1AZBA 5T8IA 5I1KL 5I2IB 2QQNL 3IFLL 4D8PB 4XN1A 3DJRA 2G2PA 3X12B 2JB6B 2KI6A 5DRNA 5I76A 4MQ7B 4AG4H 1RUQL 5TK4A 3ZJAA 4ANVA 2PPAA 2EC9U 4YGVA 3JT2A 3DX1A 2QSTA 4OZFB 1X2WA 5AZEL 5I2IA 4F8OA 1NFKA 1BQHG 5IHWA 1HHJA 4NZDA 2FT8A 1CBVH 4H8HA 4MNQB 2YEVB 2WXNA 2JELH 4J8RB 4V2CB 3ALSA 1LYQA 1D2OA 3F7YB 3RNKA 3TYFA 3AS2A 1B4JH 4WW2C 4FKHA 5F0LB 5L2JB 1QX1A 4X9YA 1I4FA 4AIXA 1UM5H 3APCA 5EMYA 1E9PA 3DUSA 1AXIB 1MAKA 1Q0YH 3JV5A 4XVJH 2Y7MA 1UXSA 1ODUA 4W9JC 3V5HA 4Z7WE 3F5WB 4JHWL 3KMB1 2GJZB 1T1YA 2OMXA 3V0VB 1INDL 3L1GA 3OKDB 3ZUNC 5I30L 4EI5A 3ZDZF 1JGUH 3LX9A 4CKQA 3EO0B 3C8DA 4NPYA 1NJ9A 1MLBA 2Z9TA 1KNOB 3GMRB 2YA0A 4PQXA 3CG8A 1G6VK 3V55A 2HTLD 2ZAGA 3HE7B 3LV3A 3SE4C 1J8HE 1S7TB 1GYWA 3DSNB 3WNMA 1RDJ1 3MRDA 1Y1UA 3VQMA 1A1MA 5F72S 1E8IA 1UM5L 5F7KC 4AGLA 1TSRA 1UG9A 4OIIL 4UYQA 4BXSV 1PNCA 4OCNC 4K3EH 1M2VB 2XN2A 4JVWA 5I0WA 1U92A 3FF8A 2XVBA 3K2UL 4BQ6A 4RGNC 5DO8A 2WZ5A 4PR5A 2FEDC 4ZUVB 4DFIA 5BV7B 2ZE0A 2Q10A 4PI2A 4OQTA 1U9KA 4P5TB 2WP3T 2YQ3A 4JVUA 2D4FA 5JHDD 1D7DA 5J8OA 2R0LL 3MLUL 3T2NH 4W6XB 4NQVB 4LSVL 4I18B 4YN3A 4ENZA 3RVXD 3A6BL 5DMGD 5KYWB 4U05A 3FTXA 3ARDA 2EDOA 3MA9H 4WKZA 5KWYC 2X0VA 1WQVT 2NY2C 3I84A 4RMQA 4P59H 4UDUA 3NEOA 4CNIA 5A2AA 2Z31C 5EDSA 3KPSE 1F1DA 4HGWA 1RZJL 1Q90A 4EIBA 1YG9A 4MXQC 5F7MC 3FOMB 3N85L 4PJHF 3VFRB 4AUYA 5AVUB 4M8VA 4OFKA 5JYLA 4XNXL 5DEGB 4GIAA 1JXKA 4ZOBA 3O9WC 4HC1H 1WBZB 2G9HB 1U8QB 2RQEA 4HIPA 3VX0A 2G75B 2QADD 3S3PA 5LDUA 4OGXH 1BZEA 2CCVA 4WUUD 5HVHC 2O5XH 2MOGA 2E0PA 3HNTL 5LLIC 3DRTA 3CHOA 1NEZA 3ZYIA 4N1CA 1PZ5B 3MRPA 3SDAA 1R33A 2H3NA 2J5LB 2O30A 1LEGA 4LLMB 2YPVH 1YPQA 2VM9A 4MJJA 2MQGA 3P4OA 5L2KD 3S3CB 4QRQB 1A6TA 5BO1H 1QR1A 5BS0D 1KLFB 2B3IA 4K23L 4AEIH 3DPBA 5T3ZD 3ZHLA 4AYBA 2ZUXA 3O3DA 1JCVA 4HSAC 4FXTA 5CCKL 3TEWA 2VCOA 4GJTB 1VACA 2WP3O 4NN7C 4I3RL 4TVPE 5F3HA 2JI1A 4J2QA 1QPXA 4QF1A 4PLKD 2O5XL 1INQA 4HOMA 1RK1A 2ZP0T 2P8LB 2AANA 4M93B 3VXMD 1H0DB 3ES6A 3OLIA 1CGVA 1TYRA 1MCHA 2MHAA 3H3PL 2VN7A 1A9BB 2XTJD 3WIHL 3EJTA 1DR9A 3Q43A 4DVRH 4IOSA 2XKUA 4MCZB 4F57L 2CNYA 1PLGH 3FFCE 1FV1A 4MAZA 1IFRA 1NC2D 3FU9A 4IRZH 4YDJA 4TSCL 4B95C 3MRMA 5A6IA 4LARH 4GLRI 1BJ3B 3TLRA 1X9UA 4N2BA 1DLHA 2A1WH 4IJTA 1AO7E 4R0LA 4F7KA 4PJ9B 1PZAA 4WFEE 3LCYA 3T2PA 4N4YB 4TQHA 3VI4E 5ACZA 1KENL 2HFFA 3ARFB 4OU3A 4Q6IA 5D2LA 5I66A 5E5MA 4XN2A 3KQGA 2NXYC 3QEQB 1A02N 2A9MH 3SDXF 4CC4C 4NI6A 1F13A 5AENA 1JZGA 1L3NA 2W9EL 1JI1A 1J35A 1HXMB 4LVEA 3OJDB 3RWGA 4FX5A 1MY7A 1ZANH 5TH2B 3O8XB 3AFLA 4PP1C 4BH8B 5GGTL 5E9DE 1IC1A 3EUUA 1Q72H 4X6DF 5EN2B 4QXTA 5ALCL 4N1HB 3V4LA 2NNCA 1OTTD 25C8L 2F53D 2HTKD 1EDQA 4RFNC 1EVTC 3DMMA 3I6KB 4DKEL 3FQTB 4YDIH 4N0FA 1IGJB 4LP5A 4XP9H 5DYFA 4W70A 4P4RA 3OR6B 2CPUA 1G5GA 2MPVA 5DUPL 3X3GL 2AFPA 3LB6D 3MA7A 4OLVH 3PG2A 1AS7A 4EI5D 1X7QA 4PUBL 1YY8A 4QHNB 2GO0A 1AR1C 1T80A 4YE4L 5F44A 5DTFB 2F9BT 4NZRL 1D9KA 3KBEA 3T4YB 2ODIA 2ZYIA 1G43A 2QVKA 2BNRB 5JMRA 4X6CB 2ZCLH 5GGTH 3QJTB 4JRYB 3GMQB 1QO3B 4YHNA 2X53A 1NUGA 1P5UA 3SN6N 1XH3A 2AEPH 4WNSA 5EZOH 4J6JA 5E1GA 3SGDH 5C7XH 1YECL 3LPPA 1N5AA 3KPSB 3KPQB 4JGUA 5DUJA 2NZ1A 4UWWA 1BJ1H 4M3HA 4P0DA 2JFCA 1UZ6E 3GPRC 4OLVL 4HULB 1OY3B 2VXSL 4GBXB 3K81A 3RRQA 1EFXD 2J8HA 1GW6A 1OE3A 5JLZA 1KYUA 5KN5B 5H37G 2YSSB 1BJMA 4GQQA 1O9ZA 4JFVA 1T89C 3VUAA 1C1EH 3M46A 4LRNH 1BG9A 1SL4A 2V7HB 2Y25A 5IBUB 1NCJA 4YVNA 1SJHB 4YLQT 4LHUD 1O9VA 4QHPA 1E5BA 4XXDB 4P23D 2WXLA 2Y5QA 4QCIA 1KX1A 4FNLH 3VJ6A 3CFCL 3NJJA 1E3ZA 4HJEA 2QVIA 4I8DA 2P24A 5AKSA 1OB1B 1QLFB 3NIGF 2Z3FA 5J3HC 4PTTA 3WIAA 2Y07H 4FQQA 1R24A 1FFOB 1B0IA 4IRSA 2YD3A 3JYCA 2EIDA 4M5ZH 4N36A 1CFNA 1PZ3A 1U2CA 3F62A 2ZYRA 3EYSH 3CAFA 3NYKA 3QUMB 4UB0L 2D03H 3VD7A 5J89A 2GBVA 2O61B 3TN0B 1CCZA 1ZJAA 3BZFA 4Y16C 4WV1C 5T1JA 4R7VA 3HZMB 1JPTH 1MFCH 4KJQC 5H35B 1GH7A 4JQXA 1NDGB 1TYEB 3AAZA 3B2UC 5AWNL 3C8KA 4H0LC 3FRUA 2BC4A 4HH9A 4M9PA 5HJDA 4PSRA 1MEXH 1H8SA 3ROOB 2IPKA 3LSOB 4LVHB 4KHTH 3BT2H 4YQXH 4B9YA 1FNLA 1BBDL 2VL4A 3P77A 1O7CT 4N9OB 1ASOA 2D03L 4JREB 4KKLC 1MCIA 4QGYA 3ULVH 1OAQL 4GMSL 3J27A 1AI1L 2CDFB 3HRZC 1EFXA 1FNGA 3L08A 5D2NB 4EOWH 2OS9A 4FFWD 3MBXH 1XF5B 5C0AE 3NEXA 3WFEH 3NDYE 4FHKA 3VA6A 4FLRA 3D05A 3GXNA 1DJWA 1LO4L 2BS71 5B1AB 2E6QA 5DD1L 1NQBA 1W72L 3ECVA 1RTM1 3WG7B 1BQHA 5IOPB 1UKSA 1I9IL 2AZUA 4MNGE 1ANUA 5EU6B 5G55A 5AAPA 1KXHA 3MV8E 1WMYA 1AS8A 5HGAB 2GITA 3TT3H 1NOFA 1TZHB 4AKQA 3GSRB 5GHWH 1CFMA 43C9A 4F8NA 5DGRA 4CADA 2AJYH 5CR8A 5EPMA 4FFVD 1ED3B 5AVWB 4UQBA 5B8CB 1D6VL 1HESA 1NCBH 1FFPA 2BVPB 4FS0A 4JFZL 1N8ZA 3HAEA 3WI9A 5HHQB 4R5XA 4G43B 2VC2H 4PJDB 5HI4D 3LIZH 1JNHB 4UU9B 9PCYA 5MEQB 5I74B 4O4YL 1Y18B 4G82A 2CDFA 4FFYH 4P9HL 4WO4A 4MTHA 1PZDA 2YD1A 2Y5TA 4KK5D 1AE6H 5E0QA 3J07A 5BQ7B 1AFD1 3WWKB 4YHPB 2XNAB 3B1TA 1FHGA 4KPHH 4A04A 3RZCA 1P6AB 2DAVA 4A6YB 3T6VA 5GS0H 1I8MA 4YL4A 2VSCA 1G1QA 4DTGH 1J48A 1AO7B 3WLWC 2B1HH 3T5WA 3SBWA 1GS7A 4PTUB 1L9NA 1IXXB 5E2UL 4MSWA 2ZG1A 4I4WA 4LDLB 1ETZB 3LN4B 3QR2A 1XZWA 3D4GA 1F42A 3WFBH 3RB5A 2H6PB 1QMUA 1UENA 4AEFA 4FFYL 4IU2A 2EO7A 2O61A 3UTPD 5B39B 4QJ3B 3B5HA 1UTDA 1CGUA 1E2WA 3JUYA 1TTGA 1F18A 2EXYD 4IRSB 1KGWA 1YEDA 5GRUH 2D0HA 3DECA 1H9DA 4YMDA 4I1NB 1S3KL 2R0ZH 3WNLA 2XV2A 2MKWA 4U6TA 4LSQH 4HC1A 5FUZL 3N2JA 4E9VA 3MRFB 1BQSA 5BZWA 4JRWA 1RUAL 3D39A 2B08A 1U3ZA 1YEDB 3ZTNL 1G7QB 5T3XH 1IC4H 4MMZC 2NZ9D 1F2XK 1FVCA 2I60H 5D1XA 4NPJA 1BGXH 1HHGB 1SN2A 5FYLE 4ELDA 2XN9A 1E3FA 2EDLA 1T7WA 2AXFA 1G1KA 3IDMB 2HT2D 1JFQH 4YSOA 1UH4A 3JWNE 5DGQA 3S5LA 3SKOB 2B14A 2XX1A 4OD3H 1MZZA 3L4CA 5GGVL 3IEAA 4AYFA 1MPUA 1KCVL 1V7ML 3B8YA 3SOTA 1SXZA 2D73A 1QFUL 2O5YH 3HC4H 5JIKA 3K0YA 3X3FL 4HHGA 2VQTA 2EZ0D 1BLIA 1MCCA 3VU2A 2EDRA 2YD0A 3FHAA 5M95B 1J05B 1AVAA 3P4MA 1IC4L 4OZGE 5DHMC 3BP5A 5L8JB 2FSDA 4TYUA 4PMEA 1N5AB 4XX1E 1XGRB 4XE5B 2Y5TB 3ROLA 3WN5C 1EGJH 5FO9A 3VGDA 5BOZG 3T65A 1MHPH 3WD5H 1N8OE 3K6OA 5CGBA 2CR3A 2BMKB 1FZJA 4L8DA 1ZHLA 2ZXEB 2FNBA 3K2IA 1JPGB 3DDFA 2F5BH 4PRPD 5IBUG 1ZPLA 1U8HB 3O6KH 1BD2A 2HWZH 4L4TD 1A3RH 3FU7B 2BPEA 1XGYL 4XC1H 5EEYA 1KTDB 2H1LM 3BD4A 2Z91A 3SE6A 3WY2A 1U0NC 1YPZE 1YEKH 3W5NA 4BHUA 3RGVC 2DQJH 5BV7L 3UZQB 1E5UI 3QUXB 3WTVA 2CMRL 4Z7OB 4B96A 1UADC 4BQCA 3AM8A 3WKMH 2A83A 1RZKH 4R8WL 1BCH1 2CM5A 1I8IB 1QLRA 2EXSA 1EGIA 3EDDA 3FB5B 1JPFA 3X17A 3I6KA 4LIQL 5EZPA 4HQQL 2TRYA 3GYRA 2IXQB 2QQKL 4JZNB 4LKXB 2OV0A 5LBSH 4FJ6A 4K5MA 5FW6A 1SXNA 3DVNA 1AGDA 3KPNB 4X5LA 3GLDA 1LP9A 1XF3A 4R90H 4ICWA 5A2KH 2E4FA 2YKLL 3M7FB 5A2CA 4P5KA 1FFNA 4KQ4H 4JDVB 4RA3A 3VFGL 2BHUA 2VZSA 1MFUA 3O2VH 5FUCE 4PJ9C 3U1SH 3ARFA 3LKOA 2VH5L 3AM8C 4FXGB 1AIFB 3U0TA 1EO8L 2NDGA 3CLFL 4HG4J 1WRFA 4R8WH 1J1XL 5IQ7L 2H3XC 2YD5A 2AEQH 4IM8A 3IJHB 5AEAA 1A6UH 4RFOL 4XP1H 3QG7H 1KJ3H 2NY4B 1DY0A 1BF2A 1KBWA 2PP9A 3WNJA 1OGPA 1SY6H 3GQFA 4HIHB 3FRUB 4WI8A 4Y5XC 3JWNG 1NM4A 2NYKA 3MRQA 1OZUA 5CR1A 3BAJA 2V2TB 3RDTB 3GPRD 3LTVA 5GGUA 4X98A 5AW3B 3ZKXC 2X0WA 4GQZA 1M53A 3PL6B 3FCTA 3LN5A 3CSFA 1UWXH 2C34A 3P3RA 4A38A 1RK1B 3UZEC 1INQB 3PBFA 3WBRA 2JELL 3KPMA 3FTVA 1VFAA 4RZKA 1YYML 5GGTA 1VZGA 5AW6B 3B37A 1FFOA 1AACA 2APSA 4PJ5D 3FUIA 4KTEL 2WLIB 4WHDA 1SY6L 1QRNE 7TAAA 1AZCA 1F0LA 3TEZA 1A6TB 4LGRB 3GHPA 1QR1B 1DJSA 2EXTA 2X1XR 5LB1A 3LH8A 1YHPA 4R5VA 3H8NA 4Q9RL 2R69A 3O6FB 2W0LA 3MRGB 4GH7B 3RDJA 4EN3C 2ORBH 4K5LA 4CW1A 4F8QA 4BZYA 1HAUA 1FL6A 3EJZC 4HIJA 4N86A 2K3TA 3QQDB 1T5KA 5BRQA 2XXFA 2F53B 3GS7A 5EEXA 2QGEA 3WSRA 1EJOH 4MB4A 1VFUA 4D9RD 3BKMH 3O3EB 1AGFA 1G7JA 4N2DA 1A6AB 1UH2A 3F7QA 4GSQA 2VWEE 1R6VA 3WOVA 4PJDE 1DVFC 2PR9A 3WELA 3D5OF 3OAZK 1CGTA 3FOMA 4R2GC 4PJIB 4ZFZA 3VFRA 3BYYA 3B2PA 1ZPUA 3H6AA 4XCEA 4JB9H 3T8XA 3HUJA 3K74B 2YD2A 5FYJL 5SWZE 5KYYA 3P7GA 2X89A 4ICXA 4R97C 1Y0LB 3ARDB 1QUPA 3KPSA 4X6BB 3MYJB 2ETWA 3OMAB 3ZRCC 2QSVA 1DEDA 3SQBB 1KN4H 3HHSB 3DK0A 4PB0H 3ZO0A 2VUVA 4IMKA 2LLGA 4LU5A 3BDBA 3LKRB 2VXUL 3ULUF 1YEEH 5AOZA 4U2ZA 3UBXG 4W9DC 2I25N 3UJTL 4JPIA 4MNHA 3V4VL 2EDWA 4YBQD 5CGYD 2AXJA 4ERSH 4MCYA 4NQUA 5A2JH 5FGSA 3TF7C 5EEZA 3ASOB 2GCYA 5E6IA 1JPST 1X7QB 2VDOH 5EOCH 3V4VA 3PLYA 2X38A 3QJOA 3T0AA 2YEZA 1QSFA 3SO3B 4XBPB 4NGHH 2FT6A 4OTXH 4LU5L 1Z9SB 4AVHA 1AIZA 1G94A 1EIBA 2GG1A 4AIOA 3Q1SH 3DSFH 2R7EA 3DMMB 3MRCB 3VXUD 3FQWA 1N2RA 4HC1L 2HT4D 3RL2B 1NGPH 4XI5C 2VXUH 4E2OA 3C5ZB 1UM6H 1ZT1B 3CBRA 4KVPA 4PD4J 1W6WA 5DI8B 5FHAH 5JPMA 4NUQA 3TWCH 4BFEA 2IOOA 3OKDA 2KPWA 4PV9B 4WLCA 1IM9B 2WLLA 3V6OA 3OAWA 3DGCR 5E24E 4H0HB 4HJ1A 4ZAKA 3L4YA 4PI0A 3K6IA 3ZK0A 4UUJB 2HFFB 1T4WA 4F9LC 4OTXL 1JZNA 3VXUB 1JIBA 4BELD 2F61A 5MEOB 3SDDD 3Q1SL 4PJBB 4HCFA 3RZCC 4N8PA 1TO5A 1HQ4A 4Y4FB 2CKBA 2B8OT 4OZFG 3T3PF 5SWQB 5GS1C 2GKIA 4CDGC 4K7PY 4RMSA 5FW8A 5FFLA 1U8MA 1QLEH 4Y1AA 4Y9FA 2Q86B 5DK2B 3ULSB 1IBDA 4YHZL 1A0QH 1DO6A 2OMUB 2DWDB 3BHBA 4WVRA 2R59A 1NFIB 1F8TH 1XVSA 4KJPC 3UC0L 3CTTA 2HJKA 3L5WB 4LSTH 3I9PA 1X9RA 4G8EA 1F11A 3RVXC 4F1ZA 2ZAIA 3QXTA 2CRIA 4WSJA 1X5XA 5FPIA 4KOCA 3GB7B 2JV6A 2O6EA 4ZW5A 3H7BA 5IK3B 3ABZA 1CFTA 1BFVH 2ZUSA 4YUEL 1FYTA 4IRJD 4ALAH 2EDEA 3QEGL 5I9QB 4QRQA 5IJKA 1G7HB 1CG9A 2FJSA 1QLEL 5D5MF 2IT5A 1G4RA 2H32H 4TLSA 1KTCA 1J0IA 4AV5A 3BO8B 2WIIB 4GKZB 2H3NB 2EEBA 4PS3A 3WBQA 4LAQL 4PJ7A 4X7EC 1KT2A 1ZHBB 5F88B 3P3TA 4G9DB 4PV1C 3HPJB 2P43B 1SEBA 1MCWM 1RUPH 3MVSA 1IGMH 2HN7B 5I1GL 1HXYB 1CR9L 1A3ZA 1T0NB 2PF6A 1IGTA 4DKEH 4AT6A 3ZL1A 1GVIA 3AB0C 1IBZA 1ID5I 3A6CL 3QXWA 1S5HB 1MKFA 1AHWC 2BPDA 1AHWB 3PP4L 1F41A 2GI7A 2B1AL 4DQOH 2W0PA 2E4TA 1VENA 3FT9A 2GHWB 5IJKC 4AMXA 3ESVF 3P9WB 3OX8A 2PPEA 3S8WA 1MLCB 1M2OA 2MKLC 2XTJE 4NRXA 4ZFOA 3CLWA 3WJLA 2BWDA 2J55A 4HUXB 2VM3A 1IBYA 4JM4L 2ZCLL 5C08B 3HG1B 2GHZA 1D5ZA 3MLRH 5T3ZL 2C7UA 3U30C 3QXVA 3P69A 3AXIA 2R2EB 2EDYA 2NY3D 1G1YA 3A6CH 3GPRB 2JCCA 5ETUA 3C6SA 4JG0L 1FN4B 3ULUD 3FTGA 5C08A 4LLYB 4P05A 2F6AA 5I74C 3VXRE 1AFB1 5ID1B 3C5ZC 1JGLL 3HOGA 5D2LF 1GCFA 1R3KB 4M5TA 4R5TA 4PJAE 5EO9A 3SKMB 4I5BA 4JHUA 1AMYA 4XPHL 4A67A 4F5CE 3IDIB 5DK0B 1DQQB 1EAJA 1ZGLP 1S5HA 5T5NG 4CSZA 2ZX5A 2LT9A 1S7WB 3ZYZA 5C0EB 2BX5A 3HS0B 4AT6B 2YGQA 4YIQB 2FR4B 1GYAA 4RGMB 3QP3A 1UB6A 3HLAA 2EABA 1UUSA 1Y17B 1SEBB 1H5BB 3DVFA 4JN2B 3KLAA 1KT2B 4JFTA 2R39A 3SODB 4WTZG 4W6WB 5AB9A 2IH3A 2BH0A 2XQBH 4A39A 1VGEH 2N4IA 5E1QA 2QVTA 3G04A 4KXCA 4ODWA 2NTSP 3BVWA 1QEWB 2D7TL 2ZCKL 2AQTA 1CMOA 4PJDF 1RIUH 1IBFA 3ZU8A 1BXUA 3S34L 1YEJL 4JO4H 4BFOA 4J8RA 2HJLA 1MWAL 4KI5D 1WSST 3Q1EA 1K6QH 5EZJB 4Z8FL 3CCHA 1GTNA 2KUTA 3U0PB 5IK3A 5EC2A 3SPJA 1A6PA 3ZE1E 1HC1A 4HALA 1KLUA 2YAPA 4X7DC 1A14L 2HUEA 1NL0H 3SKUD 1AKPA 1ILUA 2ADFL 4AQAB 1UM4H 4Z7AA 4X4XB 3TBVA 1TEGA 4WNQA 5HSFA 3P5HA 1E4HA 2XQBL 1A7RL 1QAWA 2IFFH 3D4YA 5KVMC 2Y6SD 3V0GA 1IL1B 1ASQA 5DQJA 5HJ3A 4N2NA 3VM5A 2R0KL 1HZLA 3S34H 2RAMA 1ACYL 4IHOA 4HZ1A 1NEPA 4HIIB 4N0YH 4ZSOB 2L7UA 2DKMA 1OAQH 4GMSH 4JM2A 4OLXL 5I1IH 1NUDA 5IB3A 2QEJA 4X7TA 1BFOA 4AVJA 2B59A 4M3JA 1EBPA 3OV6A 1KJ2A 1QSED 2CR0A 2EDNA 4HV8A 4JZOA 5TE4H 4HX1A 4AQOA 3PIQB 2Z31A 4OFDA 3UP1A 2R2BA 5CZRA 1QVOA 1AZRA 2V0AA 3VI4A 1KXQE 4L4JA 2E7LC 4YAQB 2VE6B 3CN4A 4MAUH 3VSQA 4LLUB 2BIQA 4BEIA 3IN2A 1UKMB 5L9DH 3CPUA 2J12B 3ALTA 5IIEB 4TQEH 4TRPH 4L8SC 1VB9A 1R9FA 1GW0A 1WK1A 4OLXH 5I1IL 1MFDH 3KPLA 2TSBA 4KKAD 4D94A 1WAEA 4HS6B 4WWKC 3SYOA 3KWWA 4NQXA 3MMEA 5E94A 5GISH 3UZVB 1U58A 2GY5A 2FX9L 2NY7L 2Y2TA 4IRSD 4RISL 2OYPA 4AWJC 4EBQL 5C0RH 1VAHA 1A6VH 3KYNA 3QUZA 1ETJA 4ZS7H 1XTLA 1F00I 5K9KA 2GCYB 3E80A 4L3EE 1A9EA 1N3NB 4O4YH 5H37A 3SDXB 3CC1A 3QDGB 4TLUA 1KCGA 1YMHB 1EAPB 2E59A 2FO4B 1YQVH 2AV7A 5SX5H 3S8FB 5DCCA 3D0LA 3V8CA 1AE6L 3WIHA 2HUHA 5E8EB 4ISVA 2RHEA 1TVBB 1KGCD 3MSPA 4PGDB 3RU8L 3ZRSA 4OVUA 2NY0C 4Y9CA 4BSVA 1CYWA 3OHXA 5L2KE 5L9DL 2XYBA 2Y7QA 3MOBL 1DY2A 5I1DA 1I8KA 3UACA 3WHE0 2VR4A 1U2HA 1BD2E 4HMCA 3SGDI 3EZJB 4BK8A 1DVTA 3NOIA 4Z7VA 5B3NA 4L05A 4MMYA 1EGGA 1UEYA 5DA4A 3RKPA 2OXHA 3WFCH 4PY8J 1UJ3C 3HPLB 4ZUTA 2Q8BH 2VDNH 1Q94A 2FH6A 3F12B 3FT2A 5INCB 5JW4N 2NY3B 1IEAA 1U2YA 5E8OA 3HUJB 4QAMB 4U0QB 3JTSB 4CAGA 1KUMA 3QO0A 4ENED 1JGIA 4BSVB 1YTTA 3WFBL 1YPOA 1VZIA 3CDGF 3VGHA 3QFJD 1URZA 1YNTB 4C4BA 4PGZA 4S2SB 2FO4A 3CHXA 5AAWC 1YJDH 4X4KA 2PLTA 3UBUA 1NCAH 4OLWL 4NCC1 4F8LA 4TOYH 3DKHA 4ONGH 1NFDA 4F2ME 4KZDL 4JPKH 2R29A 4K5OA 4JO2H 5FA4A 4NQEE 4NC0B 2OJEA 1J8RA 3MMEB 3KWWB 5E94B 4OIBA 5K59E 2VDLL 1LNUB 1KCWA 4LHUA 2AJUH 4JFPA 5B1JC 5FR3A 2X4QA 3ZTNH 1CFSB 1MCNA 1EZVY 4NNYB 3Q48A 5T3XL 4IOIB 5F7DB 3U6XS 2E9JA 1G9ML 1UKMA 3P0YL 4RDQF 4HXAH 2AQSA 1FO0L 2WLIA 3NSXA 4AK2A 4I9XA 7PAZA 4AJVA 3HI6H 3UO1L 4UTAH 4BCZA 4HLJA 1NCAL 4Z7UF 3WFZA 1K4CB 2C3XA 2PCXA 2CIKA 3UERA 5I6KA 1Q4NX 4DOHE 5FDYA 2B59B 1J18A 3BOVA 2VLLA 3VFTB 4F33B 3RJOA 2C9XA 2ZONA 2Y6SC 3POCA 4PJ8B 4DZBA 5J5EA 3HB3D 3D0VA 2QPSA 4IGBA 4CKVX 4XTRD 4GP5B 5I1HH 1L9PA 1MHHA 2WJ5A 4FFZA 1MHPL 3UO8B 1YMME 1NCCH 3LZRA 2BNUA 4JFED 1LDPL 4JFXA 4PHXA 1PJWA 1WFOA 1F90L 2W9DH 4JG5A 5IVOA 1HHHB 2F74B 4N3UA 5TQ0L 4JFHD 2NW2B 2LU5A 3CIQA 1KDIA 2I32A 4LAJH 4YSRA 4G6AD 3U0PA 1S7RB 5T1LD 5JQ6L 1ES0B 3JWDH 4P3DB 2OS7A 1OSZA 1AGDB 4QRTA 4P8QA 1QFHA 3MXWH 2F7PA 1F6AB 2DYSB 3PHQA 4JZNA 1L6XA 4N2KA 4MQTB 3IBEA 3TFKC 4AQ1B 5CGMA 5KJRL 4QXGL 3L3DA 3MCKA 2KYIA 4HA1A 3V0WH 3ISWA 2NLJB 3HFMH 3GSUB 3V6ZA 1NCCL 4XVSH 2Z35A 3NA4A 4YMPA 3MUZ1 3AS0A 2NY0B 4PJFF 2VJ8A 1B0RB 4DF9A 1HOEA 1DBKL 5LG1A 1URLA 2FATL 4D8OA 3APMA 3B56A 3BSZL 5M62A 3WJJC 3IJEA 3AC0A 4CC1A 4K3GA 1HEZB 1VGKB 4ONFL 5JQ6H 2BXZA 4TS6A 1RZPA 1U8HA 5DD6A 2PCPB 4RQQA 2IBGA 1KSRA 4PYHA 4L8DB 2WNGA 1J1XH 5IQ7H 4P57B 5H2BB 3ZDZB 4KMTH 4M6NL 5CD5C 3QG7L 3LHAA 3FSWA 2ZKMX 3H9ZA 2DB8A 4Z7VF 4DT2A 2AJ3B 1S7VB 5C86A 3V4PB 1DVXA 3BZEA 4B27A 2EO1A 1J05A 4G6ML 3QK0A 4FQCH 4Y8DC 3HE6A 3RWDA 2GSIA 5HYFA 2DDQH 1LTXA 5FYJD 1FN4A 3I6LE 4L4TE 1F3JA 2ZSWA 2VDKH 3L2MA 2HFEA 2E56A 1PZ2A 4K8RH 4ACPA 3EOAA 2I7SA 2DEXX 4Q58C 2XSKA 3GXDA 2E9GA 2XV0A 2N7SA 4NM8L 1SZNA 3D4CA 2VXVH 2OKMA 2E3VA 5DHXB 4CN6A 4NJ9L 1TOXA 4OJFL 2CJ3A 3BGAA 3IMUA 3QBTB 1OZ7A 4RMTA 4FLOA 1K8IA 2J8UF 2H41A 2NNFA 1DQIA 5EU3B 3U48A 2N1TE 2Z7YA 3NPSC 4U33A 4A7VA 5FO8A 3CPLB 1KV7A 4CRPA 3L3IB 4U1SA 3VWKB 5IB2A 2UWEA 3N06B 1JXDA 3QNZA 5AUMA 3SGEI 2ADIA 2I5YH 3DX4A 3BX7C 2ZF8A 3I02A 2NZIA 3QS3A 5HY9B 4P04A 1SDDB 1PSKH 3BKML 4PVLA 5FV1L 4RWYL 4HFWA 1FORH 3RS1A 2GSMB 3Q3GB 1PFOA 3TTYA 4JGNA 1MIEL 4CL7A 1T7VA 4RMWA 5FKPB 2EXYC 2W95A 3N6YA 5FWQA 5LO7A 3IDNA 2XFGB 1CUOA 1D5MB 1AFVL 1J1OH 3IDJB 2RQ8A 3ARFD 3KDPB 5SWZD 1XX9C 2BOLA 3K6NA 3VXSE 5JW4M 4HLZH 4MNQD 2VXQL 3AUVA 3C5JB 5EBMB 1D5BA 1JHTB 1U8NA 4HT1L 1P5VA 4U1NB 1TIUA 3BKCL 4XVTH 1NDTA 2VERA 1HJBC 4P5MB 1X5HA 1AZUA 1PSKL 1RCYA 3D07A 4ILDA 4WIQA 1IKFL 1QSZA 1RDO1 1JSYA 5KG9A 4XR8C 4ANKA 4KNSA 2RALA 4J4PA 2LS8A 1JCKA 4X4ZA 3U9PL 4X5RA 3VFWB 3BCDA 1T8DA 4V1DA 5FLVA 1NOLA 3BPOB 4YSEA 5EOCL 2Q20A 4PJDA 2DQHH 4GAFB 5I24A 1BX2B 5E1HB 2Q86A 3BPLB 4NIKB 2WQRA 3T1WA 1DE4A 5K1JA 1OAKL 4Z3GA 2XJLA 2ZXGA 1DBJL 3OKNB 4PS7A 3SDDC 3L95A 2IANE 4HS3A 2OYLA 4Y4FA 2CRMA 4ODHH 5DMKB 2K6ZA 4RDBA 1BPVA 2DL2A 4PJBA 1N19A 3CC5B 4DESA 4G6FD 1NKGA 1KIRA 1XD0A 1UWEL 4JR9H 3UP6A 1KXTA 5A6MA 2BVTA 2QTEA 3RVUC 5J11B 5KVEE 3DVIA 2IPTL 5C0FB 2EE6A 4PJAF 3L1OL 2X88A 5CSBA 4NLHA 1NAKL 4PJXE 1B6DA 3B2DC 3JUZA 3O4LE 2P48B 4CN1A 2YPLE 4FE9A 1XF5A 2FJHB 5C9JB 1MHEA 1W6LA 2CA3A 4W9CC 4OVVA 2NYYD 4PRIA 5C6TL 2R29H 3LH9A 3EGSB 5GS1B 1O6SB 5DJ0A 3LN9A 5AZ2H 1ZVSB 4ZD3L 1LWHA 1UWEH 4JR9L 3B2VL 5BUAA 3Q13A 3VH8B 4R7DB 3ZO9A 4TM9A 5D1QB 1KXQA 3T77B 1BAFH 3KJ4B 3HZVA 3RFZC 1XGUA 4GG6F 4PRPB 2P8MA 4IOPB 2WYHA 3UIYA 1G0YR 1IBBA 3HAEH 1QI5A 3LKRA 4FTDA 5B1BB 3CV5A 1E9OA 3LMJH 1VKXB 3L3KB 2B20A 4H7VA 3DTXA 3UG3A 2P80D 3C60A 5C6TH 4AUJA 5SWZB 2HYMA 5JIDA 2CJUL 3VRLE 1UWGH 3TT3L 5IMMB 4Q52A 5MEPA 4ALAL 2Y1VA 1JV2A 5GHWL 2O1AA 3FYIB 4MLIA 4I0CC 1JZ5A 4ZOAA 3C5SA 1PW3A 3OC5A 1S8DB 3LRKA 2LHAA 5DUBA 4KVCL 3GPSA 3FRPA 5JIQA 4PTTB 4GI9A 4JFZH 3RVTD 4MJ5A 2P24B 3ABKB 3HE7D 4L3EB 5FO7A 2GEQA 2I9TB 3RQ3A 4NUGH 3MNMA 3MUGB 4A2LA 4ZMWA 1IGML 3ZL4L 4ZMZA 3L6FB 4P9HH 3VWKD 1HH9B 5D7LE 1E30A 4Z9KB 1VFBB 3S5YA 3TA4D 4HHAA 2ZP8A 5D9SB 2GY7B 3ARGD 1IM3B 4XNZB 3WLBA 1AXSB 2VXTH 3FB6B 1F97A 1IT9L 1KPVA 2Y22A 4CC4A 3L4XA 4OB5L 2OFQA 3SDYH 1V05A 4Y2DB 3DO7A 2EIJB 1DQDH 2Q9OA 4ZQTA 4X83A 2A4EA 4FMKA 4YDMA 3G6JB 1IC5L 2FQFA 2F1EA 1JRHL 3UTOA 4KV5F 3R8BB 1KBGL 4GXUM 1KELL 3QWRA 5IQNA 3RJDA 3WFDL 2WWMC 3OG6B 3W0WA 2ENYA 5HGDB 1MRFH 1JV2B 2BVEA 3JTTB 3CSYA 5C0AA 4MMXA 4MJ4A 2CGZA 5FFRA 2VDPB 2BW5A 4OLUL 2LGNA 3MUUA 1A47A 1PAMA 3FCTB 3OM3B 4HUWA 4BKTC 2E76C 4KRNA 1WBXA 1P5UB 1I75A 1Z1WA 1XMWA 4NHUB 1UB5B 4X98B 1D9KD 4Y4HD 2ICES 2V9UA 1ZK5A 2HG5B 2DYPB 2FD6H 3CMOH 5E08H 1Q9OB 2OSLB 2WUBH 5TK2A 3T04D 5DSCB 1DJHA 4PFEA 4JRYD 1KG0C 1BMZA 4PJIE 4WJ5B 4P2QD 4Z95L 2ZNWA 4H88L 1KELH 4JO1L 4HZLA 4TUJA 2X1PA 4XP6L 2I60L 2AK4A 4NKDA 3AG3B 2X44D 2NSMA 3H9YA 2EVFA 4JQVC 1GJUA 1UXLA 3EGSA 3LB6C 4KZCA 5EU7C 4PRIB 5GS1A 5DRXB 5EBGA 5BOJA 3QNYB 5KYXA 2OTPA 2Z4QB 1IJKC 1FCGA 1NFAA 3MODH 4NZUL 1AKJA 1FO0B 2OMVA 2YMXH 1KTLB 1BVKB 2K0RA 2MMXA 3MLZH 3NCMA 3MJ7B 3JWDC 4JY4A 3ZKMC 1FO0A 3ZIMA 1MFMA 1J35B 5B7MA 1TF4A 3O8XD 1X6NA 1FL5A 2FX8H 1FNSH 2YPLB 4AGNA 3OB8A 1MELA 5I0VA 3ZZQA 1V8HA 4P23A 3MOAH 3TBBA 2IH8A 3ZDYF 4M1GA 5I1EL 1LMIA 3AWEA 3L5XL 2OX5B 2E47A 4L4TB 1AG6A 4R0LB 1H6FA 3V6OC 3IXTA 5JUEH 2K4WA 2Z91B 3FDWA 3NABL 3OAZH 3OHMB 4OZHF 1FA4A 4MJID 3O6KL 2OI9C 4CMMA 1E90A 3D18A 4X8XA 4D0BA 3PFUA 2WXFA 3CFNA 5AKVA 4GW4A 2CMRH 2FX8L 3ES6B 4OBRA 3VFOB 1ZEAH 1SY6A 2XT1B 5PAZA 4IBSA 2BRRH 3ESOA 5L8LB 1MDTA 3JTTA 1RZQA 2EE9A 3C22A 4YOKA 1HI6B 1E4XI 2CGRH 2XY1A 4Y4HA 5J1AA 1SLXA 4Q9CA 1HWHB 1L7IH 4PP2A 4FG2A 3NZHH 1A4JB 3IKKA 3W82A 3N42F 3L2NA 4X9HA 2DD8L 3OWEA 1LK3L 5D1QC 3UTZA 5E1IA 1N0LB 3K91A 3VFGH 4FZ8L 1BYPA 5J12C 3QDAA 4PRAA 1OV8A 1WC7A 3B83A 4DSYA 4FGMA 3QUYC 4UT6H 3DRTB 5LBGA 1LO2L 3ARBB 5E2WH 3RDTC 5DWUH 3FKUS 2COVD 3TTSA 2ALWA 4ORGA 1R0AH 5JW3H 3FSZA 4Z78B 4AKPA 4HS8H 1FLTX 2OMTA 3CFIC 3EBIA 1QA9A 4ZX5A 4NO2B 3LNDA 4FQXA 4FNTA 3D39B 1UUNA 2WY3B 1YEHL 1XDTT 1OAYH 3EYFA 5IV2A 4JCMA 4UT7H 1HCFX 2QSQA 1J88A 3B2XA 4Y7OC 3S35X 4EBQH 3VWKA 4M1DL 3WN6A 1D5RA 4AZUA 4D9RE 1LK3H 2X2UA 1M7DB 3C5SB 2MCPH 3TCLB 3QPXH 5KSBA 3BJ91 4NKQB 1ZE3H 3QPQC 4FL4C 1K5WA 3ZGIA 4XGZB 1C12B 2NY2D 3QG6A 1CICC 1OCWH 3AVEA 5C8JA 3FUEA 2OJZL 3MV7E 4EN3B 3II3A 2QHRH 2R4RH 3TO4A 1I7RA 1J8HB 1MVYA 3H85A 1BVLB 4NP4L 3HB3C 1AGEB 3QI9D 4FXKC 2HFEB 1CU4L 4M8UA 3ILQD 4OUUB 3KL0A 3B6SA 1LM8V 1RUQH 4HWZB 5I71B 2ZZUT 4KK6D 2ORBL 5HHOB 5D93C 2KLRA 4LLQB 3RZCB 3WUWA 1CF1A 3LS4L 3QJZA 4C56D 5D7HA 1CB4A 4RGND 4M18A 2C9QA 3EH4B 4P2OD 2AJ3A 3MCG1 3MJWA 1KIUA 1OCWL 2D0GA 2BNRD 1Y18A 2OJZH 3HNSH 2CO1A 4LLDA 2Z1KA 5HHQA 1LEIB 2QGBA 3PQYE 3BYTA 1B4TA 1V5JA 1Q0YL 1C5CL 1YAZA 2VL5B 4XVJL 3VNZA 4X6CF 3AY4A 2NQ3A 3ZDXF 2YS4A 4C83B 4QHLB 1M7XA 2PO6C 4UAOC 5ESAB 4J5VA 4ZRWA 4F27A 5I30H 3MGAA 5TDNB 5E0FA 3KG5A 5C07A 1E9PB 3IRPX 4K71B 4YLIA 2QVMA 5CNHA 2NW3A 5ADPL 4AQ1A 3MKKA 1MNUH 1YNLH 1FF5A 5HI3C 1G9NH 3IJ7A 5IJVB 3RUGA 2K3HA 4S0TD 1REIA 3HC0A 1C5CH 2X4TB 1J0ZA 1MG2C 4K3HA 2XC8A 4U1LB 4XO3A 2XZQH 2VQUA 5EA0L 5K33A 1OP5H 3UBHA 1PG7L 4V1DB 2P8PB 5C7ZA 4LU5H 2XTJB 3CZKA 4M43L 4FOMA 4APQA 4Y88A 4KKNA 2H0EA 4R7XA 2JB6A 4TSBH 4O2CA 4ZS6C 2PO6A 4PVMA 3LQZB 4R4BB 4R3SB 3JXAA 4JKWA 4ZNCD 4JLRA 4BFRA 4BQBA 1MNUL 1YNLL 5C2UB 2JIXB 4M6ML 1F6LL 1BJ1J 3IFOB 4M7JL 4H8WL 4UZSA 5FOBB 2PPCA 1D5BB 5AL8A 2HRLA 2XPGA 4JKNA 1OGTB 2CO7A 5J9PB 5HXMA 3L4WA 1U93A 3IGLA 4ZK8A 2C3HA 1WE5A 5E9DB 4HWBA 1MN4A 3M07A 4ZBJA 1YPUA 3RL1A 1N7MH 2BSRB 4Y1SA 5FF6A 1UD6A 1GJWA 1FL3A 3GHBL 3RIAF 4KZVA 5IQOA 1XFPA 3T0EB 3CHPA 2GJ6E 4KJWD 1MRCH 3FUKA 3VMNA 3HFML 2LQRA 3D3VD 5G4MA 4OZIE 4QOKE 2YXWA 1Q38A 4ZYKB 2BP8A 3V8OA 4MJ6B 3QQ9C 3T3AA 4WHYH 5IB2B 3L3IA 2ZAHA 4P23C 4U1SB 4X5WA 1SNRA 2YBRB 2PW2A 3AQZA 4ZO6A 3Q05A 1T2QH 2DLEA 4XE0A 5EU3A 2F5AH 2ZG3A 4XNQA 1U8LB 4P07A 5AVQB 5T1LB 4RAUA 1WISA 3BVTA 1OZ7B 3GUFA 3RAJH 4ONFH 3VPPA 3SGJC 3RLSA 4ACTA 2DMGA 4MMZA 4JL2A 3FFCA 1PCSA 4HVBA 2ZT9C 1T83A 2A9CA 4LOEA 2QGDA 3F58H 4YHYC 3CN0A 1KYFA 3S8GB 5A16A 4WU7A 1TNMA 5GZNA 1JDAA 1QNIA 1C08A 3NP4A 5HBBA 2YQ2A 2P7TB 2WVVA 3RVWD 5IHZA 4G5ZH 3S88H 4JDEA 2A6IB 3H3PH 4XRCB 2W1NA 5EU4A 3IGUA 2WBXA 1F4YH 3V2AR 2ZXAA 3BZEB 3ETSA 4G2AA 1ZLWK 3LZFH 1SL5A 4BA0A 1MFEL 1S7VA 1DYZA 1CR9H 4L3CB 1QO3A 4YHNB 3GMQA 2YWZA 2VISA 1OAXL 5F89B 3L17A 3CDZA 4JFOA 2ISDA 1KB5A 2ORJA 5C0JB 3VW3H 4GKNB 3E6FA 3GJFK 1DV8A 5BUPA 4A6YL 1L9TA 3QDGA 4NBXB 4LSSL 2B2XL 2CLRB 4K4KA 1IGYA 4G5ZL 3TJHD 4ZZKA 4F37K 4YXLL 2W9EH 3V6FB 5J0BA 2ICCA 4Z3HA 4ZQKB 2YRZA 1OWWA 2JKIS 2R4SH 3PWJB 2WCSA 4U4IA 4GI0A 4JM4H 4HS6A 3GSUA 3V6ZB 1I1AA 3NDZE 5ESQA 2ZX8A 1CE1H 1J11A 1PZCA 3TXAA 4OI8A 1K3IA 3US9A 3NIDE 4HUNB 4TN9A 5ABZA 4PIRF 3REWB 4XH2A 4Z76B 3RWGB 4HCRA 4RRPA 1E9QB 5KUMA 3BEVA 3IMBA 1JK8A 4LNRB 3T4AA 3VXSD 1F58L 1CD0A 4EJ1C 3DV6B 2VR8A 2R2BB 4OZHE 2VXQH 4HT1H 2F74A 3Q8EA 3W57A 3U30B 5FYJE 4MRBA 3FMGH 2XV6B 4O02A 3MV9E 3VFMA 1J0KA 3LKPA 4N0UB 5EOQL 3IKCB 5IY5B 1WZ1L 2GSGB 2ICWA 1L6PA 3MFGB 2Y36H 4RZCB 1UD2A 5DC9B 1FI8C 2EILB 2NT0A 6FABH 5C7XL 5HJ3B 5ANMB 3G84A 4S1RH 5F1OB 4EIZC 4PJ8A 4DZBB 1Q9LA 4MCNA 5G5DA 3GMNB 3A0OA 5KSUA 2XWTB 5KVGH 2AMUA 3NSFA 4N0UA 1A9BA 3GPEA 2NNAB 3HBQA 2O26U 4HH8A 5GS2D 2D8KA 3DX0A 2K6WA 2X2HA 3FQYA 1L5GA 1VGEL 2DZEA 3C60C 1TLKA 2WSDA 5LQBH 1X5ZA 5KS9A 4CUCA 1F45A 1RIUL 4KKAC 1G5AA 3CWGA 1NMAH 2XN1A 3K1KC 4RGNE 2UX6A 3PWPE 3A3YB 2ESVE 4OCRL 4EVNB 4I9WD 3K8MA 1B0GB 1R19A 5E8NB 4FCHA 4NQEA 4JFPB 4OLZL 5I8KL 1I82A 3QORC 3K1DA 4N2GA 3CFCH 4XAKD 1ZD6A 4XHJC 4GQPH 3PQYD 1IV8A 3TEYA 3TNMA 4YSSA 2DLGA 2V5TA 3HMWL 4P4KA 1ZHNA 4ZFGL 2ZYHA 1BZ7B 2AQQA 4MBOA 4PW3A 4U7MA 2BCKB 2OYKA 3ATBA 3HLAB 1A7RH 3WUWG 1VFMA 2IG2L 1QFWI 2QFPA 4QOKA 5MENA 1KDJA 3LJ3A 3VD1A 1SYVA 5B4MD 3S96A 1S7WA 1YNTA 1LGVA 1RZ7L 2VDLB 2ZYSA 4LEXH 5AZ2L 1M9SA 2J3SA 3LPGA 4JFOB 3CDZB 4N0YL 5DYOA 2NX5B 3LZOA 1UD5A 5D1ZA 5MERB 3TC9A 5GS0D 3FU3A 4K07A 5J13B 4OLZH 3FCSB 3FONB 3QZMA 4HEPG 1X44A 5AAMA 3UFIA 5AW9B 3KPPA 2OXHB 5CJ5A 2YMTA 2XHNA 4LEEA 3VXOA 1R3KA 3D12B 2ZXWB 1ORSB 3PPEA 3SPGA 3ARDD 1FZMB 1Z7JA 3P2TA 3V5DB 3KPTA 2HVBA 3CK0L 3FK3A 3GPRA 3DJSA 3ZHGD 1NMCC 2AV7B 3UYPB 2UUDK 3DWTA 3ECBA 4L1BA 2XXCB 3CX2A 4O58H 1BP3B 1Y6MR 5EBLA 4NB7A 4N2MA 3FFCB 4NZFA 2AXGB 3MBXL 4ZFOB 4F15B 3SO5A 2LU7A 1JZJA 5EULV 4RGOH 4H1LA 3OX8B 4UTBA 4ZS7L 1XEUA 2FYYA 1BLNB 3CFEB 3HKZA 4ALAC 1WTGT 1LLAA 2GK0B 1WS7A 3AREB 3BP6A 2IDSA 3BSGA 3BMWA 5DD1H 3WE6B 1X5GA 2KDGA 2AITA 3N43B 4HSCX 5IIEA 5DJ2A 1I1YB 1AGCA 3IU4L 4UNVA 3NFSH 4NQED 2ZUTA 4HKJA 2EINB 3FPXA 1AD0B 4PRBB 7PCYA 1MCFA 3PWPA 4X8JB 1T0NA 2F8VA 2VLME 3VQ1C 1LP9E 1JHLH 1YC7A 4JRFA 3UAFA 3WFHA 3WIFA 4L8CB 5C6WH 4AV4A 3RGBA 2DQDH 3FT4A 1X5IA 2FBJL 3MUY1 4FTVD 3KAAA 4HIEA 1JZ8A 3HPJA 3WFCL 1F02I 4OZHB 5CF3A 4QRPA 3TBTA 1HN1A 5C3LD 4PVNA 2FEJA 4GKZA 2WIIA 1U0QA 1FUNA 5I8OL 4YBQC 3U1PA 5J9PA 5BJTA 3DI3B 4BGDA 2Z64C 2P28B 4MXWH 4IHOB 1RZIB 1RJCA 1R5VB 1OB0A 1MRFL 5FGCE 3DHPA 5JR1L 3AROA 4YDVA 4AENB 4JANB 3FB8B 1HHJB 4V11A 5GGQH 1SEQH 3EYOA 3N0AA 1W8OA 2Z4TA 2NY5C 2X6UA 5GS0L 2PO6B 3QJRB 2EIZB 2EACA 4YS4A 5CFAA 3UTSA 3K4DA 5T5NF 2J88H 1M7IB 3Q7JA 4K3JH 3TH4T 3PP3K 3CFDA 4H26A 5CS7A 3WY3A 5LNGA 1NFIA 2X4OA 5GZOA 1A25A 1DJZA 1QSFE 3FYEB 1CDIA 3ULUL 5CP7A 4JO1H 4AENA 4R2GD 1KWVA 4HXAL 1MI5D 1FSKC 2UUDH 2AQPA 1UFGA 5SWQA 4KMLB 1MCRA 4Y5YB 1AYRA 3I3DA 3K4AA 4OFYA 1PLAA 4MRCA 1OP3K 3SCMB 5KVEH 4PSPA 2CK0H 4BFKA 1S3KH 2R0ZL 4YSAA 8FABA 2YD8A 5C07B 2VLJB 3EG9B 2AI0H 2XYCA 4KNUA 4XPBL 5AOMA 1YXJA 3IKRA 1CTNA 4XVOA 1LE9A 2AMGA 1OZTG 4NZTH 3BUTA 3KVDD 1DBMH 1OLLA 4G9FE 3CVHA 5GGRA 5B3SB 1J5CA 3NJKA 5HDQL 4HKJB 4UT9H 4F20A 3BFWA 5DJ2B 1X4YA 2IADA 1QBLL 1LEIA 3L3GA 4LLDB 3QIBC 4J6KA 3AG4B 1WCBB 5DC2A 4G7RB 3V4PL 2WZPD 3S7GA 3FQWB 1BPLB 3IMWA 1RPQA 5IMKB 4JFHE 2OI9B 4NRYB 4BFNA 4H40A 4H1LB 1Z9SA 1NWOA 2FBOJ 1PWBA 2AXGA 4LLQA 1J9QA 5MEND 1NC2B 4KUCD 5DVPA 4WEBH 2Z8RA 1HOCA 2JCCB 5ETUB 2G0LA 3MNVB 4KY2A 1JP5A 4LCCA 5D71L 5F3FA 4MNHB 5DUMH 3VD2A 1I3GH 3BPLC 2JB5L 5D1ZD 4XXCA 5L4FA 5LXGL 2A5UA 1TO4A 2GJ6B 1I7RB 2P4AB 3P9MB 3B7YA 1NKRA 4PHZA 5J6SA 3FXIC 5D72H 3W38A 3WTTA 4EN3A 1NZRA 5IUCA 4A2EA 3A4EA 4A7TA 2IGLA 4NRXB 1C12A 2O4EA 3QB7C 3ULVE 3WE1A 5LKNA 2CK2A 4H0IA 1P4LB 2H2SD 3TCLA 1GYUA 3E6HA 3OKOA 4E0RA 1YEKL 2H2TB 5BXFB 1OGSA 4IMLB 1MCEA 1AHWA 4AEEA 4QHKJ 1VERA 3FT3B 3PDDA 5CSZB 2CXKA 1FJ1B 4M7LT 5F7YC 3TZVC 1A4BA 2YQGA 1DUYB 1U6AH 1BQLH 2C26A 1WZAA 2R23A 3CFQA 1X4XA 5SWSA 1HEJC 5FOJA 2PMZA 5BW7A 5INDB 4YC2B 1AAJA 4ZW8A 1QSEA 4PJEF 1PKQA 2CKBL 1NGWB 2OXGA 4P4KB 3ARWA 4UF7C 2JJTA 4ESKA 2TSAA 3BRGC 4F7EA 2WWKO 1IGIH 4R90L 3PAYA 4K55A 3O6FA 1JNNH 3BO8A 1KZD1 5EU7E 2DIAA 4ORZC 1FHNA 1MJUH 2VDKL 3FFOA 3O2VL 1J9RA 4AYMC 1ZVYA 5CGYC 5F1SA 2ORKA 2X6AA 3QRFM 1A3LL 1S9XA 2XOTA 4JGJA 5D7IB 1EJ6A 2IVFC 4IK6A 1ZLSL 4HLEA 4DGVL 2DQIL 2HZHA 2QV4A 4NSKB 4M7ZB 3RBSA 5FHBL 3W9DA 5LHDA 4PRDA 1VFAB 4L3AA 3EO1B 2FWOB 4LBAA 5HTSA 1FDLL 1KJVB 4GW5A 4XBGB 3VFOA 4QMEA 4AM0B 2QL1A 2OCFD 3ZDWA 4LO9A 2G5BA 4LLWB 3C6LA 4Y9GA 3VH8G 3WNPA 1NGYB 4WR9A 1GPOL 4P2YA 4D3CL 1XR9B 1JNLH 1OE1A 2H0PA 1A3LH 1HCVA 2MWCA 2A6DA 1T03H 1KOEA 3VFMB 3L3OC 5HI5D 2DWXA 2WINA 4HJTA 3HNSL 5BVJA 1E2VA 4XMWA 1AIFA 4FYRA 5DEJA 3VE0A 4BE5A 2VMDA 2R1XB 1ZK9A 3RKDD 3U9UB 5KBKA 5DWPA 4KVNH 4ZAKB 1TLMA 4FQPA 3AREC 5FGBC 2V17H 1MI5A 2B9BA 3NJXA 3BAXA 4MKTA 4I77H 3MHZA 4LASL 4KTYA 4LOUC 3P7HA 1XL4A 2R69H 3REWA 4ZXBC 2ZSVA 1ORQA 1T04B 3MU3A 1PEWA 1JNLL 3K72B 3C6LC 1N2RB 1J5HA 3MRCA 1L7TL 1Q1JL 2W60B 3HRZA 2VGLM 3GSVA 2J1ZA 4KJYB 2EJ1A 5IW1A 3FRPG 4GG8B 2B4CC 1TZIB 1XXFC 4BDVA 4NZJA 1LXMA 3T6ZA 1FAIL 5EC1B 3M9ZA 1G87A 1HL4A 4AQEB 1BM3L 4LSRL 4Z77B 3IVKB 1VZHA 4PJGF 2AK4B 1B90A 4NKDB 4WWKA 4JB9L 2WO4A 4JHZA 1IGYB 4HJJL 5AYQA 1HFUA 3ATAA 1OF2A 4WFFD 3BDWB 4MYPA 3VG0H 3TIEB 3BUYA 4TPRL 1Q9WA 3D39E 4WSKA 2R69L 2BJML 4OQ1A 3CBJB 5F89A 2VISB 4C56E 3PDGA 4E9SA 2VO5A 4QY8B 3HBPA 5DLML 1G9MC 4PJEB 3H9SA 2NY4D 2EKJA 3CDCA 1B3IA 4RSYA 1WF5A 5KUKA 3P5IA 2HKHL 3V5KA 1OSPL 5FA3A 1FAIH 3UJTH 1EEZB 3BKJH 3NK3A 3C6LD 1K9JA 2RCSH 3HZYB 2X7LA 5IHZB 4GS7C 1NGZA 5HGGS 3VTMA 2ZOUA 4DP9X 3KYKH 2PYFA 1U0OA 2RIKA 1U91A 3VG0L 1UGNA 2IH1A 1RDI1 4AK8A 4AYFB 3MGTA 4RETB 4JFEA 5KS9F 2FGWL 3S5LB 3EHBD 3IMTA 5I17A 4OF5A 4HK0A 4QRSA 3MNWB 4GAYA 1AXSA 1LWJA 1MRCL 1IM3A 2B0SL 4EKJA 1WV7T 1UM6L 5FHAL 1AY1H 4QRUB 3RTLA 1LHZA 4E5XB 3WO4C 3LEYL 1VF5C 3I3EA 3PWUB 3TWCL 2XN9D 4XWOC 4E52A 1G7QA 1Z9OA 3TV3L 3QUXD 1BJ8A 5B1KA 4L3EA 5FO7B 1KIPB 1IE4A 1KFAL 4NCC2 1HJCA 4ZYKA 3T0DA 2FNWA 3TX4A 3FQUB 3SGKC 4MD5A 2W5PA 3GI8L 5DD5L 3O9WB 4NWTH 3HI1B 2P5WB 3VXME 4B7LA 3EF4A 1FG9C 1W9XA 3GS4A 2BWQA 4DGIH 4Z7UA 4X8CA 1AY1L 2D7QA 1WIOA 4LQ1A 2E86A 1A0QL 5IVZA 5AB2A 4O9HH 1ADWA 3JSSA 4MX7B 3QJFA 1T1WB 1OSYA 3B2UD 3JZ7A 4FULA 4O5LH 4PRNA 3TN0C 4A2DA 4AGOA 5CBAB 5KZCB 1KFAH 3ELAT 3T0XA 4UINL 5IB4A 1E27A 1XGQB 2DKUA 2GUOB 4PJFE 5IROC 3T77A 5LNEA 3QI9A 4R3SA 2K45A 3GEWB 2CHNA 1F4XH 4PIBA 1OAXH 2NY5H 3U0TB 4ZOCA 3WMPA 3HE6D 4M8QB 4POZD 2QDVA 4QO1A 1BNLA 2QMJA 3MBEC 3VXNB 4WO4B 4WO4C 4C56A 3BP7B 4L0YA 4AQ1C 3P40A 1WFJA 3V52L 1LWRA 1IC5H 3H0TA 1A6WL 1N70A 4O5LL 4E41B 4S0UA 3PHOB 1KBGH 2VDRB 2RR3A 1E4KA 5HHPB 4ODUA 3SKJL 2VRQA 4UQ9A 5B8CA 5KSAC 3QEUA 2GJRA 4OZIA 4OUOA 2E7MA 1EA9C 1I9RL 3C09B 3C6EA 4OIFA 1QUNB 1KCLA 4B41A 2Q7AA 2BXYA 2O6CA 1R13A 2JI3A 1KIRB 5E4IA 3GI9L 4BZ2L 1IGFH 1ITCA 1DP0A 1ZT7B 5HDBF 3QUXA 4WHTB 4HXBH 3OMIB 4QXWA 3DURA 3TYGL 3NFPA 4ZETA 1XCWA 4ODUB 2BP0A 4GRLB 1SXSA 2BVYA 3LH2L 2WQUA 3P5DA 3H0TB 3AS1A 2CR6A 2WLMA 1F5WA 3KXFA 4HPHA 1RJYA 3OKEA 1Q9KA 2DTMH 4MA7H 5DC0A 3REVB 3ZDYE 3VCLB 2XIBA 2FWUA 1KB9J 2AJZA 4NT6A 1AQDB 1YAIA 5D7JB 2CA4A 3ROLB 3QA3A 3BJLA 3QQ3B 4IS6A 3MROB 4MJIE 1L0PA 3WKYA 1OP4A 4UDTB 4J6QA 1IX2A 3BP5B 4L37A 3R7RA 5I71C 3WUWB 3WXWH 2A9DA 3VXTB 1CL7H 2VB5A 2DWEA 1F56A 4PB9L 1WWBX 1OCZB 4X7CC 5A3ID 1EBAA 1EDYA 2DICA 1TKWB 3NCCB 1UD4A 3OKLB 3WO4B 2D7MA 4PRNB 5CBAA 1SN0A 1OPGH 3VG9B 4G11A 3WY4A 5JNYA 1TTBA 2LFGA 3PGDB 1CICB 2E7BA 1FNSL 2YXFA 4P99A 5IVZB 4DZ8A 3GBDA 4ZMYA 2EH7L 2N7BA 3IDJA 4D2NA 4UAOB 4OKDA 2NY1B 3PUCA 1WIUA 2QKIC 4V1DE 1V7NL 5HPOA 5FKPA 5MHSD 4XXCC 5IT2H 2JJSC 1FFQA 4B9FA 4E9QA 5LG6A 2VDMB 1CL7I 1PZBA 1KWKA 2Y72A 3GFUA 1R24B 3WN5A 3KS0J 3VXQA 1ZGLA 3FU0A 3MLWH 5GZNC 2GW5A 2Q3ZA 43CAA 2YUVA 1H3GA 2ADIB 3IRCA 2J8UA 2QPEB 1YDPB 4PDCA 2A38A 4KKCC 1EZVX 4QTFA 1JMZA 3BAWA 1H19A 4JJHA 4QCIB 5CJOH 4FFWC 4U6VH 2P46B 2PKDA 1O7SA 2V4LA 2ZCKH 2BRRL 4XXDA 1HHIB 2PXYA 1YEJH 4U49A 3FUFA 1BDYA 2WANA 3W39A 5I75C 2ZWZA 2CDGA 2JKWA 4JQIH 3G6DH 1CICA 1XB8A 1R3IH 3GLEA 1IFHH 3P0GB 2YSSA 3EOAB 5FLUA 2ILLA 4EO5A 1SRDA 2MPAH 2HSIA 3VRJB 1R5WA 1RP8A 3U2JA 5D5MB 3U4KA 3DBZA 2ED6A 3OKLA 3S35H 2WXIA 1UM4L 3K2UH 1N59B 1CXHA 1WZMA 3SOBL 3OPZL 4UILL 5IJDC 3QEHB 2H6UA 1RZGB 4MZ3A 2D31A 1SFDA 2OTUB 2ICEB 5IBLD 4N38A 2CUAA 4YHPA 3KPQA 2H1PL 3B9KB 3QA3B 3QQ3A 5HDBB 3TEXA 4UOZA 5C2BL 3QC6X 2OX9A 5DJCB 4GW4B 1QZNA 2GT9B 2WTRB 3W56A 4GS7B 4XB3A 1WGOA 3GD1C 4WHCA 2FUQA 3BH9B 2WZ6A 5C0CA 1IKNC 1Q9WB 3DX6B 2Q2LA 4CMMB 3Q2CA 3T4YA 4FFZL 1TTFA 4RGOL 4Z7OF 4GRLA 2BP0B 1OF2B 4PEEA 4ZFFB 2MCMA 2F2HA 4PJCA 4QXUH 5BVPH 5TDPA 4YLCA 2OX5A 3ZQXA 3TH3T 1PW9A 1IIKA 3G6AB 4OF0A 3IU4H 3U36A 4S0HA 1CXEA 4XNXH 2IALA 3E0GA 1JJUA 4LVNB 1K85A 1M56B 3GSVB 3QXDA 3NIFB 4J3OH 1TXKA 4P4KD 4ODTH 5JO5B 3RWEA 1F3RB 5HHPA 2XZAH 1F6AA 4IBQA 4YFLI 4GMTL 4ZUUA 4XCFH 4U1GC 1YEIH 4P3DA 3SHSA 5C0GA 1AHKA 1JWMA 3C08H 5CKAA 5C0RL 1IC7L 1H9VA 4XN8A 4UIKL 2R9HD 2WM0A 4FCAA 3C75A 3LS4H 4GBXD 5AW8B 3P7FA 5E5MB 5AAWA 4K0OA 5HYQA 1V27A 3HZ3A 5DMGC 1JNJA 3VXNA 4QO1B 1YEFH 5HJGA 1WPCA 5ACZB 3FN9A 1TYJA 2HFGH 4FXKB 3L8QA 3ILPA 5BVJB 4BSWB 1ZHKA 4YK4C 3KPSD 3M1CA 3S36X 3GSNB 3LKSB 1PY4A 3PAKA 4WJ5A 1SN5A 1RDK1 2XZAL 3KXFD 1MJ8H 1XWVA 5GGRY 3DETC 4RMUA 4QI3A 1V55B 3RHWF