1E5UI

Nmr representative structure of intimin-190 (int190) from enteropathogenic e. coli
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
187
structure length
187
Chain Sequence
TLTIDDGNIEIVGTGVKGKLPTVWLQYGQVNLKASGGNGKYTWRSANPAIASVDASSGQVTLKEKGTTTISVISSDNQTATYTIATPNSLIVPNMSKRVTYNDAVNTCKNFGGKLPSSQNELENVFKAWGAANKYEYYKSSQTIISWVQQTAQDAKSGVASTYDLVKQNPLNNIKASESNAYATCVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Recognition of the Translocated Intimin Receptor (Tir) by Intimin from Enteropathogenic E. Coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Intimin
molecule keywords INTIMIN
total genus 27
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2000-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF07979 Intimin_C Intimin C-type lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1e5uI01
3.10.100.10 Alpha Beta Roll Mannose-Binding Protein A; Chain A Mannose-Binding Protein A, subunit A 1e5uI02
2E3XC 3GPRC 3FF7C 3P5IA 2RICA 1AFB1 3BX4B 3ZHGD 3PAQA 1G1SA 2E3XB 1HTNA 4AK8A 4N35A 2VRPB 4KMB1 1QO3C 1IODB 1E5UI 2XR6A 4J6NA 4M18A 1ESLA 1WMZA 2ORKA 4WCOA 1E87A 3K7BA 1X2WB 1YXJA 1MPUA 1RDL1 1HYRA 5B1XA 1EGGA 2BPEA 1WK1A 4N38A 3FD4A 1KWZA 4WR9A 1UKMA 1FIHA 3UBUA 1C3AA 4C9FA 3WBPA 1U0NB 4YMDA 4S0UA 1YPQA 2RIEA 1B08A 2N40A 2M94A 1RJHA 3WHDA 4N34A 3PBFA 2OS9A 3G8LA 3VLGA 1GZ2A 4QKGA 4ZESA 4J6JA 1V7PA 1KMB1 2MOGA 2I83A 3PAKA 1RDO1 1BCH1 1UEXA 3WH3A 1KOEA 4UXMA 1KCGA 3GPRD 4WREA 4HU8A 1LITA 1FVUB 1V4LB 1P4LD 3FF9A 1SB2B 1CWVA 3ALTA 1B6EA 3WH2A 1BYFA 2ZWKA 4WRFA 4G9AA 4CAJA 1O7BT 1U0NC 4N32A 4QKHA 2RIAA 1IODA 2MQGA 4EZMG 1KWTA 1QDDA 2IT6A 3CDGE 1YPOA 2BPDA 2BPHA 2N7SA 4LU5A 1IJKC 1RDI1 1X2TB 1J34A 3WWKB 4M1GA 4WRCA 1C3AB 3P5FA 2OX8A 3WBQA 4ZRWA 2ZQKA 3BDWA 4GJ0A 1SL5A 1BCJ1 1R13A 1KWYA 3KQGA 1G1QA 1YPUA 4GKOG 3CCKA 2KV3A 2LS8A 3WWKC 1OZ7A 4ZRVA 1DV8A 3G84A 2XR5A 3P5HA 1WT9A 3WSRA 3IKQA 2RIBA 1JA3A 1UMRA 3M9ZA 1R14A 1RTM1 1V4LA 1TN3A 1TLGA 1DY0A 3WWKA 1RDK1 2VUVA 4WQQA 2MH4A 1KWVA 3G8KA 1J35B 3BX4A 1E8IA 3RS1A 1SL6A 1Y17B 2C6UA 1JWIA 3T3AA 1F00I 4J6MA 5F2QA 1HQ8A 1MUQA 1KZA1 3VYKA 1G1RA 1J34B 3GPRB 2RIDA 3P7FA 1H8UA 1SB2A 4LQFA 1UV0A 1KWXA 4WUWA 1DY1A 1AFD1 2OX9A 3VPPA 3IKRA 1IXXA 1YXKA 2YHFA 3IKNA 3BDWB 1K9IA 1KZD1 1KX0A 3ALUA 5FFSA 2MTIA 1JZNA 2AFPA 3GPRA 4KI1E 1F02I 3C22A 3P7GA 1U0OB 4J6PA 3DBZA 1K9JA 1U0OA 1T8DA 1SL4A 4N37A 1JWIB 1TDQB 1X2WA 3HUPA 1RDM1 1MSBA 1Y17A 4AQ1C 1KG0C 1KX1A 5M62A 5FFRA 1FIFA 1T8CA 4IOPB 1DY2A 2BRSA 3G81A 4M17A 2VRPA 1P1ZD 2CL8A 3P5EA 4ZETA 4YLIA 4MTHA 4N33A 4PDCA 2GGXA 1AFA1 4PP8A 1BV4A 1WT9B 3CADA 2ORJA 4C16A 4CSYA 1BJ3A 3ALSA 1KZC1 2ZIBA 4G96A 2H2RA 1UOSA 5J6GG 1KZE1 1PW9A 4AQ1A 1RDN1 1KWUA 2IT5A 4IOPA 2L04A 3P7HA 3NCWA 1KWWA 3L9JC 4WUXA 1EGIA 4J6QA 1G1TA 5KTHA 3VYJA 1WMYA 1BUUA 4QKJA 3C8JA 5B1WA 4UWWA 3CDGF 5B1RA 4N36A 3G83A 1IXXB 1X2TA 1YTTA 4QKIA 3UBUB 3WBRA 4J6LA 1UMRC 1J35A 3ZHGA 1OZ7B 1FVUA 1BJ3B 3IKPA 2H2TB 4GJXA 4KZVA 2GO0A 3P5DA 1RDJ1 1FM5A 1HUPA 1XPHA 5K8YA 4KZWA 5FFTA 1O7CT 4DN8A 2PY2A 4E52A 1XARA 1UEXB 3CFWA 3FF8C 2VUZA 3P5GA 4J6KA 2GGUA 2MSBA 1V7PB 2KMB1 3KMB1 1KZB1 3C8KD 4GI0A 1IJKB 1PWBA 5KTIA 1UKMB 3NCXA 4GK1A 1BNLA 2PF5A 5LGKE 1UOSB 3PARA
chains in the Genus database with same CATH superfamily
1QX1A 2D3VA 2K9FB 3APDA 1MG3C 1EDQA 4GSXA 4K8RD 5DLMH 3SD2A 3HPLA 5I1AB 3IGAB 3VFRA 5I28A 1RY7B 3SDAB 5KWYC 4AQZA 2PCFA 1SY6A 1UKTA 3CE1A 4O2EA 4MCZB 3HN8A 4JZOB 3AADB 1T2QL 1YJDL 5EN3A 1K85A 4Z7NE 2HRPL 3QJUB 4Y4KA 4HJJL 7TAAA 1FGVH 2J8HA 3MLWL 2HSIA 4AEIL 5JPMA 3F05A 1DBJL 1HVXA 2D7NA 4NN5B 4QRTB 2J57A 3BZDA 3F84A 1ADQL 1TU2A 3H7LA 1T5XA 5KW9L 1EZVX 2WB1A 3WJLC 4RSVA 5BZWA 2NLJA 5IIEB 3TEZA 3MREB 4Q6IC 1IGYB 5H2BB 4HUVA 4H5SB 2ZUQC 2VIRB 1KUMA 1XXDC 1U33A 2EUXA 3GMQB 3RBGA 1X7TA 3QDMD 2Z1PA 1A1MB 5BMFH 1IFHH 4BZ2L 5J8OA 1DQTA 3MNVB 1MFMA 5HYQB 3F7VA 3MJWA 4S11A 1GGUA 1RLWA 1SEBA 1L9OA 1YPQA 2OL3H 4Z7WA 1R0AH 3GSWB 2RIEA 3OKOB 1XH1A 2ZWYA 1SMOA 3C8HA 3MV8B 1HQ4A 3CHQA 4AQEA 3WNIA 4H13C 3UTTB 4YPGA 4N34A 4AMXA 4L5FL 4XAWH 1MLBA 4J5VA 1DEDA 2EE3A 4NPYB 1YYCA 1NTDA 4R7DA 1BZDA 1G7QA 1IGMH 3F5WB 3PWUA 5EU7E 3D4GA 3EFDH 1AVAA 1QUNA 1LQBC 1ERNA 1KTJA 2ED9A 2J8UB 4FABL 1MAJA 1MY7A 2WYTA 1EEYA 3C09C 5GS0C 2Q1EA 5F89B 1EFXD 5CLWA 4KV5F 1JNHA 2W94A 2HKHH 3KVQA 3D25B 3FHEA 3OG6B 4FZEL 4H40A 3VG0L 1MHPL 4GAJL 2WZ0A 4MNQD 5KS9B 1ITCA 1J12A 2GB2A 3MA9H 4JVWA 3CZLA 5FO9B 4KXZH 2WYZA 4F91B 1HSBB 3I84A 4NKIL 3AQXA 3NZ8A 3GJEA 3HHMA 4WRFA 4OZIE 1JWSA 3S35X 4FXGB 4P9HL 3HHRB 1XH3A 3DX6A 2DQJH 2MQGA 5FUZL 4UTBA 4HKBA 4ZW7A 1LM8V 1K6QH 1VB9A 3C9NB 4Q9BA 2PWFA 2Q10A 3P0VL 2EICA 2IH1A 1XF5B 4JFEA 1ASOA 1HHJB 2WCPA 1DJWA 1L6XA 2ROYA 2UXFA 2WQUA 3I85A 4K94L 3IJEB 4XP4L 3HS9A 4CNIB 3V5DA 2B39A 3K6IA 4QTIH 3GI9H 1YYLH 4XB8A 3QDHA 3TZVC 4GAGH 1IIIA 4N2NA 4R7DB 4DIXA 2P5WA 4FQQA 2NYZA 4MA7H 4W68A 3X12A 5A2JH 5LWYH 4DTGL 2IWGA 4P5TD 2YPLA 1OCWL 3VVVA 5DQJB 1AGFA 1JXFA 2P7TB 4TYUA 3Q5TA 1YMHB 4XPFL 3UAJA 5JW4Q 4HZAA 1NGQH 4FQQB 3LS5L 3SDAC 5IFJB 4R4BA 4IHBA 1SOQA 4YXLL 3ZE1E 1OAYL 1WBZA 3FO9A 5GGSY 5J6HB 2FLBT 4LSRL 43CAA 4QTFA 3BSZH 2X2YA 3T8XA 4Q14A 3HI1A 3SDDA 1HNYA 1DVSA 4HKZB 5C07A 4XMLH 2JXMB 1R3LB 3Q5YA 3JTSA 4G6ML 2XN9A 1QQDB 3VFNB 1KG0B 1E4KA 5DWUL 5C0NC 1IGFH 3T8MA 5GGQL 4UAOB 4WWOA 5T5FA 3G6JA 1XH3B 2OXHB 4S1DC 3LQAL 3EJTA 5DWPA 3U0TB 4LPVA 3R8BB 1Q1JH 2HRPH 3ZT7A 1MNUL 4L2YA 3UBXA 4Z7OB 1ANUA 2BIPA 1A5FH 5IM7B 5GZND 1TXKA 3RTLA 2APVA 3QZWB 4NRYB 1XEUA 1LO5A 4P04A 3BH9B 1AHWA 1J0IA 4BFRA 2AJ3A 3FOMA 2E4TA 3S37H 1SYSA 3E8VA 1KULA 1FZKB 1OTTC 1XCXA 2HJLB 5FIEA 4DVBB 1A66A 3CK0H 3LMJL 1KTBA 2VLME 4KO6A 4LU5H 2EACA 3ZW3A 1KIPA 5L4JA 5EOCJ 4QIRA 4O02L 2J1KA 4FFWC 3ZTNL 1J8SA 4CKVX 4LLDA 5TPWL 1M1XB 2DF3A 1GZQB 4JFOA 4FG0A 1AY1H 3ARUA 4NDMA 4ODHH 4WQQA 4D8OA 3MGTA 1F86A 5C07E 5C0JB 2VUYA 1OE3A 4PN6A 5L6YL 4QGTA 4R90L 5JUEL 4A2HA 3VWJC 4AL8L 3K4DA 2XN1A 3L3IA 3RWCB 3QG6A 1E8IA 4YDIH 4YAQB 3NZUA 4HT1H 2CDEA 4EUPG 1TQBB 1VACB 6TAAA 3HR6A 1URIA 3L2MA 2V2TA 1IFRA 5BZZA 5EOCL 4YHYB 3KLDA 2OJEA 3BESR 4ETQA 3FONB 5DVOA 3KM1A 5TDNB 3L4YA 4FQLH 1NSNL 1AGDA 2OBGA 2FDBP 1A9BA 3EYFB 5CMAA 4QY8B 4J3TA 1DJGA 4P46A 3RWJA 4YPGB 3QORC 4Z7NB 3C8KB 3GNML 1P7QD 5FYKL 1KYOK 4Y4FB 3HCVB 5DURB 1W0VA 2DWEB 3AS0A 2AVGA 3EF7A 1WYJA 3B7SA 3GI8H 1B0RB 3EOTH 4Z3JA 3K7UA 3HZMA 4Y1SA 2WM0A 5F0JB 4JKPL 1A9VA 3B2XA 2IH8A 4HKJB 3WV0A 1N0XL 1JPEA 5BPPA 3HZKB 4BWUA 4L4TA 1O7DE 4OF7A 4BK5C 4BFNA 4L3CB 1A6UH 5LAXB 1UB5A 5GGUB 1ACCA 2ERJB 3TF7C 1P5VB 1R3IH 3UJJL 3VXRE 3IKRA 1IXXA 3LKOB 2BVPA 2AK4D 4P2OB 1A1NB 2BMKA 3LNDA 3TYGL 3U6RA 3L3GA 3EJZC 5C7XL 2OYPA 3SJVA 2DLGA 3JVGA 1C9SA 5SV4A 2MTIA 3MV9D 3NN8B 1R9FA 2AFPA 3B2VL 4S2SB 2NX5E 4NQEB 1EEZA 1KJ2H 2XN9D 3OKLA 3D39E 3NJVA 4AQOA 5EZOH 2O5ZH 5HDOA 4E9TA 3VSVA 3FCSA 2JIXB 5AENA 4MCNA 2G75A 1K8DA 5F3FA 1LMIA 2QKIB 3SGKC 1F1AA 3THMH 4LCYA 4C59B 3D69A 5ID0B 1GOHA 1PD0A 43C9A 2UZYA 3RILA 2YPLB 3DX4A 1BF8A 1Y1DA 5LCVL 2F74A 1MJUL 1BQLH 2WXPA 1A4BA 5FKAA 4JZNB 4J3OG 4UU9A 1KX1A 4FJZA 5DD3L 5A6MA 1FORL 5AVXB 4PJEB 5IUCA 5TQ0L 3L1OH 4BZ1H 4FLSA 1MWAB 2CLZA 4NOBA 4M9PA 5AAWC 2EXWD 2YEVB 4TS6A 5GRUH 3RJOA 2A3TA 4MAUL 5KN5A 1D5ZA 1DJYA 3KEDA 1OP3K 5CFAA 4DOHE 4UDTB 5CUSH 5DHVA 4Q52A 4AJ0A 4UTAL 4P46D 3L5IA 3FT2A 4GIAA 1ZLWK 2A73B 2RCSL 3BSGA 5F7KC 3K8KA 4JHBA 2KQNA 1JRHL 2FIKA 4Y4FC 2XWTA 1RJCA 3DVGA 5FYKE 4ADIA 4N0CC 4R96A 2Q6WA 3KBPA 2OCJA 3DMMA 3UOAB 3ZKXB 4BK5A 1D9KB 5B7MA 1UXMA 3DHMA 4RMWA 2V8MA 1EO7A 1XF3A 3HBQA 3IU3B 2VC2L 4JW3A 4M1CD 4Y19D 9PCYA 1Z5LB 5I66A 4RRPG 1JCKA 3LH8A 4F8PA 2BW5A 1UOSA 4AQ1A 4HJUA 3KDMA 4MDJB 3MC0A 4FD0A 3FQUB 4ZX6A 4U1NB 1NGZB 1AE6H 3QR2A 1KWUA 4IHOB 1X5MA 2HMIC 1BM7A 5F6IB 3DO7B 3QUYA 1M6OB 3CLEH 4U1JA 2MOQA 3WBDA 4JMNA 1MEXL 5FFLA 5JHLH 1GTFA 2CAKA 1MZZA 2GIXA 3HE7A 2QEJA 3N50A 1EGIA 3WIAA 4YSUA 4OLZL 1IAIH 1MFAH 4EUPA 3L54A 2X4RB 5ICUA 4KU1A 5BJTB 1QAWA 4JY5L 5AQ0A 5CILL 1FYTE 4IRJD 4NRXB 3HE7B 4K2UL 4Z3HA 3QZLA 5EZPA 4QKJA 2QQNH 3LYRA 3D4YA 4JB9L 3C2AL 1OPGH 1XF1A 1TQCC 3CFNA 3S35H 3T1FA 1YEEL 5C7ZA 3P9WB 5F7LB 4ZUTB 4ZOCA 5E8EB 1QD0A 4P3CL 4P5KA 4WFEE 5DC4B 3R4DA 1CFMA 4GYBA 4YDNA 2VZVA 4LIQE 4J3VA 3MNWB 5JDSA 3VXMA 4PI0A 1WFOA 5CZKA 1BAWA 1X9UA 2I60L 2OTWB 4KZVA 4LL1A 1HOEA 3W11C 5BS0D 3OPZL 2FBJL 3WYRA 1RDJ1 3TH2T 2ZUYA 4UNIA 4EEEA 4IBUA 4XWGH 4WU7A 3CZEA 4PJ8D 1C12B 2YGQA 1GZPA 3RTQC 3VWJD 1JGLL 2WTPA 25C8L 1E65A 5DDHA 5ITBL 1IUZA 4P49A 1U92B 4HULB 3SPHA 1R34A 2O5XL 3M45A 2K7PA 3MJ7B 4HF5L 4OFPA 4ZW5A 4TUKH 2B08A 4XC1H 2MPAL 1VKXA 4J6KA 3AT0A 1PCSA 2ZYSA 1E43A 5JW4M 2W8CA 4QHLA 4U3SB 4OSUL 4PBWD 1V7PB 2KMB1 5H8DA 4AK1A 4YDMA 1WS8A 4MCMA 1JF1A 2GUYA 4PJBA 3RAJH 4C54A 2APXA 1XZ0B 4LRNL 3EJCA 2DJ4A 5KTIA 1M3JA 5BV7C 4U1GB 5GJSH 1ACYH 5DD3H 1NUFA 3PWPB 1XZWA 4Y7MA 3L7EB 3UX9B 3DSNB 4HIEB 4PJ8A 1MKFA 2XQ0A 4P48A 4JKKA 1JHTA 1NLBH 3OJDA 1Y07A 5ALBH 1QLFB 4J1UB 1WBYB 4QD2E 2NUTB 1QR4A 1TLKA 5D7IF 4HUNB 1RURH 2GI7A 1H19A 1QLEL 4Y19B 4F5CA 5J7CC 1EFXB 4KFZC 1S9VB 5EBWB 2CKBH 5BO0D 3P77B 4OZFA 3CPLA 4PCYA 4HOXA 4HCIA 3UBXI 1DE4B 4FZ8L 2AXGB 3U7WL 1YC8A 3JYBA 2W65B 3UMNA 3TNMA 4N3UA 3BVTA 5TDPB 4PJBE 3FBKA 3X11A 4AE0A 5DD0H 1IODB 4LVEA 4ZFZB 3E1F1 1S3KH 4XAKD 1E5UI 3LS4L 4G1MA 2F8VA 4UB0H 3OJMB 2V9UA 1OEZW 4BBWA 1R19A 4HWBA 1CYWA 5CLTA 1CR9L 4AIOA 2H0FA 2IG2H 2DZEA 4PS7A 4JUTA 4N8PA 3BQUA 3IXAA 3UDWC 4PB9H 2B9BA 1KY7A 1XGRA 1KLFB 1MW1A 1C5CL 3FCTA 1RDL1 4Q9CA 1K9TA 4LE8A 3U79A 4U6XA 3QUYC 4M5ZH 4MVBD 5G5DA 5T3ZE 4OIFA 1MFCH 1JN6B 2ICWJ 2WINB 2HLFC 3QXAA 1C1EH 5DD5L 5EN2B 5E6UB 3CFJA 1U21A 4F8QA 2WXQA 5E5MA 4JRFA 3MV9A 5L6YH 4KKLC 1HH9A 4WZ9A 2F8XC 1CYXA 3A4DA 1OAKL 4OUUA 1UGKA 1BHGA 4UM9D 4KNSA 1H8SA 3CXHK 3BWSA 1NEZB 3NA9H 3IGLA 2A77H 1CPUA 4Y19A 3VXTB 4APQC 4N2FA 4R84A 2E7LA 2A6KA 2NY4C 4PD4K 3PJLA 4CC4A 2YA1A 2C1PB 4UYPA 2R0KH 2DYPB 3KWVA 4J3OC 1CVRA 4EUPB 3EO9L 5E99L 3QQ3B 1PZBA 3BUTA 4PJ9A 3S3DB 3RWIA 4BK8A 4JM2B 4TPRH 1X3DA 4ZUUB 5LXGL 2O61A 3HE6A 4L4JA 5LNDA 3F7PC 4FQCH 2DLFH 3AUVA 4GQ9H 3O6LH 1BM3L 4EKJA 3E2HC 1XL4A 5IJCC 1KB5A 4N8VA 5D1ZI 2XFGB 1HJBC 4ZNEA 3TBYA 4ILDA 4ANXA 5KSBA 3T6QC 3GPRD 4FNQA 2ZPKH 4HU8A 1L5GA 1BW8A 1GGBL 4WUKL 1UM4L 1TQWA 2C1OA 3JWDH 4QXGL 4V11A 3UTTD 3GZQA 1EAOA 2K0RA 1KTRL 1P6FA 3EGDB 4ZMXA 4Y9BA 5A1AA 1WS7A 1P5VA 3V6BR 2X09A 1JG9A 3KPOB 1A1OB 1OE2A 3R0NA 4K7PY 2GAZB 1BP3B 5BS0A 2VYRE 4HF5H 4YHIB 1DQQB 4EN2A 4JZOA 3ALPA 3IFOA 4KTGA 2HUHA 1CMOA 4ETQB 1O9ZA 1TTFA 2ZX8A 1EIBA 3SDXA 3QYMA 2B20A 1KTCA 3TJPA 5KYXA 4PI2A 2CHWA 3DLQR 3SGEI 3LXAA 4D9LH 2N7SA 1ZT7B 1AQDB 4UDUB 1D6VH 1FF5A 3QDGD 4H20H 3VFTA 1U30A 1URLA 4MKMA 1WFUA 3FB6B 3PHQB 4K7PL 4D9RD 1OWWA 1C08B 4NQQA 3O3EB 1BZ7A 3QXUA 1YUHB 2CIKA 3MXWL 1JF1B 4GQRA 2JKSA 4HU2A 5E1AA 3V6FA 4L8SB 4NGHH 4ZX4A 5KOMC 5TFSL 1NLBL 2Z4QB 4PJ5E 5EIIB 5CMAB 3BAKA 5DUJA 4YGVB 5AW4B 5DS8A 1IC7H 3WBQA 5DQ9B 1R5VA 3GSNA 5E4IA 1GS8A 2GC4C 2NY7H 4X42A 1XFPA 4PG2C 3W11D 3EO0B 5HDQL 1DQVA 4TLKA 3SDXE 3HC0A 3QQ9C 1FORH 1Z3GH 4HIHA 1VJSA 4PTTB 4Q6IB 5F0MB 2WSKA 1AHWC 4NN7C 4HX1B 4OKDA 1NAKL 5E00B 2ICEB 4XHJD 5IMLA 4K3DL 4F92B 1XIWD 1FGVL 4Q4EA 3A6CL 4FYSA 2PETA 3LPWA 3PFQA 4JAMB 3BQUC 1CI3M 3AJ7A 1Y0LB 3K6FA 1Q9LA 4RZCA 1D2PA 2Y7OA 3MVSA 1M05B 5E8NA 3BKCH 4GAAA 3VFNA 3VSQA 1C1EL 3VA6A 4R0LB 2X4SB 4I9WD 5CZVL 3D6GA 1GKEA 1QI3A 4UT7L 6PCYA 3EBIA 3II1A 3MLZL 1TZOA 4GG8B 5DI8B 4KY2A 2A99A 1U8IB 1XAUA 1G6RA 5LCVA 2JIXD 4GBXC 3VFGL 5FO7A 4A7TA 4E2OA 4U1HA 1QNIA 5EU4B 1CG9A 2YJQA 4LHUA 1XT5A 2K6WA 3BFQG 4GKNA 1XF5A 4JG5A 5DMKA 4PVMA 3OAYH 4JBSA 1C8QA 2WO3B 4Q9QH 2A38A 2NY1B 2O6FA 4J23A 1HE7A 5F0LB 2DQDH 4BFGA 4NNPH 3U1PA 1M56B 4YHNA 5JHLL 1UEYA 4FFZH 4TPRL 4AIZB 1QBML 3AS1A 5IW1B 4Z23A 5KSAA 4IDJL 5DZ9A 5FA3B 5F1NA 2PNDA 1PTZA 1MWOA 2AHIA 1U8HA 1C5BH 3QEUA 1RPQA 5B4MD 2CDEB 5DFVC 3NRQA 3DJZA 3VFMB 5IHZB 4PRPE 5FO2A 1E4JA 4I5BA 2CXKA 2N56A 5E08L 1PJ9A 2WVVA 5JW5A 5K39A 5IESH 4N2EA 5FKPB 2Q0ZX 5IHWA 4J3OF 5T33L 1ES0A 4QXGH 2V9QA 1PGRB 2O5NA 3K71A 1DDTA 2OW6A 1IEAA 3LRKA 4LSPH 1WHOA 3QEQE 1IKFL 1K3ZA 4X4XB 2WN2A 4TRPH 3UTSB 5KBDA 3GXIA 4I0CC 1XH0A 4HPYL 4Y4FA 3EOBA 5KBKA 2DICA 2EE2A 4XO5A 1BZ9A 1IQDA 3BDXA 4OB5L 3JVGC 4FKHA 3IRPX 1SZNA 3BLBA 2CH8A 5IB1B 1F90L 2ZG2A 4F7EA 1I75A 5A2FA 1YEJH 3HZMB 5DFTA 2Y0SA 4RNRB 1I7UA 5JIMA 2HFGH 1DZ0A 2FNBA 2VZUA 4QF1B 4QRRB 5D6DA 1MF2L 5DEGB 1M2VB 2AW2A 5E8OA 4MB5A 2EYTB 1KX0A 4D3CH 1YYLL 1BVZA 5FFSA 3BPNB 4XB7A 1NGWB 1S5IL 2AJXH 3ARWA 1P4LB 3C5SB 4YL9A 4LDEB 3T2OA 4DKEH 3HNVH 2E7CA 3B2UD 4MMXC 3CZFA 2I32A 3OXRA 5C8JB 4Y1AA 1UZGA 2UV3A 1NGWA 3MJ9H 5SWSB 2NXYB 5E4EB 4BFOA 3U7YH 2WCGA 4P23D 2A6IB 2ZXWB 4KRPC 1VGEL 4UINH 4UDUA 3ROLA 1JP5A 3Q6FA 2XKNA 2Y5QA 3Q01A 2DD8L 3SO3B 2R2BA 4DN3H 5JDJA 2G2RA 3QEQD 2F8OA 3FU3A 4XZUB 2YAOA 2XQYK 4AXWB 4HJ1A 2QSCL 4LOVA 3IETA 5GJSL 4K5OA 2C34A 5JZ7D 3SE3C 2A5UA 1KELL 5C0BB 4ANKA 1HNFA 4ZMOA 5CINH 3TYFA 1FH5H 3CDYA 2NZ9C 1T6WA 4AWJC 4W9LC 4ELMA 2PO6C 2Z9TA 2Y1AA 3FQ2A 3VXSA 4KTYA 3QCVL 3BUBA 3WFEL 5EOTA 1RURL 4WV1B 2NTFB 2HG0A 3ZKND 3MODH 2GGXA 4KZ0A 1G5GA 2WK2A 3HNSL 5EOTB 3O3DA 4ZFFB 4AV4A 3SOTA 3ZSSA 1ZCRA 3QNFA 1D5IH 4G7YL 1FC1A 1WE5A 1YNKL 4K94C 4J6RH 1G9NC 4UB0L 1X7QB 4LCWB 1YEGL 2JTDA 5AOMA 1C5DB 2ZIBA 2DQUH 4WWKC 4E41B 1TYRA 4G96A 3VX0A 5D9SA 1EHXA 4HIIB 3ETSA 1BEXA 3NG5A 2YEZB 4H8VA 4NUJB 3WMPA 1TTAA 2CJSA 4I9WE 1RHHA 1SYVA 2OPCA 3GSOB 4HWBL 5GSRB 3OBAA 4MJ4A 5C9KA 4AEHH 2VGLM 8FABA 4JFOB 5D1QE 4LVOC 3GLZA 3P7HA 4PBDA 2HFFA 4XE5B 1RJYB 1RUML 3GXDA 1OLLA 3PL6A 4NFDA 4FADA 3MCKB 5FF6B 2ILLA 3SQBA 5B39G 5FXCH 3TA3C 5HGHB 5CEZE 1AGCB 4OFYA 5C0GA 1NCCL 5DJAB 5F7HA 5GS0D 4M1GH 5HDBE 4EI6A 3GI8L 5DQJA 4KKCC 1XIWC 1ZE3C 1NINA 1ZLUK 2F0CA 4B0MB 1MDTA 5IB3B 4OF6A 2KLTA 2XVBA 3D39A 4K3EL 4GW1B 4I9XA 1FNEB 1WZMA 4L29A 3DRTA 5BVPL 1SDDB 3NRPA 2NR6C 2BCKA 4M8QA 4HX1A 2TSAA 2ZSVB 4IIQB 3VFWA 1FWXA 2Z7ZA 1AIFB 3MV8D 3CX5J 4S1SL 4F58H 3DETD 1LDPL 1OTSC 3F3HA 5DMJB 1FNSH 1NC2D 4CAGA 2TRYA 1Q1PA 3ZE0E 2BVQB 4TOYH 1M7XA 1AIFA 1WAAA 3G6JB 5CSBA 2Z34A 5KS9A 4OLVH 3IFNH 4DPCX 3ARTA 4XMWA 5E8NB 5JPNB 3EXLA 4ZMZA 1JUFB 5BRZE 4GBXD 4RWYL 2KQMA 3P4MA 4GBXB 3QUZD 3WO3B 4R7XA 2X7LB 5DYOB 5CEZD 1K4CB 1L0PA 1MG2C 3T04D 1BD2D 3BGMB 1FNGA 4FX5A 3BEWA 1BJ1J 1KIRB 4G8IB 4XXCA 5AEAA 2VUZA 2CBPA 2EVIA 5GS1C 2PPCA 4FQXB 3MFFA 1CBVH 4HALA 2GHZA 2JMRA 4Y5VA 4ZS6D 2I9TA 1P4IL 1OB0A 4WEMB 2OS7A 5C8JA 1JBJA 5PAZA 3K5SA 3ISWA 3QAQA 2DRUA 4X8GA 4Y4KD 1SM3H 2CXGA 3GMRB 1UA3A 1WCBA 5D1XA 3T3PF 3U0PA 2R56L 4LK4A 2XKNB 2UY7A 3DX8A 5TE4H 1GGTA 1LO4H 5L4IA 1EV2E 1TTRA 2AXJA 2QL1A 1T1ZA 4L4VD 3BVDB 2EILB 5L2KB 4HV8B 3LTVA 4FQPA 3HI6L 4XZUA 2WWKT 4XNZB 4EDWH 1OM3L 2W0PA 3GPRC 1XB3A 3K6SA 1MHEA 4GRWH 2HRHA 1NCTA 3KPOA 2MNWA 4LSRH 1KCBA 1OE1A 2CD0A 1DEEA 1I9JH 3QCUL 3WXVL 3HNSH 4QYOB 3B9KD 1T5XB 4NI3A 2BHYA 4RRPM 3H2PA 4N9OB 3ZLQC 3LZOA 4XMXA 4ODWA 3TWYA 2H4EA 4MXVE 3CNKA 3VG9B 4B96A 1KYDA 4ZAKD 4JFFA 3NCJH 4X98A 1OSZA 1T3FB 3ARDA 2VR3A 3GMLA 4MA1C 4OCXL 5A6LA 4G80B 1U2YA 1OCCB 1FJ1B 3AQZA 4NKMB 1J86A 2YLKA 4H88H 3RVTC 1HYRA 2OMBA 4J4PA 2VITB 3MLYH 1E40A 1ACXA 2YGNA 4GPVA 1BWMA 5AUMB 5D1XB 1BQHA 2R4SL 4YFEA 2IBGA 4K23H 2WWNA 4WDIA 4GH7B 3T6VA 5GS0H 4AV5A 1D5BB 1BZQK 2DAVA 3GHEL 2WWOA 3O2WL 4IYKA 5DUPL 4ODVH 3O11A 5HHOB 3RPIA 3GMNA 4KJPC 1H3GA 3UACA 5CLYA 1N9PA 5L8JB 1HKFA 3GTTA 1N6QH 2A6IA 2A9NH 2JI1A 5IW6A 2BIIA 5T1MB 3T0EE 3FSWA 3HN5A 1Z9PA 1S7QA 2CUIA 1F56A 2DI7A 5I5MA 1I85C 1ILUA 2EXYD 3UC0H 2R39A 4G59C 2ZZUT 1RUAL 5HGDA 2JELH 4PY8I 2Y2YA 3KPSE 4MB3A 3WY1A 1ML0A 4M6NH 1ZA3B 5ANMB 3LRHA 4X7SL 4ZTPL 3T09A 5A3ID 1X9QA 3DX9A 2E6JA 3N43F 5I8OL 4Y4HA 2X4TA 1K72A 4FXKA 4GKSA 3V5KB 5JA8B 2AJZB 4AG4H 3PXJA 1KGUA 3BUQA 3QIWA 1EGJH 3BE1L 3E6HA 2KT6A 2DWTA 3SPVA 3EZJB 5EBWA 2W07A 3NPZB 2VOTA 4GG8A 4NUQA 5AVWB 1CWVA 1G0YR 5GS1B 5HYJA 4TQ8A 3GJEB 1JZIA 1MJ8H 2Z7UA 4K8RL 5JMRA 1JZ6A 4FTVA 3QG7L 4X6EA 3GDBA 5DZOA 1U8LB 4XRCA 4LSVL 5EO0A 2WOBA 3OGOE 5T3XL 4N6RA 4TQHA 2HKFL 4H26A 1LK2B 1EXUB 3C6EA 2OMWA 4OIIL 5B38A 1TLMA 2FX8H 4J1UA 1IEBB 1GHFH 2V5TA 3HFMH 3QC5X 4N68A 4G2AA 4OLUH 3PDOA 4OKVA 1WWCA 1DZBA 1N3NA 1M57B 4WUUE 2AXFB 3NIFE 4XBPB 1P5UC 1YPZE 4W6XB 2NRDA 4L1SA 3ARFB 1SGKA 5FYJH 3D3VB 3TVMA 4JQXC 4QLRA 1PY0A 3JVFC 3O4LD 4G43B 4HFWA 5D7IA 2G5RA 3HZ3A 5I1CH 2EDXA 1UB6A 1NCJA 3PQYB 1GL4B 3PXLA 3EJYD 5DRNA 5IVZB 3WJJA 1C3AB 2YKKA 3DOSA 1TZIB 2JH2A 3CVDA 4WHYH 4N3TA 3NQIA 2IALA 1J8HE 5EZJA 2BOCA 2OQJA 3OB8A 3W3BA 1IVLA 2RMNA 5D1ZB 3WG7B 3QCUH 2VT0A 4HJ0D 5DJ8B 2Q76A 3OR7A 4JQVA 4R8WL 2IGFL 4OVUA 5T1LB 4ZNEE 2Z7WA 1ADWA 1RK7A 4LSQL 4Q8BA 4XX1G 4RAVB 5D1XD 3ULUF 2DM7A 2FTAA 1JK8A 1TQUA 3DYOA 3NCJL 5DGRA 4CRPA 1YO4A 2OTPA 3HG3A 1F4WH 2E7HA 3TZVB 3IDNA 5GGTH 3QQDA 5DMIL 4QYOA 3OWEA 2DIAA 1S78D 3EH4B 4MKTA 3AT9A 4LZKA 2BSTB 5D7IE 3TIDB 1WBXA 4JKMA 1I1AD 1G0XA 3EYSL 4N85A 3IDXH 2BFVH 1TN3A 4F93B 4NO2A 1SXNA 4FERA 5SWZE 2HPTA 4K23L 1QHPA 3EO1B 4AH2B 1CFSB 4XNXL 1PNDA 3GHEH 4W9FC 1RDK1 2XXMB 5EU3A 1HNGA 2G2RB 4FI7A 2VWEC 4F7PA 1MJJB 2ZNXA 5TDNA 2D73A 2DQUL 1OAKH 3UAJC 1GTNA 3MRHA 5J13C 1NFAA 2N0MA 4LPCA 5C97A 4X6DF 4B9CA 4JPVL 3RGVC 2WXJA 2C9UA 2OX5B 4HBCL 2FJGB 4TXVB 1P5UA 4GKLA 2CHDA 2CK2A 3NJJA 1BXVA 5IQLA 4N22A 3G04A 1AFVL 2ADIB 4N24A 3BC9A 5CCHE 4ZI8A 5EZLA 1RAMA 1ZT1A 1O7VA 4XXDB 4DHLA 1T03L 1NCNA 3RWGB 3EDDA 5E1QA 5L4MA 1BMGA 1X5IA 3P0YH 1ZS2A 4XNBA 2RHEA 5K1JA 4LCIH 1QUPA 3ZDYE 3DUSA 1UWYA 1EGJL 2D9CA 3SGJC 3WD5H 3KPSD 4U1LA 4EBQH 4WU7B 1XGTB 1P7QA 1FUNA 2V7NB 3EAKA 1V7NH 1ZEAL 3B9EA 5B3JE 2VW4A 3QFGA 5B7EA 1XGZA 5KVEL 4C56D 3NIFB 3R7RA 5F72S 3D85A 1JF6A 1YEFL 2WWMC 3CPLB 5M94B 5I1DB 3TWCH 5E4OA 5F44A 1WDAA 3SPVB 3JYCA 4EDXA 3G9AB 3B6SA 4S1SH 3ARGD 4ZUVB 3VPPA 4WKZA 3D85B 4W9ZA 2HZHA 5TDPA 2GFBB 4PH8A 3QUMH 3QRBA 2ZWLT 4MJIB 1KCRH 4BKSC 1W72B 3PS6A 2R29H 4XO9A 3IMSA 1IJ9A 3BWAB 2OR8A 3QCTL 4F5CE 1TTGA 2WBWB 3RHWK 5BVJB 3HBZA 2A9CA 2ODIA 1FGNH 2PYED 1UG9A 5IQMA 1JE6A 4GRMA 3FTVA 2EIZA 1E4XL 5D4QA 1E5YA 4YDKH 5SX4I 5CR8A 3QORA 3GRWH 3UMTA 3V6OC 2QFRA 3DPBA 5CIPH 2X6VA 5GJTL 3LIZA 3ARFA 4N0FA 5MHSD 1TZHA 2XBTA 4KMTL 2CRMA 4MFHA 3PAZA 3A67H 1JVKA 2GBAA 5D2LE 4G9FB 1ZLVK 1RDM1 3MUGA 2CLRB 3P69A 4FI8A 1IGCL 2J3SA 1YEKH 2OP4L 2MJWA 3MRLB 1DFXA 4FJYA 1K3IA 1IAKA 2V7HA 3A21A 1JNJA 2LHAA 3O6FA 1SHXA 4QRQB 2YD6A 4DGYH 2QT6A 1E9QA 3P4LA 2N7AA 5IOPB 4XCCH 1G7LB 1IV8A 5HYIA 3GMPA 3QJXA 4OGXH 5EA0L 3TO2A 1A5FL 4JFXA 5H35A 3KL3A 1JGEA 2HTKD 3RWHA 4D8PA 4WWKB 3NN8A 4HAFA 3BWUC 1RD6A 2UXTA 1FDLL 2OM5A 3ZRSA 2XWBA 4ALAH 2I9LB 4QMEA 1EBPA 4F8LA 4LLYB 3SE8H 5CCJA 1I7RA 3GRWA 3LZPA 3POHA 3LMJH 4PJAF 2Z35B 1AFA1 1I1CA 3OAZH 4QTHB 3FRUB 2DS4A 3ZE2E 1UWFA 1YNTA 4BXSV 5I8CB 4H8WL 4UQDA 4GIOA 3CSYB 1NEZG 3X13A 4JM0A 1WIPA 2A9MH 4W9DC 2Y2WA 1G7QB 4BA0A 1KJVA 2OR7A 1UJTA 3TIDA 1AZVA 5IB4A 4R0LC 3ABGA 1HI6B 2H0EA 1EUUA 2X05A 1OTTD 3LQZB 3NSYA 5C0EB 1DN0A 1DBBL 4X9GA 1PZCA 2YR3A 3PXHA 1G87A 4RQQA 3S2AA 1XGYH 4QRSA 5AVYB 1DVQA 2Q7YA 2Q8BH 4DQOL 4GW4A 1XSKA 4DO6A 1KTLB 5JW4N 3FB8A 3K2KA 3MGAA 3J7HA 4HWNA 3RPIB 1UQSA 3PWLB 3D85D 2C3GA 3IT8D 3BOVA 3OM3B 2P80A 5IBTH 1RIUH 5DRNB 2PYEA 1U8NB 3JBG7 3WE1A 3RY4A 3OZ9H 2WY3B 2AV7B 4BQBA 5E0FA 2CO4A 2JCCB 2NXZC 4DK6A 5DTFB 1FL6A 4E68A 2K70A 2R7EA 3T3ME 4WJG3 3OWRA 3JZ7A 1CDBA 1C16A 2NZIA 1FNFA 1YQVH 2A7BA 3CZGA 4LCUB 4QUOA 4XAWL 3G83A 1SMAA 3QJFB 4JKPH 5AL8A 5BZDA 1PPIA 4LNRB 4HJGB 4XPAL 4QKIA 2NQCA 4E42B 2WUBL 1AO7E 2IAAC 4B9KC 3WBRA 1DQKA 4JPIB 1P1VA 1XWVA 1UWXH 3BPCB 4FQCL 3HB3B 4PJ7F 1AHWB 5IV2A 1ZV9A 4AIXA 5KVFE 4HXBH 2FD6L 3WKPA 5D7JA 1Z9SA 2GO0A 4NN6B 1MAKA 1OARH 4NWUH 3WU1A 4F7TB 4AG4L 1JHLH 4N28A 1DVUA 1OF2A 2R4RL 4EZKA 2HAZA 4LOUC 3QPQD 5TK4A 5CHNB 5KYUB 3M1CA 1QNZH 3CV5A 2BNUA 1FNEA 5IHLB 4PYGA 2VISB 4NP9A 3CU7A 1WA2X 2E27L 4OZGA 4RIRA 3TA3A 1TENA 3G6JE 4K3HA 4U1MA 4E52A 4QY8A 1ZPUA 1IBZA 5KEZA 4WFFD 4HC1A 3G3LA 3RIAF 3BEVB 4PRIE 3GZOA 3AREC 1BLIA 4R4FL 5FK9B 1WAAE 5ECGA 2WUCL 5I1KL 3ZUNC 2BIMA 4RGMC 4XAKE 2AERT 3VXUE 2V0AA 3QHZL 1N5YL 3LDBB 5BRZA 1MQKL 4FNTA 2CRZA 5LO7A 3QXTA 2GIYA 3CHPA 4JY4B 2GY5A 2NNCA 2VCOA 4WI9A 4NX0A 3UAEA 4D9LL 3C5XA 2QSCH 1PWBA 1E2ZA 5AAMA 5ID0A 4ZUWB 5F7FA 2EDWA 4JS7A 3WE6B 5D1QD 1QO3A 1DUZB 2JQAA 4GK1A 4U0RB 3NJNA 3HVDA 1BNLA 3MLVH 4QHKJ 4XCCL 4MA3B 5GIRA 1HDMB 1ZT4A 2EXYC 4JEGB 4LLUA 4YO0B 5IVXE 5ITFA 3D69B 4UILL 3QISA 3GK8L 4E41A 2BY1A 5JHBA 1VIWA 4DKAA 1NMAH 3FF7A 3RIFK 2R27A 1ZTXH 3TBCA 3P3UA 4JDZB 5L7XL 3BSZL 5ICXB 2B59A 2XX0A 1RHHB 1SYVB 3N41B 3AXHA 1YCSA 4S0TD 4IRZA 2DMCA 3BT2H 2BSED 5GS1A 5LNGA 3NBNA 2AJYL 1Y7VA 4LSTH 5C1MB 1P4BH 3DOHA 2ADFL 5DJYA 1X4ZA 5MI0B 2OK0H 2FATL 3DO4A 1XCTA 4KK9D 3BP4B 2ZUUA 4Y16B 3T9WA 2VC2H 4BSWA 5C0CD 3K6SB 5HPOA 3D30A 4GI6A 2YKLH 2ORKA 3U46B 2JE8A 2BNQE 4Y5YA 3S7GA 1F4YL 4LCCA 1MVUB 5HJGA 1MCIA 5DJAA 3AABA 4ODUA 3VW3L 4PRAA 4Q4IA 3BRDA 3ALWA 4XPBL 3ESUF 4XI5D 3TBBA 4IK6A 1AMXA 1M7UA 1RZQA 4L8DA 4AMKH 1AANA 2JB6B 3G5YA 4PGZA 2NY5H 3T0DA 1W0YT 4S0UA 1F3DJ 1AR1B 1CFQA 3AXLA 3TJEH 4CU6A 4M29A 1GYUA 3CAFA 1X5XA 5HI5D 4Q0XL 4MRCA 3WEXA 3SE4C 2FNWA 5KSVB 3D87B 4CJ0A 4UOQA 4NCC1 2CUHA 5I74C 2WXIA 1JIBA 2OS9A 3H0TA 4KDTA 1IAMA 1PIFA 2BNQA 2GJZB 2JKXA 4EMZA 3RI5F 1YMME 3CZNA 2XTLA 5F7WC 4YHPB 2D0HA 2CUAA 4X99B 3U0PB 2YXVA 3LNHA 4TVPE 4YDVB 3VXSE 4ZNCD 4M4PA 4Z7AA 12E8L 4PLKD 3EYUH 5F7DA 2ZYHA 2FB4H 3KDPB 1LO0L 4GRWF 4WWPA 3EGDA 1LO5B 3TTSA 5SWSE 3BGMA 4MNGA 2HB0A 3KCPB 1IM3D 4IGBB 1KPRB 4F3FA 3H8NA 3TZVA 3W5NA 3RBSA 2N4IA 4K7PX 3IJYB 4FA8A 2OTWA 1OAUH 4WREA 3MFFB 1MHCB 3WD5L 4AEEA 3VTAA 5EUKA 4DVBA 1QNZL 2KPWA 1TETL 3VXRA 1I1AB 4KKNA 4J3UA 4QT5A 1SB2B 3VRLF 4AV0A 1M1XA 4NDMB 3ALTA 1I3GH 2H2PD 5I73C 1YECL 4I18A 1S7SA 1FBIL 1EBAA 1Q38A 1J1OH 4Y9CA 5H94A 2VB5A 1JYXA 5DSCA 1YEFH 4G9AA 2OZNA 3X14A 3FTUA 4B50A 4KI5C 3OZKA 3QC6X 2BVYA 1OHQA 3K46A 2WP3T 4R97C 4UV4L 2VDKL 3SDDC 3T4AC 2JV6A 1I85A 1N70A 1KYUA 2IT6A 3QUML 1BFOB 4QHKI 3MBXH 3UTSE 3MRQA 1E4HA 1N8ZB 1NC4B 3IMWA 4UDTA 3V4UH 3AWEA 5AW1B 5HYJD 4EN3A 5KYWB 5F6IC 4PJHF 2R2BB 4OGQC 3MV01 5C6PB 3HJ0A 1HILA 2VDLH 3VQLA 4JM4H 5FR3A 4L4TE 4KVPA 4EI5D 2BXYA 3B2VH 3DX2A 3FUJA 2LV4A 4K5LA 3K1KC 3NP4A 5INCA 4PGCB 4Y4HD 1FL3B 2GG1A 3SCMD 5I1EH 2F74B 2ITDA 3MLXH 2EUVA 3GHBH 4K3JL 3GMMA 1QPKA 4ZXBC 4AT6A 1A02N 4ZRWA 2BJML 2I5YL 3VAEA 3WE6A 2IWKA 2Y22A 3HR5B 1QLEH 4K8RC 4M03A 4WUUA 1OP9A 1JZ5A 4OV5A 2OSWA 5C6WH 2OMXA 1SFDA 4OD1L 3HHSB 3KR3H 5TJWK 3S4SG 1N5AA 2AV1A 3K72A 1IB5A 3GBNH 4ZBJA 4FZ8H 4OJYA 4KHXH 5JPMC 3DRQB 3OTTA 1TZGH 5DYFA 3A6OA 1RZPA 3CN2A 2IH3B 3OX8B 1FZMA 5F96L 2LS8A 3KS0J 5E00A 5CZRA 3HAEG 3ZT5A 3D34A 3MOQA 4R97B 2YGPA 3T4AB 5CD5C 3CHOA 3TNMB 3QI9D 1YYMH 4W4OC 4FMVA 4XGZA 4OI8A 1D6EA 1QSEB 3TU6A 4P2OA 1FNAA 2E8YA 4E9WA 2QLVB 3KBEA 1BFOA 4WFHD 3OJVC 2RCSH 5DC2A 4DVRH 1GZHC 2EIEA 4GI8A 1X9RA 2F19H 3H9HB 4GO8A 1AG6A 4H25B 2JI3A 3VWKD 2EYRB 5CCKH 3LPPA 1UZ6E 4KNTA 4YE4H 4AL8C 4BUQA 1SBSH 3VNYA 5C86A 3OLGA 5DS8B 5IQ7L 1GC1L 1UATA 4V1DB 5CWSB 5GS0L 4AENB 4Z7QB 1LO3L 2C9RA 3C6SB 1XH2A 1CD9B 3G08B 4TN9A 4PGCA 5TE7H 2YA2A 2A6JB 3S96B 3PL6C 3MNZB 5HHNA 4NKDA 2VM9A 1KB3A 2FEDD 4NJAH 5LBSH 3WJMA 5MEQB 3LKPA 4URKA 4GW4B 5DMKB 2WD0A 2BOBB 2EDOA 5EMYA 1A3LL 3RS1A 4L8DB 1XGPB 4H1LG 3BAIA 3I6GA 5JTWA 4ZOAA 3EO9H 1O5DT 5E99H 4MD5B 3FUHA 1MFVA 3ECBB 2VLKE 4RAUB 4NBZB 1TEGA 2YUXA 3SB3A 4GXFA 4G82A 2TSBA 5JLZA 1CU4H 1KCUL 3L9EA 3QVAA 5AD0B 1NCBH 4MMZC 5I8OH 4QTHA 5KG9A 1N0LA 4PWKA 1MI5B 4F9LC 3O0RH 2F1AA 2YD8A 4N2HA 4XNZC 3HPJA 4KX9A 1TCRA 3EFOA 5CEZH 4L8BB 2H1PL 2QDWA 3BE1H 4ZXBB 1DSYA 3B9KB 3AWGA 2CGRL 4QWWC 2D7PA 5J12B 4M5TA 4RETB 3O81A 5I1AA 4P2RD 3UZVA 2AQNA 2WANA 4QRFA 1OALA 2QSVA 2OMVB 5D7LD 3HUJE 1L9PA 3J27A 3ILPB 3O2VL 2KUTA 3EOBB 5EUKB 1DY1A 4E41D 4ENZA 1AFD1 1MHCA 1WTGT 4PHXA 4F37K 3LEXB 1LDPH 5L88L 2FD6H 4O51A 4XN8A 1R5IA 3QH3A 3QS3A 4UQ3A 3SDCD 1A47A 3HFML 4OV6F 1FHGA 5EC1A 2APSA 2H9GB 5ESVB 1FZOA 2YOAA 3K2UH 3FYIB 2BOCB 2OQJB 4IRZH 3DXAB 1AXSB 3MRPA 3QE5A 4Z0XB 1FZJA 1WK0A 3V4VH 2VH5L 1KZD1 2FH8A 5EBLA 3ALUA 5AG9A 1TVBA 3O6MH 4CMMB 3FFOA 1JXGA 1TQTA 1T7YA 3GJFH 2WBJD 2C8NA 1AZUA 2A6KB 1GIGL 3ZE2F 1BIHA 4U3CA 5I1GH 4K3JH 2W0KA 3NFNB 3Q6FB 1QSZA 5I1LA 1MIML 1N8OE 1IC0A 3GSWA 3LS5H 4ZS7H 3F85A 3ULVE 4PJ9B 5B1JC 1KZQA 1SJXA 1RFDH 4RFNB 4NLHA 5JO5A 4NO3B 3IXAB 1RZ7H 4BH8B 4QPEA 5B4MC 4QYAA 2BSRA 2VLMD 4C4BA 4EZJA 3ML9A 2GK0B 5F96H 5G5DB 2GAZA 4FQXD 2LLNA 2WZAA 5LGYA 2BRSA 3GSQB 2MQ0A 3MXVH 3S4SA 4HMEA 5GZOD 3KG5A 3P30H 2J1ZA 3ARDC 1TJXA 2NY3B 3OKMB 3STLA 4GAYB 1RUPH 4RIRB 2K7QA 4N33A 4WU5B 4JRXD 3X1EA 1K2DA 2Y7NA 2QMJA 3F62A 2QADD 4PVBA 4BQ9A 5JYMA 3E9UA 5E2WL 2M83A 3L08A 4FYTA 1ORSA 4N0CD 3RFZA 2QGBA 3AY4C 2V33A 1KV3A 1SBSL 2PWHA 4JVUA 3WUWA 4PU2A 4BQ8A 3FRPB 3F6JA 5HDBB 4E9QA 1VRSA 5H94B 2PF6A 1WWBX 3DX0A 4MMXA 4CGUB 5IMLB 4RDQG 1ORSB 4GSUA 3HN3A 4JM2A 4EDXB 1HQRA 3SGEH 2K1MA 5J5EA 3LPGA 2DDQH 2A4ZA 3RWEB 5JUEH 1AD0A 5C09E 4HXAH 3FN0L 2JK5B 3CZJA 3KPQB 1CE1H 4PJBB 4G8GD 2V5MA 4BSJA 4GO9A 3O3EA 1QZ1A 5ESAA 3A5VA 5DHYA 2RALA 2ZOLA 4U1LB 5DXWA 3ZXAC 3N85L 4QAWA 3TIEA 2MKLC 2P1YA 3NCWA 3RNKA 4NJ9L 2XTJD 4PJIE 2A9DA 3LN5A 4YZWA 5F88A 1KGIA 2IV9A 1AGEB 5HY9B 2ENPA 1JXKA 1MLBB 2DV6A 3ZGIA 5EWIL 4XP6L 2NY5L 3QDJD 4U1HB 1E27A 3P40A 3MRIA 3CQFA 3OLDA 2NTSP 4LCWE 2WTRB 3EFFB 2Q86B 2M8XA 2KZWA 3L9YA 2NYYC 2RFXB 2VDNH 5D7SH 3LEYL 1KGXA 4LEOB 1T20B 4X6DE 3PWPE 1U95B 3TT1H 3MBEA 2ZF9A 3BGFB 1ONQA 5EU7C 3FPYA 5AW0B 1BXAA 1KPUA 1LHZA 3QWRD 4LSPL 2AJSH 4ISVB 1NA8A 4ZAKB 1I1FA 2WLZA 4B3EA 2D7TL 4BV1A 1OSYA 2C1OB 2AZUA 5F9WB 1OZ7B 3M1BA 3QQ4A 3DIFA 1QRNB 4NT6B 2DLFL 3DYMA 2R0WL 3UTQA 1KBWA 3IJYA 4HPYH 5GSRA 1XTMA 3HKZA 1KBVA 4LVOB 3MLTA 2GUOA 2ZSWB 2H5UA 2V2XB 3P5DA 1ZKAA 1TYJA 2Z8VC 2A83A 2R69H 1V05A 2QBWA 4HCRA 3WTVA 1IQDB 1GGBH 4WUKH 3O45A 4OQ1A 3SKUD 2N1KA 2V2WB 1WG3A 2XWBB 4R4NC 3QNZB 3QDJA 4O4YH 1J8HA 1JGVH 1U3HA 3FQRA 1I3GL 2DPKA 4Z7OF 4FE9A 3EBAA 5K69A 3RGVA 1B0WA 4XI5C 4NKIH 4HD5A 2CKBA 4ZODA 4QO1B 4WW2B 4EIBA 3HC3H 4XXCC 2B4CC 2J73A 3DX8B 1E9QB 3HRZC 1SJEA 2QFPA 4RX4A 4WEEA 3GIZL 4NRXA 2WVVB 3AXLB 1CFQB 1ASQA 1DSWA 1A6PA 1IKNA 2QV4A 3NMEA 2VRQA 2AGJL 5IQ9A 4X9HA 1U8QB 2YPVH 3WEMA 1F97A 3OHXB 1BG9A 1UJ3B 3HE6B 2HG5B 3QUXB 2F54B 4JN1H 4YX2H 3DUUB 4L3EE 4CILA 3EOAA 1H3PL 1Q0YH 3VFUB 2G9HB 1PG7H 2OXGA 2FECI 1DP0A 1ZJBA 2EH8H 2SODB 3DVFA 4AC2A 2Y07H 5H4ZA 2EJ1A 1JD9A 4RGOH 1T5KA 3ELAT 5AZUA 1OD7A 2ZXDA 2CO6A 5IB4B 1RU9H 1B3IA 4GNKB 4NCC2 4X4YA 1XF3B 2VR6A 4M9OA 3KYNB 3VXMD 5KTEL 1AFB1 3BT0A 4ZT1A 4NSKA 5JOPD 1HTNA 1QHQA 4OGYH 1W16A 5CP3H 3GSUB 3MAWA 2C3XA 2WIIA 3WIFA 1ZLWH 1UVQA 3H55A 4H1LH 4KMB1 2XI9A 3MBED 4WI3A 3VI3B 5DJDB 1YNKH 4JREC 1T04B 2CLVA 5IQOA 5GHWH 4H4NA 3SKMB 2E6PA 4XX1E 3GBLA 1KDIA 2NY2C 2R0LH 4W1TA 3A0OA 2G3ZA 1F4WL 4HAGA 2HLFD 4S10A 1ESLA 2MMXA 2V6HA 4KZEH 3P73B 4KGLA 2GJ6D 2LAAA 3L5WA 4RFEB 2ZWSA 2ZIDA 2Y7QB 3S37L 1BAGA 4E5XA 4ZUVA 4RISH 4MD0B 1INQA 4JZJB 4AW4A 2B0SL 1WUNT 2IFFH 1NAMH 4OU3A 2UY6A 4L4VE 3FD4A 5DHDA 1HYSD 2F8IA 1KJMA 1SOSA 4KXDA 4Z7UA 3WEBA 2ORBL 3DSFL 2DYPA 1MLCB 2LTQC 3X3GL 1U0NB 1IEAB 5TE7L 5INDB 1HINL 4GS7B 1JHTB 3QJTB 4PFEA 3BLKA 3K72B 1A7QL 4AUYA 3QDGA 3TIEB 4P4RA 3GJFB 4GUCA 5J06A 4WI8A 1B08A 4MQ7B 2XNAA 1XMWA 3F6IA 4N0UE 3R0MA 1PLCA 5CGBA 2EEBA 2N40A 1CCZA 1RULH 3BJLA 4NO3A 1I7ZB 4ZDHB 1A6AB 1TR7A 4NPKA 1U91A 4H1LB 2VN5A 3U9PH 4FG2A 2NY3C 3ARDB 5E6IC 5A3IC 5I1JH 1T0MA 1THCA 3JWNC 3FT3B 2D7TH 2YAFA 4WHDA 1IAOA 1PSKL 4WFFE 2XY1A 1E8ZA 4HXBL 3F65A 4L3AA 3BN9C 3FSZA 4LF3A 3AGVA 1QASA 1FFOB 1ZPLA 2V7NA 4I89A 2VXSH 1E3XA 2P26A 5HGAA 1RZGB 1V3MA 3M88A 4EBQL 3OC8A 2CGRH 3IXTA 4F2ME 4L2LA 4LRIA 3E8UL 2X4QB 1IAII 2E27H 3DXAE 4PM1A 1B6EA 3WH2A 4LSDA 3TT3H 2AAVA 4TNEA 4ETYA 1LE5B 5J3HD 4WKZB 2X38A 3QIBC 4O51B 5LB1A 2R59A 2V2WA 2WXFA 4OB5H 3U83A 2GJJA 4DUVA 3W0WE 3B3IA 4G8GA 4WI2A 3RE0A 1HC1A 3UYRL 3ZYIA 4ANUA 2BPDA 1DFBL 3EHBB 3E38A 3FYEB 4UOW0 5KOVC 2XBZA 4F8OA 1K5WA 2WXOA 2D3JA 2YD7A 3ROLB 5F7EH 3O6ML 3VQ2C 4JN1L 4YX2L 5JR1L 1KJ2L 1A6TA 3VD9A 2V7HB 4AJYV 2ZP9A 1J34A 2Q7YB 1UUNA 1X2TB 1H3PH 1Q0YL 1QWUA 3ZYOA 4Z18A 3WHE0 2ZOTA 5BJTA 4P4KA 2WLHA 1EZUA 3GRWL 4PV1C 3HI6H 3FQNB 4NZ8A 4RMBA 3IMVA 2OX8A 1F58H 7PCYA 1S3RA 1J7VR 3KJ6L 1OD9A 3E6FA 3GF8A 3M7OA 1CLCA 4GSDL 4MS8D 1EVUA 3BKYH 3A67L 5CD3B 1T6VN 4JFYB 2VLKB 3ZVVA 3FQNA 2JB5L 2AQ2A 4XMTA 1AH1A 5GZOA 3NFPB 3RX9A 3UIYA 2J8UF 3CDGA 5E51A 4N20A 1KELH 2KV3A 1JK8B 2HTLC 1KBKA 5DZAA 5FYLL 3N44F 4Z3GA 4TM9A 1JN6A 5EN2A 1RP8A 1DJIA 3FT0A 2QSQA 2R0LL 5EFIA 3ARGC 3G84A 3LHAA 5CJQH 2XR5A 5KAQG 3N04A 1D9KA 3QFJE 3BPLB 1J10A 1PNCA 2PPEA 1PFOA 3C60A 3WN5A 5FPIA 3ZIMA 3APMA 3RFZB 4MJ2A 5A7BA 4F7CB 1EJ8A 1RTM1 3GS4A 4JE0A 3O3BB 4NQED 3ZYJA 5FDWA 1NLDH 1V4LA 3SKMA 3LSOA 4NZRL 2PR4H 3X13B 3FO2A 1TLGA 1NCHA 4D7BA 4DAGH 1JMZA 3SCMA 3D0LA 1IRAY 3UERA 5I19H 1YMMD 4W9KC 1IFHL 1D6EB 1QSEA 3T0VA 3ZR5A 4J6RL 5HJ3A 2A9ML 3UPRA 1IGIH 3RTQB 3IDJB 1QSEE 3KW7A 4Z7OE 5I18H 2BCKB 3BX4A 4TNFA 4B3VA 3KWWA 4MMYB 3DVNA 2FGWH 1DBBH 3MGOA 3LRMA 4R3SB 3TURA 1OANA 5C2BL 3MA7A 1DBML 5FYJE 1XF4B 3U4AA 2ZXCA 5A7EA 5L4FA 1SL6A 2C6UA 2DLTA 4AEHL 4DZBB 1BIIB 1F00I 3G5VB 1DN2A 4W4OA 3AS2A 4J6MA 2VWEE 3MX0B 2JVUA 2JF1A 1VCBC 2XNAB 5HHNB 5HI4D 1CGYA 1HQ8A 3CFKB 1LD9A 1E27B 3DROB 4XVSH 3G5VA 3T0ED 3FOLB 2FR4A 4Y9GA 4RMQA 3QDAA 2HT3C 4I4WB 1NKRA 4XCFL 3FK3A 3VDBA 2DWSA 3Q2VA 1HHKB 3SGJA 3E0GA 2ENSA 1P6AB 3JZYA 1E67A 4GB9A 1EJFA 4L4TB 5EU6D 3TT1L 2FGZA 5DZPA 3ZKXC 5GZOC 1HSBA 4EN3B 4F7PB 5MEND 4DPRA 3BLPX 3PP3K 4UAHA 2W59A 1HXKA 3FU7B 4XPAH 1VZIA 1JWUA 3TBTB 1V54B 1ASPA 3IYLW 3MLRH 1UKSA 4ZMTA 3HNTH 3VD2A 3IAGC 1O5PA 2DL9A 3GIVA 1CLYL 3AB0B 3U4BL 4DF9A 1FNSL 2OX9A 1YSOA 2AQPA 3F12A 4YN3A 3P73A 5FV1L 1UCTA 1SXBA 3GC3A 4L3EB 1FI8C 1S7QB 3V4UL 2VDOB 3IKNA 1DFBH 2F54E 3BP7A 2MFNA 4MNGE 3VDCA 1HHIB 3ZDYF 4AJVA 2B15A 5EDXA 1QW9A 3FAXA 4JQVC 1CDCA 7FABL 1PYWA 2OMUA 3DX9B 1P1ZB 3IEAA 1FAIH 1VFMA 2BZ7A 1N2RB 3MBEB 5FM4A 2IDUA 3LXCA 4MDRA 1RZ8B 1RUQH 2VDMB 1R3HB 2BY2A 3ISYA 1UH2A 2FJHB 5GRYA 1AXSA 3FH8A 4KBPA 4WI0B 4XWOC 4H8UA 4PJFB 4IK7A 1CFBA 3MCLL 4M61B 1M2OA 1EO8H 2E86A 3O3AB 4ORZC 2X41A 3QXVA 3X3FL 1MOEA 3CTTA 4LSUL 2VDLB 4EQ3A 2R56H 1K8IA 2LQRA 4L1BA 2EDHA 5E2VL 1QSFA 1WO2A 3L3JA 4FQXC 2HT2C 3KBHE 1BCIA 4PRHD 4BYHA 4UQAA 1WUZA 4AI7A 4LVHC 3TCTA 5BV7B 2VN6A 1QKZH 3QWNA 5J3HC 5JYLA 3ULAB 3O2DL 4V2CB 3VCLA 4A2MA 4FFWD 1F41A 4JFFB 2WYIA 3ZMEA 1HI6A 1U8JA 4PMFA 5DJ0A 4L8BA 2R2CA 3FTGB 3U4EB 4QF1A 4HOMA 5I6OA 5L7XH 4PDCA 2H6PB 3O45B 5EO0B 1ODAA 1TT6A 1EZLA 4LLDB 4N1HB 5IJVB 3QZWA 3KE0A 2XPZA 3NEOA 4Z7WE 1JERA 4A6YL 1B2YA 5DK2B 4H8HA 5ES4B 4QEGA 2NZ1A 3NFSL 3U48A 4CC0A 3CADA 4H2AA 5LVEA 2EO9A 1BJ3A 4K9JA 4I3RH 4UT9H 3VJ6B 5JXEA 1J0HA 3NGBB 1FO0L 4PW3A 1HWWA 1HL8A 2V9TA 4OFQA 3RIAK 4FXKB 2EIJB 4XNMB 4PJIB 4BFFA 5AZ2L 1QSFE 5KSVA 1HOCB 5LUMA 1FSKC 5AVUB 2HT4C 4ZXBA 5EOCH 5JNYB 2DQDL 4KKAC 5JW5B 5D4HA 1AZBA 1WEJL 4DPBX 2CPUA 3JTSB 5ACLA 3ZRFC 1T03H 4NQUA 4HV8A 2I07A 3B34A 4P2RA 3P0GB 1YNLL 3N06B 2VR7A 4BQ6A 3KPQA 2HCZX 2PLTA 3FN9A 2O93L 4Q7DA 5LN8A 5L8KB 5EBMA 1KN4L 4G6FD 1YPZF 4XMVA 4I0PD 1TJHL 2HFEB 3MX0A 4KPHH 2VO5A 5IROD 4UWWA 1GZQA 1Q4NX 1AMYA 1TIUA 1IQWH 1HHHA 1RULL 3ARBD 3BH9A 1DO6A 3LN4A 4M7LL 4NUMA 3V4VA 1HZHH 1JZ4A 1F4AA 3V0WH 1IBYA 3W1ZA 5D72L 2IEPA 4KAQL 5DZNA 4E9VA 4A2GA 1T89A 1UMRC 5DJZB 3RKPA 3ZHGA 3TEWA 5LBGA 3DTXA 3SE6A 4XCNB 1BJ3B 4DUWA 4LCWA 1CTMA 3JXAA 3V0JA 4GQ9L 2H2TB 5C3LD 1GSMA 4KK6D 4YVNA 1PLAA 4AM0Q 5GS2H 2IAMC 4OM0H 2R1YB 4A7SA 3U0WH 3BSZA 1FVEB 3FUKA 1OWRM 4JPQA 5LAXA 1B0GA 1MF2H 3KWXA 4LLQA 1JWSB 2YPLE 1NBCA 4CVZA 5KVGL 1YECH 3EGXA 5CS7A 4I2XE 4LDOB 1J9RA 4YDKL 4LSVH 2EE0A 3L81A 4B53A 2J1YA 1UC6A 4X5PA 1RUQL 1NUNB 2VERA 5HGHA 1GHFL 3N6YA 1AO7B 3UYPB 1KZB1 4L3FA 1EX0A 1IJKB 1NFKA 4JKWA 3UTTA 3C87A 3HHSA 1DVFA 5K9OB 1IBGL 4DGVL 2VIRA 3T3MB 3OSKA 3V9FA 5D5MF 4HG4K 4PJHA 3IE4A 4K9EC 2WIMA 3V8CA 5IG7A 3CHXA 2WLLB 2GSMB 2AFNA 2WP3O 3MJ9A 4YEEA 4YLCA 4P5TB 3P30L 1KXTB 3QXWA 4XMKH 3H9ZA 5KJRH 3FF7C 1LILA 1YPZA 4G7QB 1XEDA 4RA3A 2BFGA 4QCIB 4EI5B 2RICA 4Z95H 4LGPB 1G9MC 4FXGA 5C0FB 4S0HA 4WWKA 1YN6A 5EU6B 5MENB 4ZO9A 2D2OA 4HWZA 4LCCB 3MROA 5EO1A 1EJOH 5EUOA 1JS4A 3BIBX 5IR1A 4G6MH 4A6YH 3QIUC 1FC2D 1N64L 5CN1A 1U8JB 5DJ0B 2OKMA 4Z0BH 3PWVA 4PLNC 2AXWA 1JFQH 2PPFA 2E3VA 1YYML 5DJ2A 5CJQL 4KK9C 2IOIA 3ZX1A 1OOAA 2OMVA 1QACA 5AB1A 4PJHE 3Q8EA 4L37A 1KJ2A 1I7RB 1P2CB 1U8MB 1BGXH 2CK0L 4CC4C 1LEKA 4HUUA 3WHXA 2XPGA 4I0PB 2ENYA 3BKCL 3VNZA 5B39A 1ZHLB 4AYEC 1CE6A 1Q9WB 1WFTA 1F13A 2VMDA 3HA0A 4J3OD 5EO9A 3RWDB 4A6YA 4PHZA 1AS8A 4D0CB 1CGWA 2XV3A 1QFHA 2WNXA 4LPTA 1AKJD 4Q2ZB 1FFNB 5T8IA 1M3IA 3N1FC 1A21A 3TA3D 1A65A 5GSVA 1IGIL 4MX7B 5FECB 3WEXB 2BXZA 3OZ9L 3DECA 2FO1A 1R3HA 1TPXC 2KDGA 3SPCA 1OGSA 1FFPA 1IAKB 4FQJL 1MI5A 5GSVB 5T1DH 3ZZSA 4ZFOA 2P49B 3T2NH 4XE0A 3UGUA 3QP3A 1U8HB 1YY9C 4M61A 4P4KC 3NUKA 4QOKB 1OTSD 2G5UA 3MR9B 1KOAA 1PY9A 3FUMA 3TN0B 4PRPD 5HHQA 4R26H 1AGDB 5FW8A 2W80C 5IT2L 1EAPB 3C08H 5KVFH 1NIDA 3L95A 5BVPH 1BG1A 3QDGB 1KZYA 1B6DA 1MVUA 4C57C 1BD2E 4YDJA 2D31B 4YHLL 5IEHA 1UEXA 1RCYA 2YQGA 3ZL1A 1KOEA 4IRSA 4XCFH 1UD2A 4JQXA 3V52L 1UKQA 3LH2L 2QADB 4CU8A 1E9PB 4X5LA 5EEWA 3IGKA 1KTDA 5T33H 3BZ4B 1ZWIB 4KZCA 4DUXA 3HZYB 1YC7A 5AW8B 1F8TH 5AW3B 1UH3A 5I17B 4WJKB 3ULUC 3QARA 4KKLD 4MLIA 1I53A 5CZXD 1B3JA 1RPUA 3BUYB 5BQDA 1WAPA 4AGQA 3HC4L 4E0RB 2XFXB 2BRRH 3HE6C 1M6UA 3VFOA 2FYYB 1BLNA 4XB3A 3WS3B 1B0GB 4PMEA 1E2WA 4KY1L 1X6LA 4N32A 3DV6B 5HYSA 2COVD 4FC3E 1XBRA 4IW4C 1EVTC 4JCWA 2VDKB 4UV7H 1EZVY 4G5ZH 4X4ME 4MNQA 3V6FB 2FQFA 4FL4C 5T5FL 1OT4A 4CN6A 1AXIB 3TFKD 1S9KC 3I3DA 5F7DB 4ZJ9A 5DT1H 4YL4A 2OMXB 2VXVH 3VO0A 2VJXA 1VGKA 2E47A 3L95B 2H3NA 4UQCA 1VERA 1SY6H 5EF0A 3ZL4L 4YBQC 3LHPH 4LL4A 1WBYA 2VZ1A 2V5YA 4P23C 5F1SA 1M71B 4UIKH 3RL2A 1B4LA 2EECA 4JO8A 3QA3B 5HGBA 3IAPA 5AKRA 3SQOH 1YG9A 4ZMNA 1SQMA 1HEZA 3PWPA 3ZHKA 2B5IC 1GYCA 2JFCA 2WVSA 4HWEH 1JGUL 2E74C 3K74B 3IKCB 5J11C 5KS9E 1YEKL 2OP4H 4OZGB 3TA3B 4HUWA 1XB6A 4LSUH 1H0DB 2FL5A 4P57B 1VFOA 4LSTL 4POYA 3COOA 5L9DL 3AMLA 2AEOA 3MYZA 1A0QH 5CKGA 4I1PA 2FATH 4RZCB 1Z2KA 1DQQA 4ZRVA 2VAJA 3ZZQA 4WY7H 1DO5A 1TQCB 3QJZA 5GGRB 2OZ4L 4F2MA 5HYFA 5K5YA 2RIBA 3BXNB 2NMSA 2XIIA 3F12B 1E50A 4OZ4A 5E6YA 5J1TC 5SWZB 3IJSB 3BKMH 3LZQA 2P5PA 2Z7YA 5CEYA 4IBLT 4JFVA 2Y7LA 2X1OA 2X0UA 1HHGA 1I8MB 3L2LA 5C08D 4EQ2A 4ESKA 2VUVA 1X5FA 1G0DA 1D9KD 4AMKL 4YK4B 5I75B 4J27A 1IAOB 3FHAA 4O58H 3GBDA 1UT1A 3SJVD 1HIMH 2F9BT 1KACB 1RZ8A 2J5LC 4HJEA 1MW2A 3MRLA 1G4RA 4JG1H 2XDHA 3PGCB 3TO4C 2H2SD 4PJFA 1URZA 2R9HD 3WXWH 2O61B 3R06A 1CXEA 1FL6B 3WSQL 4QRQA 2PO6B 2XKUA 4N0RA 2JELL 5AVZB 1LTXA 1MIEH 4XMZA 1FFRA 4Z5RB 1UA6H 2BNQB 1XB8A 3VYKA 5FGBC 1YNLH 4V1DD 3TPUB 3B4NA 3S3SA 5FC9A 1GYWA 3W0WA 4R96B 4OCSL 4OJCA 1AC0A 1UCBL 3CH1A 3V52H 4FQ2H 5C0AA 1TJHH 3T3MF 1X7SA 1QSFD 2BSTA 4M1GL 4Z1PA 1UM4H 3ARZA 4B5EA 2A83B 2WQXA 3SO3C 3B7RL 1W2KT 2Z31D 4X4XA 4X5RA 5C08E 4IBWA 1OAZH 2FEEI 1HZHL 2F58H 3Q1SL 4JCLA 4XVTH 1UM6L 3C09B 3PDOB 4KH9A 3SY0B 1VEOA 3TT3L 2WUBH 5TQ2L 3KPNB 1G5AA 2Z1KA 3IFOB 5IB5B 5DZLA 2X6BA 1AQMA 1KJVB 4Z6AT 2OSXA 4PJEA 4HA1A 5F3BB 1F18A 1FE8L 1KB9K 2IXQA 3S8GB 4DKTA 1ZHKA 1CYGA 2Y23A 5PCYA 3IAQA 4J8QA 4MZ3A 3TNNB 1JXDA 2YHFA 1ETZA 2VL5A 4JLRB 3RZCA 3FO9B 3JWNH 5J6HA 3BAEL 1SF3A 1TZHB 3AG1B 1FN4B 2H7WA 1OGPA 4ERSL 5KSBB 1P84K 2Y7SA 2F6AA 4MBOA 1A7PL 4HWUA 3S37X 2CGYA 3KLAA 5BCAA 5ALCL 2APWA 1M7IA 4RDBA 4ODTL 5T1KD 1D7FA 1FYHB 2NY6B 1QFOA 4FNLL 1JZEA 1KJMB 1MCWM 2CG9X 4LEXL 2LFEA 3LNEA 3DBZA 3QPXL 5FGCB 1QABA 2WHVA 4PGBA 3UDWA 1S7UB 3QUKB 1U0OA 4U6TA 3OHXA 3QIWC 1SL4A 3MV11 1PEZA 2WVUA 4MGXA 3B56A 5FYJD 3ARDD 1NJ9B 3HTLX 3WFBH 4GY4A 3RDTD 3DSNA 3TN0D 1FV1B 2MCG1 4YFLF 1HXMB 3ILQD 1SOKA 2XUWA 1KF9B 3FSVA 4FHKA 5D71H 4ZPTB 3U30B 3GZKA 4PRBA 3OXSA 3WFCL 4ANVA 4GQZA 3NAAH 5I1DA 3RZCD 4QRPA 4N8CL 3VVWA 1IM9D 1IBHA 1KCLA 5AB0A 1NDMB 4M17A 5C07D 5GISL 2VR8A 3SPGA 1N8ZA 3NTCH 4G7SB 2EE9A 4OCNC 1RZJH 1OK0A 1VENA 4UF7C 3E6HB 4P5MB 5BUGA 1OSEA 3VI3A 3ULVC 4CN1A 3UAJD 3B7UX 2PTVA 3UADA 1MCPH 4BCZA 1FLRH 2Z31A 4GUOA 4FTVD 4G6KL 4ZMYA 2XZZA 4M7JH 4MXWL 1S3KL 2JCCE 2ZX7A 3MLZH 4RBPK 3O4LA 4LEBA 5C0AD 4LP5A 4PJGE 4NAQA 2CDFA 3HB3D 4E9SA 3MLWH 4XCEB 4AEIH 3S34L 1MN4A 3AFLA 3BIAX 4UQ2B 3RWFA 4RGNB 2FVNA 5DEZA 4U1IA 4PJ8B 2GJRA 2DYRB 2K45A 3QEHA 1CFVH 2VRKA 4QRPE 4DERA 1A6VL 4G9DA 1FCCA 4G7RB 5JHDD 4NNXB 3DSFH 5E6IA 1KCSL 1MCOH 3RB7A 4WUXA 3HC2A 4OLEA 3EUUA 5BZDB 3E7JA 4QXVA 3PWJB 1U8KB 5HGBB 5F9AC 1IIKA 4JE4B 3QZNA 5CIPB 4ZTEA 2BIOA 3RL1B 3WGVB 3ZJAA 4AZ8A 3QNXA 4NLAA 1F1GA 4BHUI 2IALB 2H32B 4M8RA 3GUTB 4GMSL 5BZXA 3DJ9A 2CJTA 2IAMB 4I0KA 4IOIA 4TSCH 5EORH 4ICXA 1XCQA 3FB7B 1A1NA 3REWB 4G8FA 4JPKH 3BH4A 1NDTA 4XO3A 4N36A 4E9LA 5HVHC 1G1OA 5I71B 3VMNA 4MCYB 4RGND 1NCWH 3SGKA 3C08L 2WVTA 4ODXB 3NABH 4NT6A 4TRPL 4FMKA 4GT7A 3ZO0A 4NQXB 3CFUA 3FCGA 1Q8MA 1QBBA 2GTZB 4PWEA 1VEMA 3FXIC 4IHOA 4QO1A 2VDRH 3WIHL 2DWDB 3SDCB 2R8SL 5HDWA 4BFBD 2EQDA 2VLJD 4IBTA 4P59L 3OGCA 4FJ6A 3IWVA 4LVNB 4FFVC 4DW2H 3X1NA 1MHPH 2DTSA 3OD3A 4UU9B 1LEIB 2WLJA 1J1OL 1AGBA 5SWQB 3P3RA 1WRFA 4M02A 3MUGB 1I3RA 1Q9KB 2DJMA 2E9GA 3PL6B 4AGLA 5KN5B 1GIGH 5T3XH 5I1GL 1DBKL 3KPTA 1E2VA 1MWAA 1CD1A 2CLZB 4NM8H 2Y25A 1WCBB 1IKNC 1CGVA 4ZX3A 4OUUB 4R7VA 2ZX9A 2O72A 4ZSOA 5DHVB 3FSOA 1FPTL 1EHAA 3D51A 1P7HL 4GI0A 2F15A 3KLAB 3MRBB 1AYOA 1IGCH 2ARJA 1W6WA 3BN9D 4IS6A 2VXVL 3F7LA 3V95A 2EUWA 5EZJB 1XSIA 3H3PL 3KXFE 4DP1X 3QXAB 3W9EB 5H37G 5C0RH 2DB8A 5I1CL 3AREB 5ETUB 2WJ7A 1BIIA 4MAZA 5CWSA 4U0QB 2J5LB 2X2HA 3BIKB 3ULUH 5LGKE 3U1QA 5CUSL 3MHZA 2X9XA 1UOSB 5F70A 1HAWA 2XXCB 2Y06L 2E3XC 1S9YB 1NEZA 1PZ3A 1WLHA 2DMHA 2N0KA 5IEKA 1H6EA 4FOMA 2X4NA 3QUGA 1GGCH 5FB8A 1BAFL 2RQ8A 3ARYA 1UVQB 4RFEA 3LKNB 5EBGA 2BS71 3TFBA 4LOUD 1MRDH 4R5VA 4NO2B 3ZO9A 5F3BA 5GGTA 2VITA 4V2BA 4ZFGL 2YK1H 4WY7L 1B9ZA 1Y0LA 4OVVA 5HHMB 3K3QA 2EC9U 4BD4A 4KZDL 3K7BA 1INDH 1WJ3A 4YR6B 1I8AA 4DVRL 2VDPL 2Q8AL 4EO5A 3DJRA 1E7UA 4P5RA 3FMGL 2ENQA 3WEOA 1OV8A 2D4DA 4OGAD 4L9LC 2AQ3A 1QA9B 3MCKA 2AQSA 3NPSB 1I7ZA 4JFTA 4C47A 1FQ9C 3F7VB 1T66C 1A4JA 3PGFH 4LPYA 1Y1UA 3LAFA 3EO0A 1G9EA 4OZFB 4YDVA 2X4PA 3MJ8A 2PYFA 2XBDA 4PPTA 1AS7A 4Y2LA 3ROOA 4TSBH 1KEGH 3H53A 1OPGL 4DJMA 5B8CB 3U7AA 5C0DA 3C5JA 3UYPA 4JDTL 4U1SA 1TQBC 2WKGA 3Q1EA 4ZAKC 3KL5A 2XETA 4G83A 5I6MA 1I7TB 4FFZL 4DP4X 4RLDA 3FB6A 1MCKA 4HOZA 3P9LA 3L5WB 2MHAB 5GZNA 3QI9B 2CDGA 3BUIA 4L1TA 3D1MC 2F53E 35C8L 1M9SA 3UZQB 3Q9PA 3KBFA 3INOA 4HIXL 1OARL 4NWUL 1AQKH 1HTYA 2YFNA 3GTVA 2VLRD 1RZKH 4NAMA 5E8PA 4M7KH 3ZDZB 1DJXA 4G3YL 3QZPA 1ZEAH 2DJSA 1QPXA 3TVMC 5DD1L 3EUDA 5EC1B 5KVEH 3JUYA 4HWZB 2BVQA 1VPOL 4XP1H 4LSSL 4NENA 1RP9A 1WGOA 1OGAD 1E4KC 4L8CB 1R4XA 4TKWA 4CAJA 1J8HB 1U3HB 2I69A 2Q7NA 4W9CC 5L88H 3P1VA 1R3KB 1OSPH 4R4FH 4Z7VB 1JZGA 4PJAB 1BYPA 4J6IA 4WSGA 2WWKO 2GIMA 3H9SA 2XT1B 4P5TA 3I6GB 1N59A 4NAJA 1KCRL 2VXUH 1HFUA 1YEJL 1Z9NA 2K78A 1QYGL 4LO9A 1UB6B 3V0EA 2F53A 4N1CA 4ZFQA 4WI0A 2F18A 3CSPA 2KKQA 3D3VE 2A0LC 2D7MA 3ECBA 4YSOA 1I1FB 3BSHA 1FGNL 4GW5B 5IFHH 4YEFA 2KLSA 3II3A 3GPSA 5LGJA 4HUCA 4GP5B 4Y16C 3VD0A 3IF1A 1BXXA 4M1GA 5GRVK 1S7RB 1CK0H 2QTVA 4KQ0A 3L1GA 4ZMWA 3U2SB 4ZS7L 2HVKB 4MSWB 1HQRB 1ZVHA 1F5WA 1HSAB 5IROC 3CBKB 2IAMD 2C4XA 1Z7JA 3V4PL 1JTPA 3L6FB 4WCYH 5DRXB 1R13A 1RZ7L 2H0PA 4NRYA 5BRQA 1BVKB 4QHMA 5AYUH 2Y5TA 2NSXA 3WKYA 1U3ZA 3RUGF 1AD9A 4UT6A 2XWZA 1PL3A 3CCKA 3OG4B 1KMGA 2HJLA 3WWKC 4RMRA 2I25N 2D2CC 3ZTDC 5E2UL 2ZG3A 3RP1A 2CO3A 3VXQB 3ZHLA 1FNGB 1DVFD 1N10A 4HJJH 3S96A 3LKNA 1AKJA 1A7RH 3VXNA 5IUSA 4NFBA 5ANME 4N8UA 4KZDH 2OSLB 3D09A 3VXQA 4XCNA 3O3DB 1DCEA 4YHML 4OM1L 4ELMF 2DKSA 2HJFA 4RISL 4OCYL 1OT2A 5FWQA 3DV4A 3N40P 4HEPA 4GG6F 3FT4B 5DD5H 5SX4H 5LBSA 4RMSA 4X0KA 4QXUH 2R1YA 2P7TA 5ILTL 1WSST 2Z91A 2XN2A 3IJ8A 3D4ZA 4JR9L 1BBDL 3HUJF 2QR0A 3DARA 3CDZB 4KKAD 1AR1D 4ODVL 4DGWC 1EDHA 1YEGH 1QW8A 1MFEL 4K71C 3I6KA 1SEQH 1P9MC 1Z5HA 2IH9A 3CVHH 5EF2A 4HUXA 5E9DD 3E2HB 5GS3A 3T2NL 4F57H 4BH8A 2Y3NA 4FQHB 2BVTA 2W9LA 3CLEL 4AKPA 5KVEE 1FFQA 2AC0A 5ANMA 5JQ6H 3QIUB 4FHBD 4YDLB 3ECQA 2WXMA 2NW3B 32C2B 4NO0B 4XO8A 3BDBA 1ADQA 4M6NL 5A2LH 3NJGA 3PABB 4B9FA 3C2SA 3KYOA 5FOJA 3SQBB 1NH6A 5BS0B 2EO7A 1ROWA 3QJHB 1PSKH 3B1TA 3FU8A 3WFEH 1YEWA 4AYFB 1LYQA 3Q13A 4CADB 1J0YA 3OXRB 4I18B 4HCFA 5JOFB 4Z76A 5I2IB 4KKBD 4Y5VC 1NBVL 1NGPH 3B5TA 1UB5B 5GGUA 3FBQA 2GBUA 4F7MA 1VKXB 1IGYA 2HKHL 2GT9A 3JWDL 4G3YH 3WTXA 5AZEL 1GA2A 1PF3A 3IMRA 4FQ1H 4K7FA 5E1GA 4AQ8A 1MJ8L 1A1MA 2WQRA 3UZQA 2PN5A 1H8OA 4HIIA 3EW3B 2ATPA 4LQFA 2GT9B 2FT8A 3NCMA 3J8F7 1IE4A 2C7UA 3H6JA 3HOGA 4WUWA 3QDJE 3B9AA 3LZFH 2P5EA 3A3YB 5CBEA 2JJTC 5C0AB 2IAND 5FUZH 2G2PA 3FCBA 4MB4A 2R8SH 2GTWA 2EKSB 2XG4A 3FTZA 4XBEL 3BPOC 4ZYKA 1OGAE 5CEXB 2DN7A 3U1SH 3F7RA 4B9PA 3GI9L 2XXFA 3QNXB 4JFFD 2XWXA 3D7PA 3B5HA 4O2CB 1BVLB 1QEWB 3AT8A 3FN3A 1J05B 3IBEA 3RVUC 1ZA6B 3VU1A 4OLXH 3W0WD 1PD6A 4PLJC 4JJ5B 3Q43A 1F02I 4NQSA 3RY5A 5L2KD 3UAFA 4LCWD 4TUKL 4Y5VB 2AMGA 2FJHA 1G43A 1IC7L 1PEWA 1T20A 2Q3ZA 4I85A 2X4PB 1DUZA 4ELME 1K9JA 3UBFA 5LKNA 2RFXA 3O6FB 3EH3B 5HSFA 4ES9A 2W9EL 5D2NE 4P0DA 4YXLH 5I5RA 4ICWA 1KXVC 1BQ5A 1YJDC 1JWIB 2R2HA 3RAJL 5DEJA 3GBNL 3BQUB 3QI9C 1F1DA 1MWAH 1NFDE 3BGAA 4LP8A 4HOWA 3RIFF 4NIKB 4YXKL 2P5EE 1IC1A 3B2MA 2E0PA 3HAEB 2D4FA 4XOCA 1KG0C 3QSKB 4KITB 5D7LB 5IKCB 3B8YA 2VRAA 5H2BA 4U1GC 1LO4L 2EDEA 1TSHA 4GRLD 4H25A 1L6ZA 5K9JL 3AAZB 3G5ZA 2EH8L 4IOPB 5E0QA 4JFPA 3ARXA 4A2EA 4HDIB 3ULUL 1MNUH 3SDAA 4QWWD 4AY0A 4M5YL 1SNRA 1SXAA 2EVJA 5HXMA 5C08A 3GEWB 4FFYA 2ICWA 5TD4A 1JFHA 3AW5A 5DJ2B 4PCTA 5EU4A 3US1A 4WHYG 5DK0A 3QYCA