1E63A

Ferredoxin:nadp+ reductase mutant with lys 75 replaced by ser (k75s)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPESLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Interactions for Complex Formation between Ferredoxin-Nadp+ Reductase and its Protein Partners.
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Oxidoreductase
molecule keywords FERREDOXIN-NADP+ REDUCTASE
total genus 89
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2000-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1e63A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1e63A02
5JBQA 2VYQA 1E63A 4ACAA 1F60A 1EXMA 3QE2A 1K9MD 1VQ4B 3PENA 1BQEA 4M0LA 4Y9RA 4ZV4A 5AN9A 3CPWB 2VNJA 4TMVA 2B7BA 4YAOA 1GJRA 2J7KA 3OJWA 1KK2A 1QH0A 2C77A 4FN5A 4C43A 4J0QA 1YHQB 1OGIA 4B47A 1QVGB 1XB2A 4YAUA 2BSAA 2R6HA 2DEUA 5THXA 1R5OA 1KK0A 2QTLA 1JNYA 1VQOB 3AGPA 5GV8A 2E1RA 3ZZ0A 3OW2B 5EMNA 4ACBA 1NDHA 2CRVA 3I1FA 1N8RD 4NCNA 3P27A 3OZWA 5TY0A 2BV3A 3P26A 3CCRB 3W2FA 4LBVA 3CRZA 2BF4A 3ES9A 2QDXA 1I7PA 4B48A 1VQPB 1G7RA 1YITB 1SM4A 4RD4A 4G1VA 3FJOA 4AC9A 2PLFA 2HCJB 4B44A 3V76A 1KD1D 3ZBTA 3I56B 4N3GA 2B7CA 1D8TA 3W5HA 1Q81D 1JB9A 2HMAA 2BM1A 3QFCA 2OK8A 3VNUA 1UMKA 3LO8A 2VNIA 1VQ9B 4R71A 4TMTA 1YIJB 3A1FA 4ZCIA 3OZUA 4NBSA 4YAFA 4H9GA 4N3NA 1Q7YD 5DSZA 1FNBA 1D2EA 4MYTA 5TV2A 1VQNB 1QVFB 2ZITA 4PGOA 4RJLA 2YWEA 3CW2A 4RD2A 1ZUNB 1VQ6B 1ZM3A 1TLLA 2YWGA 1S0UA 2HDNB 1VQ7B 4K1XA 4PC3A 1FRQA 4TN1A 1BX0A 4IW3B 3WNCA 3CCVB 2BVNA 3OZVA 3ZZUA 4P3YA 1IB0A 2DCUA 1EP1B 1G7CA 2X3UA 2B5OA 4ZCLA 3CCSB 1M90D 3CMAB 4AF7A 2BGIA 3E1YE 1E62A 1R5BA 3CC7B 4PC2A 1E64A 4Y7CA 1D1NA 1EWYA 2CNDA 3W5UA 3QFTA 1KTVA 1GO2A 2QMUA 3B8HA 3LYUA 1AMOA 2VNKA 1TTTA 1KK3A 1XE1A 3WXMA 3QFSA 2EIXA 3U2QA 4BPRA 1A8PA 1ZM2A 3QFRA 1HA3A 2VNHA 4M2LA 1M1KD 2XEXA 3ZZTA 1W34A 1OGJA 3FPKA 1J9ZA 1FDRA 1W87A 1H42A 3B82A 4M4SA 4Y9UA 4EH1A 1G7TA 1JJ2B 3G4SB 3G71B 4F7DA 3B78A 1OB5A 4PC7A 3SJZA 1EFUA 5HXBA 1KK1A 3VNVA 1DARA 1Q82D 4YAWA 4UAJA 3AVXA 3LRXA 1QGYA 3U6BA 4ZGNB 5TR9A 4ZCMA 2PMDA 4TMWA 2GQFA 1CQXA 1NJID 2VZLA 3ZC3A 3JQRA 1QX4A 4FK8A 1IJFA 3QSYA 1DDGA 3MMPA 1FNDA 1QGAA 1OB2A 1QGZA 2FX3A 1SKQA 1BX1A 4LC0A 3WBKA 4M1KA 4PC6A 4QHYA 2GPJA 2RC5A 4TMZA 2QA4B 1CNFA 2OTLB 1GR1A 3WBJA 3WYAA 1KJZA 1GVHA 4G1BA 1DG1G 4WQMA 1YJNB 1S72B 4MYUA 1W2BB 1EP3B 3MHPA 1AIPA 4DQLA 1JA0A 1YJ9B 3AVWA 3U6KA 4DQKA 3CCLB 1KC8D 2DY1A 3CC4B 4M53A 1VQ8B 1GAQA 3W5VA 3CD6B 1CNEA 2BM0A 1U2RA 1K73D 1FNCA 1VQ5B 4LBYA 3JQPA 1TVCA 4C0SA 3VO2A 4YHBA 4RD1A 1Q86D 1VQKB 2BPOA 1W35A 5H59A 1GAWA 1EP2B 3OJXA 4LBZA 2PIAA 3G6EB 4YALA 3CMEB 3LVBA 1JA1A 2XNJA 3CCJB 1KRHA 1F20A 3CCEB 3VMFA 4G5GA 1K8AD 4AF6A 1QFZA 5KSWB 4P6VF 4HE5A 2QN6A 2XNCA 2BN4A 3CCQB 1VQMB 5H5JA 1TUIA 1FNMA 2YWHA 1ZM4A 2RC6A 2YWFA 4RCZA 1QFYA 3W2HA 4ZGQB 1B23P 3J81k 4QFMA 3AGQA 3AVVA 4FWTA 2DETA 4TMXA 4Q7JB 1EFCA 2OTJB 1WDTA 3AVTA 5GV7A 1DDIA 1N0VC 3CB4A 4RCYA 4RD3A 1EFTA 1FRNA 1QG0A 2EFGA 2BMWA 4U9UA 3AVUA 2QTZA 1ELOA 1BJKA 5FA6A 3W2EA 2QEXB 3CC2B 4RD0A 3VO1A 3I55B 1QUEA 1G7SA 4B4DA 4HE6A 1IJEA 1QUFA 2D74A 2DERA 3CCUB 1QFJA 2C78A 4B43A 4RD6A 4PC1A 3AVYA 3JQQA 2BGJA 1N0UA 1H85A 1YJWB 3ZBUA 3MCAA 3WNDA 1B2RA 4B3XA 3CCMB 2AHOA 1VQLB 2OK7A 1YI2B 3CXCB 3W2GA 1ZM9A 3WNBA 3E20A 3WY9A 3W2IA 1R5NA 4LBWA 1KQSB 2NPFA
chains in the Genus database with same CATH superfamily
4JCCA 2B69A 1ZA1A 4KG7A 3C3EA 3VOAA 2OD9A 3VX3A 2Q28A 4HUQB 5E7IA 1PGPA 3IAFA 2BFOA 2FE4A 4HR7A 1HL3A 5DX1A 1FFDA 2NGRA 3SQWA 1R4NB 3UUFA 1NGSA 3WLQA 2WICA 3QU5A 3PENA 2QVZX 2BGRA 4ZT3A 3CCBA 1WQ3A 1U8FO 1NVGA 1Z62A 2BFFB 2NUTB 4GD3Q 3QMWA 1TX4B 4WK4B 2AGVA 4K03A 1TYAE 3O73A 4AWBA 3IO3A 5FB3A 2YXPX 1RTKA 3FPFA 1NLYA 4R9SA 1OFUA 2P0EA 221PA 4OPVA 3PDWA 4IHJA 1J0DA 3WJAA 1MOZA 4FN5A 1RCUA 2CUTA 3QXSA 1GN8A 1U3TA 2CLFB 4OFWA 2HLPA 4B47A 2QQEA 4W1PA 4PG4A 3RYTC 4HWKA 2X7HA 3I5AA 3JQGA 1PWHA 3TSOA 5A88A 4XD7A 2G1KA 1I0LA 4XWKA 2PGLA 1ID1A 2QMZA 4LOLA 3U13A 1VKRA 3GJ6A 1KFBB 2YNMD 1G64A 2HKIA 3TDNA 1R7RA 4DRXA 5IVIA 1JALA 1SVKA 2EDCA 3MCWA 3QEBZ 1O4WA 3U9LA 4MW1A 4M86A 4OQXA 2CBGA 2VIIA 1OU4A 1DAIA 1UL1X 4C03A 3LFUA 1VQOB 1EP9A 1TO6A 1LB1B 3VHXA 5IAAA 1V96A 4TLLB 5CXQA 3HA3A 3JYHA 1SBCA 1E0JA 1BKSB 1JJ7A 3W1VA 4ETIA 4O0MA 4UM7A 1PS8A 1SUBA 3Q8XB 5KSOA 2PVPA 1JUDA 2VSXA 2R00C 4YT2A 4Y1GA 4KXVA 3CNOA 3BWBA 1EXWA 3GEMA 3IDZA 1Z12A 4X1KA 4NVRA 4OHYA 4N7BA 4CF3A 4JEMA 1AKNA 4F7WA 1FMFA 1F3OA 4NF2A 5BMOA 3UM9A 4RTLA 1LXCA 2FWNA 3OZWA 2WYWA 4B81A 4CCYA 3ZK9A 3SZ3A 4D3YA 1NT2A 2DH6A 3D6JA 2GJPA 1CZKA 3KDPA 2ZT8A 3M9LA 4CDNA 1Z6ZA 2F8LA 4XKJA 2P9FA 2ZGVA 4XFJA 4PYOA 3D0QA 2VTEA 3C7CB 4PRYA 4J6FA 3C3MA 1AHPA 1G7RA 3GJ8A 1U4SA 4DIBA 3U4QA 1NBOA 1A27A 2RH8A 1NQ5A 2X8LA 4U8HA 2PNJA 4EJSB 2TRSB 3OIDA 4B6QA 2QD3A 2WJZB 5CEEA 3ILXA 1MEEA 2FPLA 2IKSA 1USUA 4PYIA 4AG3A 3HKBB 5JCJD 5HEKA 3FVVA 1SHUX 1TKAA 3EBOA 1PUXA 4H35A 3Q7SA 2B7CA 4RMIA 3KAJA 3LUPA 2Z4SA 1YACA 4PRZA 2FCAA 2QRJA 1TC2A 1LS1A 5CX4A 3DLTA 3ONFA 1NRXA 1I2BA 1F7VA 4LZOA 4J6EA 4L4SA 1CQIA 3FKJA 4F8JA 1QR2A 4OA8A 1QAQA 2IH5A 4RXTA 4AP5A 4RKRA 1NLMA 3ND6A 3LKDA 2QRVB 2VDLB 1X7YB 3M6XA 4EX6A 3UOGA 5KX5B 3QEAZ 3EVAA 2D4HA 5B7GA 2OLEA 3P45A 4ZO6A 4LOAA 4FFMA 4WCFB 3E48A 1T36A 1RKBA 1RPZA 1YBFA 2KLBA 4NZ9A 3DDYA 5IJ0B 1EFDN 1UBNA 2HX1A 1P7PA 2HA7A 3GCXA 3AV0B 1P9RA 1NL3A 3S68A 3UAZA 1TUEA 2DVMA 3KOZA 3EHDA 2QL9A 3JQFC 4JQYA 4LTNA 3W0LB 3AUAA 1M83A 5IX8A 1UM9A 3IPRA 2PZFA 3IP8A 3A6JA 2QORA 1BCRB 5EZQA 3MSXA 4YLEA 1TO1E 2R1UA 4BFLA 4G0OA 1DMRA 3K53A 3N87A 5D86A 2X8WA 3CHYA 4KP7A 1G9XA 1JHQA 2NIPA 2P5SA 3HBNA 3U3JA 1JHPA 1QXSA 5JNLA 1JWBB 5FI1B 4FHCA 3WLAA 4F9TA 4P5EA 3DOFA 4RENA 4RIHA 1K7YA 3IV6A 1YJCA 4MEBA 1YTUA 2AQKA 4MHSA 2YQ5A 1NURA 4B6OA 1N5OX 1QHEA 1OAOA 3AINA 2W2MA 1N8NA 4R8SA 3KL2A 1FBNA 3ZJ4A 4DA6A 5MN6A 2BH2A 1RQPA 1F9AA 4E03A 1JBQA 1LF0A 1XUOA 1V11B 3RIEA 5JY1A 4L3VA 4BN5A 3Q3IA 2W42A 3W5AA 5AM5A 1VLOA 5E4JA 1Y8QB 2A5JA 4KOAA 121PA 4OVKA 1ISMA 3PHHA 2A1IA 3LUKA 2YKGA 4BX3A 4XSHA 3CVXA 1QTIA 1MFZA 4ZCLA 1K7CA 1JFSA 1C2TA 3MG9A 3EVZA 3GU3A 1FFXB 3NAQA 3ON5A 5IEBA 4C0KA 2ZI4A 1U99A 4IVRA 2AE2A 2QY9A 5BQ5A 4DXAA 2B34A 2I6SA 4KC0A 3LLUA 1ISIA 3KKKA 5ENDA 1H3NA 5EPEA 3RRBA 4UM9B 2E4UA 3QYJA 3BMCB 3JALA 1IXZA 3C85A 4J4HA 1L7EA 2VHEA 5AXBA 3ADPA 5B3JA 2VF7A 1NJFA 2IYUA 4R6WA 3WP0A 2FOLA 5KOJB 4TYWA 3BGVA 1V2HE 1NW9B 1W36D 1X1BA 2VYFA 1BEEA 4LVOA 1PJZA 3RWOA 3X1YA 4JSYA 3GGJA 3ZVLA 2F3UA 2FWPA 4EYSA 1TK2A 3IIJA 4LN1A 3HZZA 3AP1A 4DQDA 1FLDA 4LK3A 4EX7A 1Z73A 2DFVA 3DR5A 3WXBA 2W4QA 4X24A 4I5FA 3DO8A 1LY1A 4FD2A 2P9EA 4F9GA 1FEZA 3I32A 3OTQA 4C7VA 2K4MA 4ZVNA 3E5HA 3F5QA 2XCUA 4O5AA 2P1ZA 3PU6A 1VSVA 4S1VA 1VSUA 5M7EA 3O1IC 3LPLA 1CZLA 4B2PA 3L4JA 1LV8A 5AKXA 3LUHA 2ZVDA 3EDOA 4CHGA 4K28A 3GPIA 5ICEA 1G7TA 4WA7A 1U3GA 3AEYA 2AX3A 3BCRA 3JQAD 5CT9A 3LNCA 1XNJA 1SXJA 3IKMB 2WMDA 4LHWA 3VR4A 3GLIA 1PS9A 3IJEB 4GL2A 3DLPX 2RKWA 3QELB 5BWCA 2GWRA 3FTPA 4RBNA 4YGYA 2EX1A 1PLJA 4CTOA 2NZVG 4PC7A 3FUUA 5GINE 1Z2OX 3T3NA 2PJRA 3H9NA 4TMFA 2ODNA 2WOJA 2ZRJA 3M89A 3P5BA 3GDFA 5F3RA 4DPKA 1H4SA 1HM5A 2R6AA 4A5SA 1VJDA 2ZZMA 1XTRA 2YJ6A 2Q6OA 2BKAA 4AJEA 3D4OA 5ALPA 2XYHA 4ZV9A 3V7NA 4CKCA 4RPIA 5ETJA 4FXPA 2MYTA 3WGOA 2FWMX 4O4JB 3LYAA 4ALKA 1QPZA 3NV9A 4ZGNB 4QVAA 3BD6A 2ASEA 3EA4A 1EKXA 3V2HA 5IN4A 3ENWA 3I9V1 4FHDA 1AA6A 2VWHA 3QPAA 4KPYA 2GQFA 2FRDC 4N41A 4C1NA 3GVLA 4HYTA 1M1UA 5JXGA 1WMSA 1DAKA 2VDWA 5K3OA 1OWLA 2AB0A 2OWDA 2XMRA 1U7PA 3LQFA 1ONOA 3A6GA 4BKUA 3ACCA 4W99A 2FG6C 3RFUA 4ZZ0A 3K20A 5L40A 3P2IA 1X2EA 2FR1A 2P27A 3M2TA 4MR9B 4WGGA 3VH2A 1A04A 2I1QA 2P6RA 1TM3E 3QE4A 4B7CA 4P25A 2ZTNA 2KPOA 3DBIA 3V2GA 4HEHA 3NRCA 1GY8A 2F1OA 5JZVA 5JW6A 1IC6A 1Z4MA 2PKYX 3OP4A 2OAEA 1W88A 2PUEA 2QZJA 4BO9A 1GPUA 2OO5C 3LBAA 5KTTA 1H9AA 2JA1A 1XDGA 2PMBA 4PM4A 2GZDA 5AKZA 1JLLA 4BB5A 3R9XA 1S72B 1RJEA 3I9JA 3R44A 5P8WA 2B8NA 2J9XB 3HZHA 4HDKA 3CFYA 4IV5A 4K7JA 1EZ1A 1NXXA 4PGFA 4YJGB 3RQIA 4C87A 3D8BA 5BWBA 5HHTA 4CQNA 1PJAA 2W2LA 5L3SA 1CK4A 3KPVA 4ZOBA 1UQUA 1VL5A 3L6BA 5BR8B 4ZOAA 2O3UA 1BXGA 2R8XA 4N7MA 5B53A 2P2YA 5A3RA 5AW3A 1SJ9A 3KVRA 3PQEA 1DIOB 5EIXA 2BMAA 1V5WA 3S55A 3V42A 1QV7A 4A0FA 2QD1A 3MFQA 2YVUA 2Q7DA 2V3VA 3IYLW 1AKMA 2BEKA 2I80A 3CUUA 2JFXA 3WB1A 4Z7JA 4MKZA 3LQ6A 2GYVA 4GUDA 1E96A 2HU5A 4H0NA 2FZCA 4JI3B 2H2GA 2V6BA 1BRMA 3GVXA 3KOXA 2DWOA 4DV6B 1J0XO 2BFMA 1CUSA 1RM4A 1FVFA 3WR5A 4RO0A 4BV2A 5JSZB 3H1FA 3OM8A 5CFNA 4WEQA 4O2BA 3ROFA 3O8LA 2EL9A 4HAIA 1SPBS 4BEJA 1OLUA 3CR3C 3UC5A 4BRSA 5E3HA 2ZTLA 4HNVA 1D0SA 2AJTA 2G28A 2IU6A 2Z83A 3EF0A 4IINA 3HRHA 5FBQB 2BPOA 1Q1EA 3WWCA 4ZVMA 2E49A 2OWEA 4C4YA 2ZBDA 1E32A 1OI3A 4E32A 3G23A 3V7AA 1N6IA 2ZIEA 3UG6A 4U7FA 4RXMA 1QH1A 2LPMA 3FBWA 2JI7A 1D1SA 4QOIA 4AD8A 4D82A 2CMHA 3MXOA 4TTAA 1R6XA 3G6EB 3A0UA 3FBGA 2OQ2A 4YMIA 4DREA 2HA3A 4DS3A 1CUHA 4TWIA 2AHRA 1E0SA 1YQ9A 4JFAA 5CB6A 5JATA 2O8FA 1XQBA 3UHAA 5I5GA 2H16A 3GWGA 5J5VA 1YA8A 4I36A 3EA5A 4RACA 2H2AA 4TTVA 2PUBA 4MUNA 1FX1A 3F6SA 2P2GA 2DR0A 2O2EA 3PQDA 4X3CA 5ALXA 5GZ3A 1RAIA 2W2PA 3F8WA 1XK6A 1YQXA 3TQOA 3G2HA 1Q14A 2M2IA 1MW8X 3PJDA 5FHRA 4DG5A 1WV1A 1TQ6A 1VTKA 3M3HA 4GZ6A 1NQTA 3K31A 3HN2A 4U1RA 3X0DA 5BVGA 4HE5A 4HN2A 1WY7A 1KSFX 4XXHA 3VZQA 3TNDA 4QTUB 2GSDA 3CR7A 4RIIA 3OZTA 4FMDB 4TX1A 5EKSA 3UK6A 3V4LA 4GO1A 3VVCA 3VU3A 3V1MA 3G0IA 5CLGA 1KKUA 3TB4A 4RPCA 1MAVA 3NJ4A 1NW4A 3QXHA 4ID9A 5B1IA 3KQMA 4CU5A 1ABBA 2AFHE 1YB1A 1PNRA 5HZKA 2Q0HA 4TZKA 8AT1A 4R1SA 2XCIA 1WAMA 1CZOA 2CGEA 3ELUA 3BIJA 3LX6A 3OF3A 3D6HA 4UXJA 5CFOA 1E92A 1KMMA 1T5HX 1DIBA 5TNXA 2W6NA 2IDZA 2YX1A 1EH5A 4YI5A 3EH2A 4ZAWA 3ZH2A 1VXRA 2TECE 4BNMA 5BPFA 3L8DA 4NZZA 2R85A 3IQZA 4D99A 4A8TA 3BXOA 1WD5A 4S3MA 3PSHA 3FGZA 4KK4A 5CPFA 2G82A 2E55A 1Y1SA 3VO8A 2IFTA 1U1DA 3Q41A 3U7FB 1NBWB 1W4CA 1XMVA 2XTZA 4TGLA 1MN6A 1LPAB 3NTRA 1WVGA 2A6PA 1P0QA 1PZHA 1RI5A 4ZMBA 3V1LA 4TPKA 3DOHA 3CJQA 4MS1A 1HZJA 2NZUG 1S2OA 5AK0A 3OBBA 1G3RA 3R6KA 1I8TA 1E1MA 3K7EA 3L6EA 4MVJA 4FM9A 3OESA 4Z3KA 3IT2A 3MWEB 4ZVTA 3QU2A 4P4LA 1DDIA 1EDZA 3U16A 4QAQA 2JGKA 4MGYR 4LV8B 3KQKA 1Y34E 1I36A 2IU3A 2QWXA 4H4DA 5DCLA 4TWJA 4MI3A 4B3FX 3I92A 4NYJR 4XJVA 1S3IA 3VPSA 3OPQA 3G59A 3H86A 1PP4A 4HH4A 4IIXA 4ZKEA 3U7JA 1J39A 4U9UA 3AY3A 5DIFA 5IC6A 3BRWA 1CYDA 3EIEA 1L5WA 1UFQA 3UH0A 1J8DA 1H5NA 3A4YA 1R8QA 5C8YA 4FGUA 2X9GA 2QS9A 1I6MA 1S2LA 3A3YA 1ND6A 2X0DA 3EC1A 2VATA 3EUWA 5DULA 2WWVD 3ORYA 1H66A 2A92A 5DTMA 1MO4A 2BY4A 5A4JA 1DRVA 5CFPA 1VLZA 4R1UA 3SC4A 4B40A 5GONF 4MQ4A 5IAOA 2FSPA 1IN7A 3C70A 2QE7D 1QCZA 1A72A 1WTAA 1ZK1A 1IEWA 3GRCA 3UAWA 3E18A 1CUYA 4G5XA 3ZE9A 3T5BA 4BZWA 1KRWA 3EZ9A 3FOFC 4MYRA 2LVBA 4IDBA 4YPFA 1OA1A 2E87A 5JH7B 1K7XB 1N2EA 2DWPA 2FLVA 1TRHA 1Q7BA 5MGBA 4KCGA 4RVSA 1R0WA 1SFRA 4DSZA 4D45A 3CH5A 3JTMA 4HPXB 4PSCA 4PZZA 2OA0A 2FUEA 3O3OB 1QPBA 2O05A 2ACEA 3U17A 2DOGA 2AVNA 3WRVA 3ZBUA 4DAEA 1NQXA 3P5SA 1J0BA 4Z7NB 4G8BA 2XOKD 3HGMA 3OIUA 1EXDA 2BL4A 1YR9A 3IMEA 4UCXA 4D4HA 1QAMA 4HDQB 1R6UA 4PYQA 4TWBA 3C8HA 3TZLA 3K5PA 2YV3A 5F3DA 3C3XA 3TLKA 4HAXA 2C03A 3ELYA 1VPWA 2FW8A 2P8SA 3FZYA 3GPBA 1FUKA 4IDDA 1AKWA 5JHGB 3T3PB 4CM1A 4NU8X 3L9XA 2NXNA 3K2BA 4M1EA 3ESZA 1YBHA 3JYLA 2INGX 3DPSA 5IARA 2PUGA 3H2GA 1KY5A 1V0EA 1PHRA 2XBMA 1L5OA 4G24A 4Q9KA 5HILA 4YJ3A 3IUJA 4ZI7B 3D3QA 1BCSA 3GH1A 3MRTA 3L1VA 4HWSA 4JB8A 2FEXA 2PLAA 1DKLA 4NU0A 2PLRA 2Y77A 2PZEA 4XVRA 2A0FA 3E7WA 3TI7A 1P9LA 3CRRA 1Z16A 1IQRA 2YV4A 2A7QA 3M6FA 5K3FA 3ISTA 2MTBA 1DTEA 3PUWA 3ONUA 1TA4A 3Q98A 2N1MA 3AV3A 3C7TA 3O8QA 3RSSA 3ZDXB 2VTBB 2YR0A 4WJKB 4YVFA 1XDZA 4ER0A 2JHAA 3X1KA 1XJQA 3WRXC 5BSHA 4IAOA 2A1TS 1LRJA 2J5XA 2GCIA 1L8XA 2K2QB 3LUAA 1D4OA 3D0KA 3GK3A 3M1AA 1ZJJA 3OPYB 4G5OA 1GVNB 4M1QA 4QZVA 1DKPA 3OJ0A 1NJ1A 5EZYA 1JAYA 2OHIA 3EXAA 3PFWO 4PQRA 2PFGA 2Q3MA 1PR1A 3EVNA 3HKDB 2WJGA 1PVDA 2QTLA 4YJKA 2HHCA 2P9CA 2L82A 2Z8XA 3GIRA 3Q7PA 1ZIYA 2P9QA 2PKXA 2PZGA 1JVBA 2JIZA 2V7QA 1T6XA 1XZKA 2QX8A 2R47A 3CNEA 1CERA 3GGPA 4JP8A 5ALYA 4ZT2A 4Z0PA 1JTEA 5JSQA 1PEDA 1AGXA 1HE1C 1JKJA 1LEHA 3DONA 2B83A 2O2ZA 3R3ZA 5CNMA 5BN5B 2J3KA 5KOIA 2DGDA 2QT9A 1Q1ZA 1JR4A 2ACWA 3EOZA 2XYQA 3WOVA 3SHTA 3ZNNA 1YNOA 3KWJA 2QD4A 4GLLA 2C9OA 4B6SA 3M5CA 1USWA 5CIWA 3SYRA 1NOIA 1HG1A 1P80A 4LYGA 4AZ0A 1X15A 4C6RA 4JX8A 1FQWA 5G0VA 3RTAA 2UU9B 3TZ6A 1CUAA 1JDVA 2OV3A 5E0KB 5JMOA 2BP7B 5KTSA 2WYOA 2CL6X 3TW6A 1FNNA 2EJVA 2BKVA 3KQWA 4ZVPA 2X5KO 1SKYB 3BMNA 3HJGA 1AG9A 3REQA 4F6RB 1LRKA 4ESEA 4RPGA 1PJ5A 5JH7A 4RD4A 4IMRA 1NE7A 2C9CA 3FJOA 3OJFA 1JU4A 4B44A 1D2RA 3A2LA 4WUTA 4BLWA 1P7ZA 1KO1A 2OVFA 3KD3A 3QHAA 4ANFA 3ZE8A 5JQWA 1E6UA 1DG9A 2J9RA 2A4KA 2Y9MB 3N76A 2BISA 2HK9A 1MAWA 5BT9A 3SVZA 1Y3CE 1TJNA 4HAOA 1NNLA 1WZUA 5FOUA 3UT0A 3IOMA 3HK2A 3N1UA 3PVSA 1QHNA 4S0ZA 2H85A 5F33A 4D4JA 1AO0A 4BTEA 5CT6A 3X1WA 2AN1A 2FWBA 2HMAA 1CBUA 1MPXA 1XCGB 1U7DA 1H1DA 3F5SA 3FPLA 4R8RA 5DHSA 1Z06A 1Y3IA 1D2CA 2H92A 5FBKA 5A5VA 2XA2A 5FOWA 5ED4A 3L1KA 4J2OA 3A2KA 1QZUA 1UMDB 2ATIA 4O6VA 1V26A 2B4KA 3HB0A 4PGAA 4RZ3A 2DULA 1BOFA 1T9ZA 2YY7A 1S02A 4RHFA 2OD7A 5J58A 1E5QA 1IIBA 4RPDA 3HWX1 4B3JA 3IE0A 4FUTA 1KXZA 5K0TA 2SBTA 2QVXX 3EYAA 4ZZ1A 2WU1A 1TKCA 3HCBA 4G41A 2GTIA 3P97A 1KOJA 1NRWA 4TRRA 4IFIA 4MV7A 1LJUA 2RJ3A 3I01A 3QY9A 4GE3A 721PA 1DRUA 4NSNA 1WJGA 1TW3A 3BK2A 2ZVJA 3K96A 2P0AA 1KO4A 1Z0JA 1G63A 3LF1A 4BJ1A 3BGWA 4C6TB 4OTZA 1WKCA 3H4IA 4BFSA 4KMSA 1JEYB 5JG7A 4L76A 2E7ZA 3AIMA 3BXPA 3WK5A 2H1FA 4G0NA 2GMWA 2OSBA 4MO2A 4KB5A 2GILA 2KB0A 4HTFB 4A10A 4CEHB 1VDZA 5U4XA 5THKA 2QJTA 1X1SA 2IEBA 2FP4A 1K27A 4TN1A 4MWTA 4ZIRB 3TZKA 4QXAA 3UCEA 2C5SA 3F9IA 4IDGA 1BEZA 1P0PA 4PHTA 2P3LA 5H9VA 3V48A 1TI7A 1RFLA 3PQFA 1EB8A 4JBNA 2HJSA 4LW8A 3OKAA 4KW7A 3BWDD 5E9AA 3C24A 1IOVA 4HDRB 4KQIA 1U3CA 1AUOA 2WAYA 5CLHA 5BSRA 3R0ZA 4AIRA 4CL0A 4UD6A 4QUAA 4TKVA 1XR3A 1C0IA 3G2NA 2RGAA 4PZAA 3D4NA 5E95A 4EFKA 5DS0A 1PRYA 2C2MA 2D62A 1IY8A 1DXYA 3CMAB 3N7AA 2F1LA 2I4IA 2O7RA 1EUYA 2QU8A 2AJDA 3A25A 3S28A 3L4KA 2BMDA 2PBFA 3PICA 3U81A 4D42A 3UOWA 4HNHA 4AK9A 1MB4A 2C9DA 2I4TA 3RS2A 1WHSB 5BNFA 4IDQA 4HVTA 3T3GA 1K08A 3PQCA 4BVAA 4DMRA 5F9FA 1ZESA 3QENA 1I6LA 2GBLC 1JZTA 4XUCA 3TD2A 4OP7A 2KBEA 1WBDA 1MOSA 2XCSB 4WJLA 1YX2A 1MR3F 1TTTA 1MXFA 3B5EA 1H6DA 2GFIA 5F3WB 1UXKA 2YXBA 3QPCA 5CW2A 3ZCSA 1MVOA 2REOA 1QJ4A 3NGXA 4YRLA 1DRKA 2ATEA 3HCCA 1KKMA 4L73A 4BPRA 1XDUA 2UYGA 3UWOA 4AECA 2IQ5A 3UMBA 4BWGA 3PE6A 4LYEA 3VTZA 1P5RA 4M9RA 3IPLA 2WZPP 2I67A 4R8VA 3WGVA 3VNSA 3AY7A 1MH1A 3D8SA 3I8SA 4M89A 4BMDA 4KYTA 5HCUA 4L5IA 3QVJA 4ED9A 1YDEA 1WSVA 2XD4A 5JRDS 1ABEA 4YAEA 5KYYB 3BL5A 2F90A 2FR8A 4PN3A 4EJSA 4Q4AA 5A7GA 2CVFA 1NKTA 5FWYA 2GM4A 1T5BA 2AQHA 1H8ED 1FC0A 2MT9A 1WOPA 1GZ3A 2RIRA 3SCZA 4YCLA 3VVBA 3K9WA 1ZFNA 4EH1A 2CMGA 3HJHA 3RKSA 4FR0A 3H9CA 2IEYA 5FD8A 1NI4A 1V5FA 4X97A 2Q8PA 3JR7A 4I0WB 5LBTA 5IVHA 1SULA 2AN5A 2Q46A 3K8QA 2FJ0A 1ZD3A 3OFSA 4MAAA 3DE7X 3KZMA 2YXDA 5IK2D 3UPTA 5EJMA 1E9SA 1YRQA 4QM7A 3VV3A 1WZEA 5JYBA 1J7JA 3EGVA 3FMGA 3QTTA 1MOQA 3MTDA 4LRUA 1BEUB 3K8ZA 1KNQA 1MAUA 3MS4A 4Z2AA 3PA8A 3JW8A 3T4PA 1F0KA 3TS1A 4U2DA 1ZC4A 3KYDA 4E1VA 4Z99A 1H4QA 4KV7A 1JLLB 4NHOA 1Y3HA 3FOWA 3FYCA 5SYAA 3SP1A 4IZ6A 5G41A 2M32A 2FRXA 2CLEB 5CA1F 4DY4A 3BE5A 3GIDA 3GSIA 1KQNA 1GARA 2P7HA 2OGZA 3GVIA 3LDUA 2OZLB 3IP5A 3LQRA 3EFEA 2FG7C 3A10A 1DUSA 1MX3A 2IXBA 1Z8NA 2X19A 4IVNA 4KTVE 4P4GA 3OF2A 4JBWA 5DBFA 4C0BA 1LUAA 3DZJA 3MJFA 2YTZA 4HYEA 4R3WA 1U8EA 2G8LA 1KR5A 4EJ0A 3HUDA 5FJJA 4ZGGA 2IBMA 1T34A 5HJ7A 4JKIA 2EW8A 3JZFA 1QGED 2FXIA 1YZUA 5CITA 1XDBA 3LX8A 1OB2A 3ESXA 3GA0A 3NXKA 4ZCSA 1OV4A 2XXJA 1KE2A 4AJPA 1U63A 4N18A 1FB5A 1E1RA 2PZAA 3LLSA 2FQYA 1CEYA 2GPNA 1Q0RA 1VG0B 2CNBA 4IWYA 4NBVA 4YECA 4WFKA 4YO8A 1DP4A 3FSGD 3RNOA 5J35A 3V7UA 3ZGVA 3NWPA 1GPKA 4E14A 3PBKA 4ND1A 3RV3A 1QU2A 3TLCA 5CA1A 3USES 4C06A 5KNCD 2GBCA 4R69A 4CT0A 2HW8A 3S70A 1EFVA 1H69A 1X42A 2RHDA 3VDNB 3W8NA 3WGNA 1RWOA 1U0GA 4J7XA 1WP6A 1SXJB 1YJBA 3QHPA 2JFQA 4ZEOA 4YY3B 2WG0A 4L08A 1M5RA 1T0PA 4EVQA 2HPAA 3OX4A 2QF7A 2IYTA 1GVHA 2A0YA 1IZ0A 3IESA 1V3TA 3L7CA 3R5XA 1Q16A 2YC4C 1KQFA 2YRWA 2GN1A 4GP9A 4KO4S 2IK8A 2Q6TA 4UCQA 1GKLA 1T6BY 1MO6A 2Y05A 4Z9BA 3TOZA 1EZ4A 3TQFA 4PLFA 1N2CB 1GPMA 1U4OA 2WC1A 2X8JB 1WBJB 3PPVA 3S1AB 2AZXA 3H7IA 4CQLB 1TGVA 2Z8YA 4G65A 3BULA 4DQLA 4FQ7A 5CRIA 4N4AA 3VOTA 4A8JC 2I03A 2WDPA 4E21A 1Z68A 2ZQ5A 2CEKA 3CZPA 3CCLB 1XFDA 5K03A 5EHIA 2G0NA 1E0KA 4N39A 4IR7A 3KJEA 4MDFA 1VBKA 3JRXA 4F4UA 5A2GA 2VHQA 3N8NA 3CD6B 2ZL6A 1B3BA 3LYLA 5AOVA 3UW1A 4IHJF 1FNCA 2XYPA 3E5MA 1FJXA 3F7TA 4YP7A 1UQRA 4BRZA 3AM5A 4QDKA 4LZPA 1N2BA 4HPJB 2HIMA 2HREA 4PSKA 2QT1A 4H3HB 5EMJA 2FEPA 1UK8A 1U0OC 2Q5IA 4WTOA 3BEOA 1S4MA 5JQGA 1GT6A 1K97A 1MQSA 4G4SP 1Z63A 4MK4A 1E9RA 1YVRA 1MABB 2H29A 3H5RA 3JQ7B 4I4IA 1ZL2A 4A8PA 5AW4A 1Y33E 4L78A 4KQMA 1JB1A 1Z5GA 2OR3A 3KZNA 2GEKA 1XD2A 3AUSA 4P2BA 4OMDA 4I9UA 1GQSA 2CEAA 1NVAA 1UMBA 4D26A 3VTKA 3IUMA 3L41A 2J3JA 2AEFA 2ZJ7A 2G4VA 1QQAA 2PIAA 3RDPA 4F91B 2CFTA 3HGQA 4L72A 1QPGA 2SKCA 1QTQA 3BXGA 3HCPA 4H7HA 5JPDA 3LA8A 4YN3A 5CM9C 4OCZA 3N6RA 4MQ5A 5EGSA 3A05A 4EF6A 4TKVB 4ER3A 4ZCTA 1O9BA 2X7JA 4E07A 2ISCA 1PW7A 3A0RB 1G8YA 4ZDKA 4DEYA 1P18A 2FFJA 3KEQA 1IPFA 3D6AA 2NO7A 3F6RA 1JLMA 2QYOA 1ECLA 1ZXLA 1ZONA 1K6MA 1PR9A 3EWNA 4XOTA 3EXIB 3LPDA 1QMGA 3SX2A 3VM6A 1E2HA 4C4ZA 2XUZA 1H23A 4R1OA 2AN3A 4R01A 2Q9AA 2QR5A 2IBSA 3OCUA 3SNHA 3FPPA 3T3IA 3QW2A 3DMRA 4NDNE 4JI1B 4OXIA 2OQIA 4GP6A 4RX1A 4XIJA 3S1LA 3V8VA 4WNCA 3LUJA 1TZMA 4AY3A 4XPIA 3QY0A 3KJZA 1F2TA 4NU5A 3NVKI 1O97D 2O8BA 4ZAVA 2RC6A 2XGJA 2YWFA 1USIA 3B8EA 4JLVA 4YCMA 3INYA 1P4AA 1RXUA 2XVYA 1NQAO 3GMDA 4P35A 1DXHA 2ILTA 4WY8A 5EXXA 4MJ3A 4MV1A 1OXVA 2O8NA 1IBKB 5ARDA 1G4UR 3DTNA 3ZXYA 2B1JA 2WJAA 2WTAA 4LWZA 2ZJYA 1WOSA 1GP2A 1YRYE 3FLBA 3GCZA 1GGKA 4GP7A 1B23P 5ALHA 4D9BA 2Y0BA 5L6LB 5CA1B 5D85A 4JOBA 2R6DA 3W2TA 4LS3A 2V55B 1MDBA 1MUUA 3PA6A 2HQBA 1GG2A 4Q34A 4PIVA 2B4QA 4F1WA 5AW8A 4Q7EA 3PFNA 2D2IA 1DFHA 4O2AB 1RTTA 2ZUWA 1O0CA 2XUPA 1ISHA 4HXGA 4TV8B 4EW6A 4UULA 1E7YA 2SKEA 1KNXA 2AUTA 1XCJA 5E4YA 1O9GA 1UBGA 2GEBA 2PQ2A 3DZGA 1FFYA 3F1KA 1UWLA 3K73O 4GEGA 1H94A 2G1PA 1U0SY 2AZMA 4V0OA 3ZDZB 2GXSA 3QWHA 1H2FA 2QQGA 3JATA 5KYGA 1HQCA 4J4TA 2ASVA 4Y6GB 4H7IA 1HNXB 3AQ4A 3CUWA 3OA2A 1DBQA 3D8TA 2IP4A 3FGPA 2QQFA 2H7VA 4G1UC 3UJPA 1DJNA 1JXQA 4JZKA 1HVXA 5IAKA 2E0IA 3BFJA 1BJKA 2ZVQX 1YK0A 4S05A 2V7EA 2V98A 3F46A 4MGKR 4W8HA 2HQSA 1W5TA 2P75A 3D8NA 3LUBA 3O4RA 4XORA 1N3BA 2AS0A 4NYJQ 1ZKDA 2P7IA 5TEVA 3EHEA 1BH6A 1R6VA 2PD4A 2ZT6A 3ORSA 3CC2B 1F2UB 3UJ6A 5K0CA 1XVVA 3W7BA 3EH1A 2W6CX 4F6RA 4G89A 2C3YA 4X7EA 1I2AA 4B4DA 1YHZA 4AF8A 1UZMA 3B7PA 3Q8MA 3NBMA 2BDTA 3T9FA 3SEFA 4LXIA 2CNWD 4CMJA 4E0FA 1BYIA 1G3UA 5IWCA 3K0CC 3E53A 1EVYA 1PJLA 1SOUA 1H2ZA 2DFNA 3H0EA 4G23A 3DHYA 4ZEWA 3VH3A 4PC1A 3AQIA 3LC0A 2XZTA 1GZ6A 2YBEA 2XOEA 5GGYA 1S8FA 1XN4A 2FUCA 2AEJA 4AXBA 5ALWA 1OB0A 5TVGA 3ZGNA 3TMKA 3RY8A 1UDXA 3DF7A 1JFTA 3NRBA 4UEJA 1W88B 2AHOA 4GR9A 3T9EA 1L5KA 1FVXA 4JBHA 1XJ5A 4OPSA 1U8TA 2O6HA 3GLGA 1MZPA 3X1DA 2GAIA 2BI8A 4GH5A 2G08A 4DQVA 1FVOA 2A3RA 3KTAB 4LVUA 1BHSA 1RD4A 1SCQA 2MSWA 2ZJZA 3NAGA 2VDJA 3V7FA 4B80A 3W05A 4XQ0A 2VAVA 4K46A 1IOLA 1PFWA 1K1EA 2YUTA 4K88A 2V5UA 3DF9A 3W9UA 1X8XA 2BELA 1CC1S 2Z4TA 3E61A 3QVGB 3SMVA 4BN4A 5KHOC 2I2BA 3ENKA 3OPYI 1E7MA 2WSLA 5IHPA 1KYQA 1CY0A 3FCEA 2NYUA 1NW7A 3LXXA 1OI4A 2CXHA 4UDXX 4E2FA 4DDKA 1D9XA 4JWTA 4F2HA 2Y6VA 1OWPA 2BEWA 3JD2A 3PCXA 3E8SA 4RA6A 2OCLA 4LVNA 1UJCA 1CE8B 1H05A 3G5MA 2EZ9A 4JAVC 3UMSA 1TDJA 2NQ8A 4KOEC 4U39A 3RS9A 3RUFA 2B7BA 3WS7A 4KDFA 4E2XA 1QHHA 4NCHA 4N3CA 3PD1A 4ADSG 1G8HA 2I6QA 1RCFA 5E9WA 1XGKA 2W6ZA 4KI0A 1NZJA 2FUKA 5CVDA 2QAGA 3CM0A 2C77A 1X8JA 2HRZA 3RIMA 4J0QA 3OQOA 2F62A 3IB3A 4H0CA 3URMA 5ADHA 2FPOA 3TWOA 1B42A 1C1YA 4IIGA 4OSOA 3ER8A 4N5LA 4D4GA 1SKBA 3K2IA 1Y5IA 2P4EA 2JJ1A 1TTPB 3OJLA 2FDRA 3LGAA 3ZD6A 1J1UA 2DEUA 3C14C 3CB2A 3HKBA 4NQZA 2G9NA 3CG4A 3TD9A 4C0XA 1OZ0A 4HUTA 5K8TA 2AJ8A 1RVDA 2CCJA 1Z6YA 2IL1A 1I0IA 2BEVA 3C0KA 3P0HA 3W06A 2IYXA 2G04A 1KK0A 1ADCA 1MF7A 3GUCA 1MBZA 3COYA 1JHOA 2ORWA 4FYJA 1B7GO 4O4HB 4WSOA 2O8CB 2Q2VA 2P9ZA 2X1VA 4JJFA 4OH7A 1W6RA 5IYQA 3GLGB 4FDVA 1U7XA 1HKUA 1VKZA 4XWGA 4MZXA 4C21A 2NV0A 3AY0A 4F71A 2J30A 1RZUA 4X84A 4QJ3A 1WDLA 1FU8A 5EMNA 3CS3A 3PGMA 1L5QA 3MUNA 4REQA 3C6KA 2J5BA 2EQBA 1TQHA 2HI0A 2GO1A 2OXFA 1W36B 5DNYB 4IO0A 3YASA 3IMKA 2VP6A 3ONWA 1FDWA 4LY3A 5FPYA 3WLTA 5JIBA 2Q3HA 4UBJA 2ONCA 3MB5A 3E9NA 4S1OA 5CFLA 3DE2X 1AS0A 5ES4B 2H1IA 4L85A 5TY0A 3R7DA 1YVPA 2WIJA 2O23A 2Y71A 1Z2PX 1E4EA 4K3UA 4W9NA 1RXYA 3WDMA 5H83A 4EB6B 2XXBA 3OLYA 3TG2A 3QKRB 2AC4A 4X92A 4JJKA 4XGIA 1JQ3A 2VUSA 4LG1A 3OQNA 3GLGE 2TYSB 3GAFA 2IUUA 1KVTA 13PKA 1MW9X 3HY3A 5AI9A 5GJWC 2ZIXA 1GUAA 3UB4A 4BWFB 4AC9A 1E2NA 3OX2A 4BXOB 1E8NA 1MVLA 2JZOA 4M3NA 5EJ2A 4P7BA 2A3NA 2CY0A 1EXNA 1OE0A 4WXYB 5EJGA 1KD1D 1GRCA 3LP5A 2HJHA 1MHPA 4E5MA 1W9XA 3AF1A 3SBOA 5JS1A 5EHGA 4MMZB 4CI9A 1XYVA 3EE6A 5I7FA 4BMZA 1W0CA 5ILOA 3WLFA 4FDMA 4OJMX 2M1XA 2FSIA 4JEIA 1EGQA 1NY5A 3IQXA 2DQZA 2JARA 3VH1A 5CH8A 4L2IB 1NP3A 4GKAA 1E4OA 3I3OA 4RHTA 3LY5A 5J23A 3E82A 3RUCA 3TOSA 2YXNA 3SKYA 1KMIY 1YA4A 2I76A 5JEDA 2OV1A 4S1PA 2UXCB 1EWKA 3JYQA 3HTXA 3NS7A 1R6DA 1T2VA 1K5HA 4CQMD 5IBCA 3QXJA 4FS8A 4TQGA 2GZAA 3WMWA 5KTYA 5JJLA 1PYOA 3RSHA 4YRRA 2GJ9A 4JT8A 2VQ3A 3DKIA 3BWVA 1SVOA 1HFKA 3S5JA 5G53C 1FNBA 1RS0A 4MYTA 3CQ9A 1ZUD1 4G0QA 4HUJA 5JNRA 4XKVA 4GOOD 3GZTB 3TK1A 4OYYA 3OMLA 4QAJA 3IOCA 2BZSA 3K0AA 4B4WA 2VAPA 2DIEA 3TECE 3AKDA 1ZISA 2BFAA 3STXA 4RJLA 4TYYA 3QLJA 4LWPA 3FUTA 4Q3LA 1U3UA 2A33A 2P6PA 1RXEA 2VBIA 1I6KA 1FBTA 3SC3A 3PCRB 2OEPA 4XLLA 1ZUNB 5FOVA 3RT1A 1ZM3A 1EDEA 1U3FA 2HDNB 4UARA 1O77A 5BNIA 1FYWA 4RHYA 5TGDA 2EGUA 2Z5LA 2WP0A 3N8GA 4MYSA 1L4YA 3ROQA 3IPYA 5F21A 1X86B 3I64A 4LI0A 3WNCA 4UZEA 1AZWA 1SR8A 2NO9A 3Q9SA 2PXXA 3ZIAD 3CH7A 3J81A 4ZI7F 1TT5B 2HOQA 3IAS6 1IB0A 4PSDA 1N1DA 3ITNA 4JNKA 2VCHA 1EFVB 1PL8A 5HW0A 1XV5A 5FA5A 3HWSA 1Y7IA 3KXPA 5CLQA 4Z4CA 3SR0A 4KBFA 2DB3A 1RQ7A 1YXMA 2HLNA 2Z2YA 3CNBA 5DDIP 2FLKA 1L1EA 4TLMB 3DD1A 1J8QA 1SVMA 1XPJA 2X7XA 4JSTA 4XTCS 3STVA 4L0DA 2ZR9A 5EIAA 4JJ4A 3VR6D 3H5IA 3HRKA 1AQJA 3BH0A 4IZHA 3OU6A 1HZZC 1F5NA 4XIYA 1NN0A 4F96A 3CKYA 3DHWC 1I7QB 4DM3A 3W8RA 2E4YA 4I5DA 4QDTA 3UW3A 2W6IA 4S1NA 2DRIA 4ROXA 5AYVA 3MOIA 3ZGZA 1QQTA 5KKAA 4G81A 3GJYA 2E18A 4RH0A 4JI6B 1C9EA 2QMUA 3THWB 4DA8A 5JDCC 5F9HA 1ZIPA 1T1GA 4ZI7A 3LBNA 5A71A 1M1YB 1JR6A 1DC6A 3CLSC 5BYJA 3SHWA 3MWKA 1RPAA 4JLNA 1H0KA 1CRPA 2JJ2D 2WQZA 3W8EA 1QIKA 1IL0A 4U7PB 2Z8ZA 5JTUA 1IH8A 1BLIA 3PJEA 1GNVA 4I5IA 1PJ7A 4Q00A 3I52A 4B1FA 2ZIZA 1JH8A 2PD6A 1XMOB 3VI3B 1WQ1R 4E1AA 3EPRA 4NBRA 1YBMA 1SXJE 2G9UA 1VJ5A 2YNMA 3L0YA 1L4BA 4X44A 5ABPA 1IXKA 2XT6A 1P60A 2DLNA 1YZKA 3KFVA 2WJYA 3ABIA 1IPEA 1VXOA 3GAMA 4RJ2A 1BROA 1T9DA 2OFXA 3BMOA 1SRQA 3Q5GA 4N3BA 4FEYA 1RRPA 1X6VA 4PX3A 5HCNA 2PYDA 2F67A 4FBLA 4I8IA 4JA2A 3IEMA 4WZLA 1VA4A 2QW1A 3ADBA 3F3KA 2UVQA 4JS0A 4RTPA 3GRFA 5EE5B 3IGFA 1Z74A 1LBQA 2GO7A 3GROA 3G4SB 3LT4A 4FQ8A 2Z5FA 3ZI0A 1DRWA 2OM2A 2AMVA 4G1EB 3WHKA 1RQGA 1RWBA 4CNBA 4PVDA 4YLYA 3F4LA 2AG1A 3IP1A 4RTJA 3GF4A 5DN9A 3O1LA 1PFVA 4QUEA 1Y9ZA 1CETA 2B2XA 5JLAA 3TE7A 3IEVA 2O3SA 4NR0A 1Z7YA 3PD0A 3RC3A 4EQ6A 4XDHA 1H2HA 3OFKA 3HXKA 3R6WA 4J1NA 1NVDA 4YK7A 5DNDA 2W8ZA 1ADYA 2OLKA 3MS7A 5ESXA 3LFHA 3RWBA 3UJDA 1NN3A 4MMYB 3UVEA 4D9GA 3LWZA 5KMGB 3EX7C 3VR4H 2XJ9A 4JLPA 3W3ZB 5IT9A 2ECKA 3K70B 2VQSA 2OBLA 5ICSA 2HMSA 1DTSA 2BAGA 2L19A 2H5EA 2QD2A 3GNSA 1SCIA 4DARA 4OBXA 1K4KA 2IYFA 4JITA 3NASA 1RAGA 5CB4F 4W1RA 2AR7A 3EG9A 4KPGA 4YJFA 1CF9A 3PQ7A 1GT91 2WMNB 4UAUA 2CUNA 5LZ7A 4AYTA 2AFIE 2I78A 2NLOA 1P8AA 2VS1A 1U4NA 3G79A 3VYRB 1GTZA 1UOOA 1EJ0A 1Q0TA 4AZ0B 4D25A 3QI7A 4UFOA 4YA6A 5SV2A 4EY6A 5KNDD 2A7XA 1TJ4A 1N5RA 1NX6A 1P7CA 1YZFA 1E1YA 1PG0A 4TS3A 4KSCA 3ADOA 2VCYA 4ZYYA 1ZOLA 1GRNA 2OTLB 1GR1A 4Q18A 5ARCA 1R0KA 2I87A 2R65A 3IPAA 5B3KA 4DBZA 8ADHA 3QITA 2OG2A 4ETWA 1V35A 1DELA 3AKYA 3CX7A 3BX1A 1UJ6A 1ZQ9A 2JLRA 2P3OA 2AD1A 3DDOA 3E9RA 1DG1G 2QYHA 4UAVA 5TF0A 3VNQA 4Z6KA 4HX5A 1XNRB 1GGVA 2D0DA 3RC2A 4G0WA 4P8RA 3STYA 2PKWA 3WGIA 3PTAA 3GVCA 4X54A 1OW3B 3VPHA 1M1YA 1FTGA 2QTGA 1V8DA 3P0EA 2JIBA 4WXRA 4UTPA 2PR7A 3MINB 2R00A 2GZ1A 4TL7A 2RG1A 2I6UA 3DNFA 4OBEA 5GJBA 4C3UA 3MRSA 2FCRA 3G3EA 1W2WB 5EIWA 4QJ4A 3I30X 3R76A 2UYQA 2X86A 3C48A 3UN1A 5AO9A 1U2RA 1XC7A 3OEHD 1VQ5B 2VZ9A 4IRMA 4MOWA 5EUCA 2ZM6B 1J8VA 4KQ1A 3TXXA 4RKEA 1Y3DE 3OY7A 1QGUB 3K9LA 4FJ0A 4KXNA 5ITSA 4UC0A 3TMAA 3FTEA 4J0DA 1KI3A 1OLSA 3C8ZA 1EA7A 3LXRA 3TL2A 5K0EA 4ND4A 4H4CA 4I9FA 4HDCA 4JLOA 1NMSA 3AI7A 3TAUA 1E3XA 2PD3A 3A4IA 4CR7A 4Q5IA 3RTDA 1UP7A 3DLAA 1VCNA 3T7AA 3JAWA 2PU5A 5IYPA 3IUSA 3L0ZA 3N2EA 2NN3C 3H2BA 3JV7A 2ZEJA 3C3CA 4FR2A 5T64A 4B4OA 1G5RA 1KIAA 2QLLA 3A04A 3NEJA 5TX7A 4BMVA 4U7TB 4PAWA 2H4XA 5IH7A 3T7SA 4DJDC 3CCJB 1OY1A 2ET6A 3AOEC 5TMDA 3IPCA 4GBED 3OPNA 3MLBA 4NZNA 7AT1A 2HJGA 1HQKA 4IH4A 4QWWA 2O7SA 4B7ZA 4CN8A 2XYRA 3AL3A 1JMVA 1SC6A 2IDMA 2R8RA 3HCWA 2GREA 1RYMA 1YZLA 3OU7A 2C2YA 4FKMA 2QP9X 4RPLA 2ZREA 5F7JA 2WQ6A 4UPVA 1DE0A 1VLHA 3QGMA 4YRCA 1OIVA 1QJCA 4MWZA 4KR0A 4PY2A 4ILKA 4L9SA 4I4CA 1P8JA 4ZWNA 2XNCA 1VMKA 2O1WA 4REMA 4E11A 1JDPA 1EGHA 2J3HA 1ECCA 3ZQ6A 1E3WA 1TPYA 2F43B 2Z4RA 3VR5A 2VK2A 4GC9A 1H8HA 4MAMA 3TRJA 1P9NA 3T7KA 4TWRA 5CVCA 4YREA 5E6TA 5IKMA 2JIMA 1RFGE 1ATZA 2AEMA 3KO8A 4HQLA 4NKRA 1DC3A 3SC2B 1AK9A 1N6LA 2C1ZA 4M0DA 2OHJA 5FTMA 4YRDA 4DV7B 3BQ9A 5A05A 2PN1A 4RCZA 3RSGA 4G0YA 4EIWA 4L28A 2LZJA 2CZGA 2BUCA 4KMMA 5EHXA 4Z9YA 2JGIA 1G21B 2MR5A 2BHSA 5E1OA 1ZSNA 1YR8A 2VDUE 1NULA 1RYDA 1NHWA 2EEPA 2VPWA 2VPPA 2FLWA 2P2NA 3E0QA 3LT5A 3AVVA 2RH4A 4I1OA 4QDOA 2YZMA 4QRHA 2KW5A 4RABA 1A7KA 3HPRA 1NMEA 3IP3A 4S1TA 1OAOC 1XRJA 2ZSHA 2VBFA 1YT5A 2OYSA 4GPBA 4X41A 4RS4A 5JZSA 1DO2A 5DLQC 4UUBA 2ZSAA 4NENB 1A9OA 5CJ2A 5K05A 3TKAA 3ADDA 1DC4A 1WKVA 1N7HA 3B3FA 3C6QA 1Z2CA 3L84A 4QDXA 4I9HA 4EW3A 3CZRA 2XUHA 5C1BA 3BIXA 2HMUA 1JBEA 2Y0DA 3K6JA 5C35A 1A50B 2B1QA 5GM1A 1V41E 1FRNA 1P0FA 1UKZA 3TMYA 2D5CA 1EBFA 5AI8A 1DBPA 4QTYA 5A06A 1YONA 2A84A 1QVZA 2EFGA 3FPGA 4U7WA 3TQSA 5EESA 3UJCA 1UMCA 3ZS9A 4MV5A 1BFUA 2NVOA 4QYMA 3SBEA 5FPSA 3M70A 4Q93A 5FA6A 1G8PA 1DO0A 1I7LA 1LK5A 3AMVA 3G1WA 4MCAA 4RY2A 2J59A 3NHMA 4KPUB 4XYBA 5F12A 5DM1A 5FFNA 1ZMXA 4OKNA 2FW7A 2REBA 2NM0A 2ZXHA 2ZXEA 3REQB 4EHJA 3L1JA 1Q2UA 4MVJP 3BILA 1T5LA 3U1TA 1X14A 4ZK6A 1GTRA 4KUEA 2E4VA 3HBAA 2R2AA 3EF3A 2X4LA 1DKQA 1MRSA 2BUBA 4Q1AA 4JN6B 2PRYA 3CCUB 4H6VA 1VLLA 1GSIA 3UB2A 1L5FA 3WQZA 2ZQZA 1JJFA 2C2GA 2H51A 2J3QA 4ZCQA 2BFEB 3LP6A 1FQJA 3LJKA 4DTIA 4AQ7A 3FA2A 3OM0A 2RHLA 4TMKA 2BGJA 5CB8A 3TRFA 1B8NA 2ZI5A 4MKXA 1T4BA 2R8BA 3VSDA 1KI7A 4O0LA 4HFNA 4US2R 3AVQA 3M83A 1VPTA 5LP6A 4JYMA 2P6UA 4BMXA 4BUCA 2I3DA 2WM3A 3MCAA 5DU2A 4CLOB 2Z1NA 3BHMA 2C4MA 4O4LA 4BUZA 1JQKA 1Z8HA 3NVAA 1C4OA 1SA0B 2DFPA 2DP4E 2DTEA 4HX2A 3UHJA 4FPXA 4BCCA 4GXQA 2O8DA 2VJYA 3EWIA 3KUCA 1V7PC 4MLZA 4PE5B 1WULS 3BD7A 1BMQA 4Y2QA 1ORTA 3P9NA 4LF4B 1CZUA 3IT1A 3RU9A 2X8KA 4C0HA 4G5FA 2BFBB 3WY9A 2W2QA 3RU2A 1IM5A 1ZX1A 1KQSB 2QRVA 5KX5A 5LXTA 2YICA 5K0BA 3SDBA 2IDJA 4XQEA 5BSVA 6ADHA 5FPHA 1GXSA 3TF5A 2V74B 3IQFA 1Y7PA 3ECCA 1COWA 4KQFA 3MT7A 3ZHYA 3BNWA 3N8IA 4S2EA 1L7AA 1ECFA 3R5HA 1TECE 4QPZA 2QRHA 3CRVA 3W9BA 2CWDA 2AXNA 4DA9A 4E88A 4AJ9A 1T8YA 4YAGA 2Q07A 3ISXA 1VI2A 3BWXA 3D02A 3N5CA 2BKUA 3S27A 3SXJA 3GLFE 1AVTA 1QB8A 3CNHA 1VYHA 3A36A 5HBGA 3ZY4A 1W44A 4HXEB 4ARZA 1QGUA 2CCKA 4XIIA 3F3YA 4JYPA 4NIMA 4V0QA 3ZCQA 4Q4JB 2RHHA 1PG5A 5CYOA 5AJXA 5LMNB 1IN8A 2ZYIA 1TU3A 1XZLA 1YB5A 2BSAA 2GX6A 2N1BA 1UIMA 2HNKA 4NYMR 5ALGA 2ZXUA 3OAAA 4L8JA 1JEOA 2I7TA 2TS1A 3H4MA 4P58A 3SC6A 4RTSA 2D1FA 3D6VA 2BR4A 4MKFA 1Y0BA 1QVRA 5IG2A 3CA8A 3O83A 2PO7A 2YRXA 4G4SO 1JYEA 5DSXA 3GMIA 4KZPA 2E5LB 3RNLA 2J0UB 1T2EA 3BH6A 5FR2A 3EFOA 4GI7A 3V3TA 2BUAA 1SK8A 2HU2A 2P1RA 2FFAA 1LI7A 1JG7A 2PUJA 4PLYA 4X6XA 3P2JA 4PZUA 3V7WA 2RMKA 1P2DA 1D07A 1S2NA 2NTNA 3P52A 4CBVA 3GPCA 1IWPB 3RS3A 4IPTA 1K8ZB 3FYUC 3PGXA 4MVWA 3BREA 1RXSA 2WM9B 3JZAA 2I4OA 5TEWA 5EAIA 5IYNA 1GTSA 1FTNA 4OQYA 4RA6B 4U6NA 4LF5B 1EDBA 1XZDA 3P8ZA 3FCYA 8MHTA 4GM1A 1W0KA 1Y63A 2QTCA 5KAPA 2WFMA 1M73E 4KWHA 1ENZA 2I2WA 3W2FA 3L4BA 3CTPA 1A71A 3PHBE 4P4NA 5BSUA 2VJKA 4WT7A 2AIRA 1AZLA 3FSEA 2WYUA 3FAZA 1H9BA 3QXCA 1VQPB 3WGQA 2J8ZA 3EAGA 1E2JA 3GUHA 3SE7A 4W5QA 3RAFC 4C30A 1F2UA 1KEWA 1SUPA 2HUPA 2XNDD 2YUIA 2ERYA 2IHKA 3PX3A 3K0FB 5MFPA 3IDFA 1ZMOA 5F64A 4M7OA 3LY8A 3QF4A 1YFLA 1SVIA 2IYVA 3N2IA 4DHEA 4ITVA 2XY4A 3IOYA 4RPHA 5IRCD 4BBZA 3C7DB 1J5XA 3I56B 1LDNA 1UT6A 4OJKA 1PTJC 3T5CA 3WLOA 1NB0A 1QIDA 3W9YA 3FNEA 4S35A 4NEGA 1Y5RA 1Z7GA 3CLUD 1G8SA 1KYXA 4EEZA 4DNXA 4WZBE 1KF0A 3KDSE 1K0FA 1VHTA 4JCOA 3UA3A 4MICA 4EAQA 2GJRA 1C9NA 4XD2A 2P9HA 3DR3A 2WFLA 5LYJF 3ASPA 4OOXA 2CFIA 2I6FA 1B8UA 1ANKA 4Q02A 5LLDA 2V6JA 2ZKLA 2OZVA 2VSOA 3L77A 2CD7A 1XMIA 2WFAA 4AKIA 1M2EA 4AKHA 1XZGA 1BN6A 2QTVB 4OQMA 4XOUA 3RG8A 3RVNA 3I61A 2O1EA 1SN7A 2H18A 2XX3A 1E2KA 4A6XA 5TQ0B 4OQZA 4X6UA 2LKCA 2DR2A 3EG5A 1D2EA 2GK3A 1OOEA 4IH9A 5IT0A 5GQSA 5DHQA 2NU7B 4X1IA 4GPEA 1A8UA 3TGPA 1MGPA 3CMCO 3OPVA 4LJSA 4P08A 5EUBA 3THWA 4PWZA 4MYCA 1KETA 4E12A 2I4RA 1F8YA 4P3NA 1J99A 4O33A 3T3OA 1JQBA 2CYBA 3DW3X 3RRJA 4ALMA 1XXHB 3BKXA 4YMLA 4CLRA 4PPFA 3F2IA 3HSSA 4MS3B 4QO8A 3A26A 1XD8A 5KTPA 4ARIA 3C6ZA 2VF5X 1I3LA 1TLLA 1WCIB 5EXPA 3KQYA 3V4FA 4QQRA 4WZZA 1R0RE 1HZZA 2G72A 3WZMA 2IHNA 1YR7A 1QIGA 1NVWQ 3HPQA 1OFHA 5BSYA 1U0NA 3TLZA 4WBNB 2WSIA 3NPMA 5U4QA 3PDJA 3KV3O 1RYYA 1FDTA 3OFNA 2XBLA 4FWBA 1JEQB 5AKLA 4UE3S 4BE7B 3WYFA 2WK1A 2ZYHA 3G89A 1XA3A 2ODEA 1M2JA 1Z4PX 3L8FA 3ADCA 2GAAA 1L5NA 3PQ6A 1G8MA 1RZ3A 3FYUB 4I4LA 1QE0A 1WDMA 4TUYA 3WIOA 2AFHA 1FLVA 3AI1A 3D3EA 3FUXA 3MWLA 3EVFA 1CRQA 1YUBA 2ZRLA 4V0NA 4BYGA 1JFFB 1VKOA 2GKOA 2ISSD 3G13A 3HKEA 3PVZA 4GRAA 2RHWA 4OYRA 2XQGA 3UH1A 4AF7A 2WAXA 2WF7A 4MKHA 2C5AA 4CLDA 1KP2A 3EAQA 5I7WA 4QQFA 3BB1A 1SH7A 4M9CA 4LSZA 5JJKA 3KZXA 1L5GB 1IBRA 3LX4A 5LXTB 4C2TA 3RSOA 4BLUA 4G3XA 1VP3A 2EF1A 2G7ZA 2RB5A 5E3IA 4HSGA 3NORA 3B6ZA 3LYUA 1UBRS 4K3VA 2DHCA 3FPHA 3RG2A 5EP2A 5AVTA 1QH8B 1BQ4A 4F6LA 3W5JA 1OHHD 4DQXA 4KR7A 3AG5A 4F5YA 2PZJA 3OX3A 4QUBA 5JJBA 4GOMD 1QK3A 3AB8A 4HBGA 2VQEB 3V00A 3GMTA 5JYCA 1T5EA 1TAGA 2HJRA 1HA3A 2GZ2A 1T5SA 4CEJB 1QRTA 1AQYA 1R27A 3MJDA 4KAJA 2NU9B 3LQEA 1U2TA 3T5TA 3WHLA 4WOKA 1WNTA 3BD8A 3HR7A 1XEWY 2PUFA 3FUCA 2IZ1A 4G5QA 2OQVA 3TR6A 1VMEA 4BAGA 1Z2DA 2PT5A 4WKGA 5AUQA 2BW0A 4UHFA 2JLUA 2ABWA 1K8YB 3EMBA 2W2KB 4IOKA 1CQZA 1F12A 3DCYA 5BN4A 4GF5A 3TBHA 2BEVB 2PY6A 4UEWA 2XE8A 1W87A 3ZZ1A 1OX4B 5CVVA 3K9GA 4DIKA 1QVAA 2CHEA 2IWRA 2QD5A 2QN8A 4UOEA 4TL9A 3DLCA 1X8LA 2VH2A 1EU1A 2XLCA 3FPAA 3FHOA 4XGKA 4Y2VA 3UV7A 5JANA 4JH0A 4BNGA 3CVVA 5CG2A 3R8FA 3GOHA 5DF1A 4EF4A 1Y4SA 2DSTA 2J46A 3CLTC 5EWMB 2OLJA 4B74A 4DBLE 4EJ2A 1SQ0A 2RFLA 5JNSA 4IGIA 2HU8A 1SB8A 3R0QA 5A0TA 1SZCA 3I53A 4Q3CA 2FDXA 2AMFA 3ETCA 1NMXA 1UMCB 4OU4A 4XCVA 1EFUA 4GSYA 4MQBA 4V24A 3RANA 4ZOQI 4BEVA 3K71B 3C7KA 3HFJA 3VNVA 1YL5A 2PX8A 3IODA 3RUDA 3QA3E 1DARA 5HX7A 1T5IA 1VI5A 5JSKA 4RF3A 4EA7A 3TPFA 2J5RA 2FVXA 3KOMA 5IMSA 4YB8A 4PX5A 1ABFA 3EXHB 5CAEB 3W3AH 3LRXA 2W00A 3RRYA 1I7SB 2ZIVB 1WO8A 1XLTA 4W7SA 5DNWA 2O20A 3MQFA 4AM8A 2IPAB 2P79A 1S1CA 3IHKA 4OQEA 4EFMA 2VSNA 3BFKA 2J4FA 4ARVA 5B3AA 5HFJA 3F6EX 4JASB 4DN6A 5I01A 4ZQFA 1NJID 2VZLA 1F0YA 1NQWA 4JMLA 2SECE 3JQRA 2V59A 4WLFA 1Q2XA 2JFZA 3A4TA 3C4VA 3JQAB 4I2NA 4KZKA 2WT9A 4N82A 4A91A 4DLLA 2CXNA 1IMJA 1KQ3A 3NIGB 1YIDA 1PNOA 1VLJA 3DMDA 1QORA 2J0EA 4PU0A 2HM7A 2W6QA 2JCXA 4N5HX 4LYHA 1YI8A 2G6BA 1U5BB 4QJBA 5LU9A 1CUCA 1NXWA 3CKLA 1EUCA 3DMTC 3NHFA 4L2IA 4G0VA 2VK4A 3UOAB 1UCFA 3PXXA 5ARBA 3DDCA 3PK0A 4KVAA 3SZGA 2PKRA 1KBQA 4GKJB 4B3BA 2F9MA 2ZTVA 4DLTA 4ENPA 3CEHA 4RF5A 5C1IA 1QCDA 2WZQA 2WILA 3E1KA 4OI0A 1NB9A 1KZLA 3VYWA 4EB8A 4BVLA 4HB2A 4EVIA 3UTDA 4YP1A 3RVSA 1L4EA 4WCFA 4CUJA 3F6CA 2NXEA 5EEGA 2I54A 3HJAA 3M9WA 4IP0A 4NBNA 4DSTA 2F1HA 2VHVA 2ZB2A 4MA4A 1KAEA 4GPD1 1ZVMA 5DWDA 1PDOA 1BMDA 4L0QA 2A58A 1FSGA 1HOXA 1ST2A 1G18A 2PQ0A 3FNHA 3GNTA 4NX2A 2VP2A 4XARA 3TIVA 3UUEA 2ODPA 3WO0A 1YR1A 2PX3A 3EAFA 1I1HA 1XKQA 2HMWA 3EW7A 2BBTA 3HRIA 5EKDA 1GAQA 4IOMA 4D9HA 3NHZA 1FZTA 2WU3A 2HJWA 1KA9H 1SKUA 1JLKA 1LQ2A 1K89A 1SNYA 3K5WA 4IG4A 4IS2A 4LDRA 4QEDA 1JHDA 4XX0A 3LIPA 1WU7A 1RC0A 2EFHB 3B2QA 3O1HB 4GBMA 4IKOA 3U60B 2GJKA 4ASUD 1GPNA 4POOA 3LBYA 1RBMA 3T3HA 2PXCA 1UBJS 3FFBA 5DYYA 4M8IA 2JAPA 3FNBA 4EPXA 2NG1A 2YHIA 1WPRA 3LUGA 4DIEA 2X3FA 1YFKA 1IM2A 4BFUA 2IYEA 3K9NA 2A57A 4WNIA 4GICA 3VO9A 1HURA 2CJPA 5CNIA 1ADFA 2EIHA 3AJRA 1L1RA 2GF9A 1XMQB 4R54A 3NVMB 2OGUA 4BX0A 3BWYA 2W83A 4K9QA 4N6GA 5FOXA 3FN4A 5LFAA 2JEZA 4EI9A 1W9HA 2QJFA 2E6UX 4EM6A 3ROPA 3KQPA 1W1UA 1EMDA 2WYHA 2O0KA 4J9VA 3RIGA 4GZLA 2JGAA 4BO0A 3C1TA 3LGXA 2VJOA 4JT4A 3R7FA 4ZKDA 2O2GA 3KK0A 3UB3A 4P6VF 3WNZA 2PUDA 1HDXA 3A58B 4DLWA 2D3NA 4KWIA 3ENVA 5I51A 1JXOA 3CT6A 3ZBQA 2VA8A 3IDAA 4U6QA 3CURA 3K30A 3KE9A 3R5FA 3UWSA 1BVUA 3MAJA 2P90A 1T91A 4LMBA 2ZOSA 2CL7X 5H5JA 2V8BA 2X42A 4LHEA 3QYAA 4K6FA 4NNPA 1OZGA 1W5AA 4HEJA 2ZS8A 4QOFA 1RKUA 3KEFA 3QEJA 1VB3A 5E1DA 1FYDA 3ZE0B 2H5JA 5F23A 2P67A 3W6PA 1NRJB 2YWHA 2G83A 3CCFA 4AJ4A 2R0QC 1U7OA 3FNRA 4F3RA 4UEOA 3HABA 4P5PA 4ESVA 1T4MA 3QVOA 2IY8A 1TJYA 1OWMA 4DNTB 3BRSA 3I6ZA 2QM7A 3KUDA 4IIHA 1KOGA 2AG5A 3JQ9A 4GE0A 4E51A 1J24A 3BL6A 2FMFA 1BMFD 4FZ3A 5FTWA 5BUSA 2CHVA 5D6OA 4QFMA 1M2OA 2VDOB 2YHIB 4X64B 2GOYA 1JQDA 3WWOA 5IAEA 4XQGA 4KVZA 2GDJA 4B83A 3P2YA 1XALA 1YJXA 4C0JA 2H2WA 2PS3A 3L7KA 3RYIB 2P9BA 2GF2A 4OQPA 4R31A 3BE6A 1RRGA 3GFQA 2GTHA 4C5AA 2ERXA 2VP9A 3MINA 3DZHA 4PYMA 1KI6A 3GV0A 1VL6A 3QVUA 4YP5A 3UGQA 3VJMA 5HZHA 4F45A 3REOA 2D06A 4FUQA 3INNA 3N8HA 1NHGA 3HDGA 3KJGA 5LQUA 2OHGA 1ELOA 3NHAA 3SS8A 1HZEA 5BUCA 1CJCA 3IELA 1Q6ZA 3NFYA 1SAYA 1YZTA 4KREA 2H7YA 1DQSA 3HDTA 2BBOA 4OI2A 1T9CA 2ZJ5A 4O1MA 5B30A 3EZYA 5TDHA 4Z54A 2G09A 3MC1A 2IXGA 1R4NA 3OZRA 1UT8A 2DWQA 2I1VB 4BFTA 2UZ0A 5H4HA 3TLBA 5FWNA 5IUNC 1G7SA 5EJ9A 1L5LA 2VWPA 4HGOA 2BP7A 4TL6A 4BL5A 4M9UA 1MNAA 1GKYA 1SO8A 1ZAKA 3FCUB 1E9BA 5ELXA 5F51A 2O5RA 3WLNA 1Z6GA 4HAYA 3L5OA 4UE2A 4NK4A 3EQ2A 3JARB 2QIOA 3CT4A 3E5NA 3IVCA 2FZ5A 3V4VB 4B32A 1NRIA 2FV8A 2Y6UA 2IYAA 1DXQA 3NYRA 4JB3A 3FMVA 1DFGA 3BWCA 2GEJA 4MTLA 2O06A 2HB6A 4N8EA 4OGGA 5IM4A 2BFCB 4L22A 4X20B 1SBQA 1U6JA 3LO5A 3ESAA 1H85A 3SS9X 3HU1A 1I6WA 1R0LA 4JSRA 1WVMA 3N07A 4CF7A 2WHYA 4Z4VA 4KIFA 4CQMB 2J7PD 3UG7A 3CXCB 1LNZA 1RW4A 2ILVA 1KMHB 1Z37A 4NENA 1UKBA 4PLHA 4ZQHA 2TMDA 4TVBA 2BGWA 1E3EA 3O2QB 5BUZA 4D0SA 2YS6A 1GTVA 4CF4A 1IDOA 4YCAA 3U3XA 5KUTA 1A4RA 3JRWA 2H4ZA 4X05A 2H2HA 4FYXA 2ZL7A 2IDKA 4LOHA 5JSFA 2DBQA 1JU3A 5FNVF 5JNWA 1XA4A 1ILWA 3E9QA 1UKAA 1W0JA 1SHJA 4ZO9A 5JZMA 3B1WA 2KVOA 1Z0DA 3MUEA 3B1KA 4O25A 1K9MD 3OKPA 4DT1A 1ORHA 1QIEA 2OESA 1XD9A 1YCGA 2PVSA 2YZNA 1DC5A 3BGSA 3BQNB 3SHVA 4AMYA 4DDVA 2Q29A 3SEJA 3LZ6A 4RLHA 1RNLA 4TQAA 4BZQA 3J80A 1QLJA 1YZGA 2PX0A 2VN8A 5TQVA 1JGTA 1MC4A 3EGOA 3OURA 4ATNA 1SOMA 2EWWA 2C8VA 4PQYA 4YAOA 1OVGA 4WOCA 1GJRA 4NBWA 3OECA 4LZLA 3TKYA 1C9JA 3HY4A 5TGZA 3OJWA 1ZVKA 4BO8A 2IHTA 3VI4B 4WK0B 1E3WB 1D03A 3K5HA 4TXNA 3WLHA 4P0PB 1Y4UA 2BR5A 3VC3A 5CK4A 5H3LA 4AQDA 4TXLA 1X70A 2OHFA 2CFCA 2C0CA 3HHPA 1FOEB 4BBPA 4DUYB 3C6YA 2ZIFA 3VH4A 3NBXX 4KNYA 1XI2A 3BICA 3RGWS 1A95A 3VPFA 5CLJA 3TB6A 1CZHA 1PK9A 1Q3HA 4UU7A 4WXHA 3OZBA 4V0MA 2IP2A 4ZI3A 4TKUA 2GLXA 3HA2A 1E2IA 1XWFA 1YRWA 3BMQB 4EPRA 4MWGA 5I7EA 2Q5FA 5BXYA 2HMVA 2EBWA 3HXTA 4Q1EA 3FHLA 4CMEA 4D80A 5NULA 4M54A 5DISB 5C52B 1YZHA 2ZE8A 2YVQA 3F97A 3Q5EA 4G84A 1FFAA 4BNHA 4I6GA 2F8SA 3UFXA 3RE1A 2VPIA 2C0PA 2FW6A 2Y2VA 4M88A 4V0KA 2QV0A 1VG9B 4WRRA 3DLBA 4L9AA 5GV8A 1T8UA 4CTMA 3B1FA 2FQ1A 3LDAA 1JFFA 4N5IX 2WLTA 5FJIA 3VPXA 3A9RA 2P77A 4CU2A 2OPBA 3R6JA 1WXGA 4F2DA 4PYLA 2RGGA 5JSYA 1AB6A 3FHCB 3QNUA 1P74A 3AR9A 3O2NA 3PS9A 4QOHA 5BNZA 5FLEX 1HGXA 3UWKA 3I1FA 1R16A 1ZHOA 2W2LD 3COZA 1PNVA 3PEFA 4FFOA 3DO5A 4LRQA 5EKUA 4CGZA 3LXUX 1JKXA 1RQLA 1W85B 1FA9A 2ZVPX 1QBKC 1O89A 3AZQA 3BD9A 1GZ7A 4RV5A 4FNAA 1RIIA 4RJKA 4MAFA 5F9MA 5IAJA 2BGKA 4MV3A 5IXYA 1R0CA 3AIOA 3KHUA 4MX8A 1I4EB 1LLUA 4TXJA 1TF5A 1EFPB 2AR0A 1KQGA 3CJTA 1K8RA 4IRUB 1HOTA 3IR7A 4J43A 3ICPA 2ZAMA 2RKBA 2RAVA 1A4XA 1DX4A 3S99A 1MLDA 1CP3A 2A5YB 2NPOA 3HEBA 3JARA 3QX8A 4PHGA 4ZOEA 3W77A 4G0UA 6LDHA 2PLFA 1ISSA 1J22A 1D1TA 1V0JA 2ID9A 2CXOA 3NO4A 3D3WB 1GFIA 4FFSA 1I7DA 1KAHA 4MRAA 4XM2A 2GLTA 1LDBA 3A32A 2UZ4A 1E4VA 5DHRA 4B33A 1X7WB 3FE2A 1VIMA 2EHJA 1L7DA 2ON6A 4ESOA 5MN5A 1Z5NA 2OAGA 1AQLA 1QQ7A 2Q4EA 3LBFA 1MO5A 2QAGC 1HT3A 3GFSA 1MX5A 1IBLB 2H9YA 5CNKA 2BM1A 1F8GA 2WIBA 2XUJA 3H3JA 3LV8A 1Q84A 4UNPA 3QFCA 2QUIA 4NS4A 1NUTA 4X8MA 4B45A 2MYNA 4CTKA 3NBYC 4EI7A 2F4NA 2VT6A 5J40A 1V11A 4F85A 1YFJA 4UBKA 1TD9A 4Y9DA 3L0CA 4KO8A 3J7TA 5CGZA 1CUVA 1HMYA 1K6EA 1DAPA 1OFVA 2NUAA 3DUFA 2QENA 4R2KA 5FUYA 2REXB 2EYQA 5FEUA 4P0QB 2D1SA 4LFCB 1D1PA 3A1SA 4OJTA 4Q4HB 3EQZA 4KITB 4L0MA 3HJFA 2RGXA 3WLRA 4W8GA 3IV9A 4AJOA 2P62A 1Q5PA 2F3PA 3OX1A 1YMVA 4IFEA 4AUNA 4CMIB 5J2UF 1SMKA 3KTDA 4TV9F 1KPIA 5IJ9A 1PTKA 4UVEA 5TV2A 3OH8A 4INJA 1XELA 5T5QA 2Q9CA 4B34A 4N48A 3NBZC 2N75A 1VZ3A 5DTJA 5K4HA 4PGOA 4BO4A 1T9KA 3NAMA 4V1CI 1J8MF 3HM2A 3ZLUA 3RCBA 2Q1WA 4OSEA 3DP9A 1KZHA 1ORIA 3B1JA 1G5QA 4LI3X 5BSEA 2LCIA 1BFKA 3WLJA 4BQQA 3H6KA 4XN0A 1F1BA 2VDRB 3O94A 2P4UA 3N0RA 3GGDA 3OLQA 4I50A 4LJLA 2VI5A 4HIZA 4QA9A 2YMQA 1EI9A 3MRVA 4EPYA 3VSCA 5FTLA 4LXQA 3IULA 5LJIA 4K1XA 1YZ3A 1TEXA 2C2XA 1G2QA 1T0BA 2Y27A 1Z29A 2QRKA 1TVKB 3QOXA 2YMLA 1VMAA 3QPWA 4LKRA 5EYPA 2BIFA 1FJ2A 1GUYA 1ZGAA 2BH9A 3AFHA 3DTVB 3OZVA 3SM3A 3WWYA 3EZ7A 2ZYGA 1E8DA 3G8BA 4HOYA 1X1TA 4F97A 2XVXA 2UXDB 1S3FA 4DMKA 4LOJA 1H1LA 1V7ZA 2HMTA 2Z2ZA 4GUAA 2NACA 4XAQA 2DPXA 1T3GA 4RFSA 3TRDA 2DSNA 4WKCA 1PBTA 1SUDA 5EZSA 3TOXA 3DE6X 3N0WA 2WKWA 5KNCH 4IOLA 1HE4A 3VU8A 4AJKA 4U02A 1UBHS 1A98A 1X87A 3L1UA 4N7JA 3TTYA 2V7UA 4RZQA 2QW0X 3HWWA 1VE3A 1TCCA 4MI1A 1U2EA 4C0QC 4E2ZA 3EFOB 3LQ4A 5B6JA 1XG5A 2OGSA 3OQIA 4HUQA 2OE2A 5CVEA 5FPTA 5SZJA 5FWAA 2IHJA 1AUPA 1PR5A 3IRUA 4HG2A 3QFTA 3OSUA 4P82A 5KSPA 3SJUA 2I3BA 3TM5A 2HHHB 2AI1A 3ETNA 1Y9JA 2VWQA 3EZ2A 2C83A 1D3AA 3DXXA 3VDQA 1PL6A 4AMBA 4R0NA 4CM5A 4ZJYA 4NHEA 4G7WA 3BF8A 2RK3A 5K4AA 1Z0SA 1DEXA 3OQMA 3OA0A 4TT3A 2HEIA 3TQRA 1KI4A 4JLJA 1SCJA 2IW3A 2SNIE 4Q7KA 4G4GA 3TKLA 3QFRA 3TM4A 3FDJA 1W5SA 2EXXA 4QC2A 5B55A 2AR9A 4M2LA 2VRCD 3MM4A 5HQ3B 3D3JA 1BS1A 1RRFA 1VJSA 2ATVA 2V03A 1QP0A 3D7LA 1V16A 4MP8A 2XEXA 1R4ZA 3QVSA 3DH0A 4MR8B 4TWZA 3UGKA 2DAPA 2CJFA 2AWNA 2DFDA 1VF7A 1SCUA 4XYGA 3ZIUA 1F2VA 1PVVA 1UD2A 2YJGA 3QKWA 5BY2A 2OBRA 4OA5A 4WFIA 3X1XA 2CFOA 3GT0A 1J9ZA 4BNDB 2I22A 3B6IA 2AMLA 2VT7A 2IYYA 4TTQA 1NR1A 3ZQKA 1KHHA 2LNDA 3P2KA 4MB0A 4ZC1A 4CFSA 2OZEA 5ALIA 4LRXA 3HEAA 2BEUA 1TE2A 5DHUA 3CW8X 3P9XA 1JSZA 1VCMA 5LDDC 3CC8A 2PK3A 3I09A 1CJVC 4GLOA 4PLCA 3PRYA 2QB5A 5AXDA 3RVOA 1RZVA 1JDJA 3H5VA 1BG6A 4X6LA 1MVNA 3QLUC 3QQ5A 5LP6C 1T5DX 2C3MA 2ZYVX 1NDQA 5A5GA 4YYZA 5KYUA 1E5VA 3MTGA 1JYFA 1NVMB 3JTEA 3KE8A 3L6UA 1B00A 3C3AA 4H6WA 5SY6A 4BATA 4CN9A 4ZYXA 1OZAA 1RJWA 3LH5A 1N32B 3NP7A 2YWBA 1E5XA 2JFPA 4IV8A 4HEQA 4UAJA 4NEHB 3DBRB 4PAGA 3R0XA 3PXGA 3ZWVA 2POCA 5LWHA 4K6MA 4TKLA 2P5YA 4I55B 4QGBA 2XECA 3H2IA 1G9SA 2W0MA 1JEYA 1SBIA 1CYEA 3FUWA 1B14A 1YVUA 4BQOA 4DLNA 4F04A 4ZCMA 3JWIA 2Y67A 2G07A 1P44A 3G2IA 3T1TA 2I9PA 3IJ5A 3OC6A 1P61B 2GK7A 3QOWA 4IXWA 4MW2A 3TQIA 1R0SA 1TM2A 3ZX4A 4RL6A 1XEFA 3WIDA 4BVJA 2FP4B 4FFBB 3B38A 1T6YA 1F1JA 3JQEA 3A4VA 2HA5A 1NYRA 1XWWA 2MSEB 2QSYA 3Q10A 3HFGA 4RKYA 4DSAA 5FLYA 2HT6A 3PCTA 5G1PA 5HP4A 1PFKA 3A8JA 5A4DA 2H6EA 4A92A 1R66A 2O50A 1C3OB 1HE5A 1NLZA 3PYLA 1J8YF 3ABSB 4QGGA 4L16A 1C4WA 1A5SB 1S8OA 1EDOA 1OJ7A 3KQSA 3I72A 4M7RA 2CCGA 4UOQA 2C5HA 1KJZA 2CXSA 4K8RB 1BDBA 3AXSA 1ISJA 5F4ZA 1I3NA 2FMHA 3AM4A 4H4EA 5TQ2B 4IZOA 1D7OA 3NGLA 5BN5A 4E5NA 1UQTA 1VHQA 1O6CA 5FO0A 2G6TA 4K26A 3V32A 2GD0A 1E0DA 1Z4NA 4CKBB 1KJWA 4J7AA 4NFLA 2QRUA 2FP3A 1LW7A 3GLKA 3CH4B 3JD4A 4YNBA 2XUGA 2QQ5A 1DCKA 3CP2A 3HKEB 5KOJA 3GFTA 5KKCA 1AMUA 2O8VA 4UBLA 4RY9A 5WRFA 3L79A 2FTKE 2GJAA 2A94A 2I62A 3KT3A 2ROQA 1KYIA 1V3QE 4LQLA 3DDUA 5BMVB 4DQKA 2X8BA 1PJ6A 5CXUA 2C00A 4II7A 1W19A 1Y3AA 1YS6A 3I2JA 3LCUA 2ODBA 4MO9A 2IYPA 1P72A 2H1WA 3IKJA 4EJMA 1LNSA 2WF5A 4J3NA 1RLMA 3KVNA 2WEKA 4UDYX 3K6SA 1KFKB 2GPWA 1N36B 1LWNA 3ZIAA 2PSDA 4MW9A 3VX4A 3UXMA 4BJ5A 2OUKA 2EZUA 2R1TB 3D0OA 4PCLA 3QX3A 4Z4WA 1YR2A 3AO0B 2EFCB 5L4SA 4NOMA 3H6GA 5FX2A 3O4IA 1PEAA 1S3SA 4GLBA 3AR5A 5GADl 4NOLA 3EVEA 3P0FA 4FX5A 5EZYB 3KQUA 4BQFA 1WXXA 4MV9A 5LP6B 2GETA 3TW8B 2IZZA 3W7VA 4MGZR 3UFXB 1EP2B 4O4LB 3OKXA 2Z09A 4HLUA 1QZZA 2JCSA 1A9RA 1ZPDA 3O8NA 2HD4A 4C89A 3BTVA 3U31A 1FCJA 3ZCXA 1NC1A 1PUJA 5FOTA 5D5HA 4R2MA 1HYEA 2YS7A 4WY2A 3NETA 2ZSBA 3ZLBA 1T4GA 1P62B 3Q1LA 4CRWB 1D1QA 1OLXA 1P0IA 1VL2A 3FIUA 2QKYA 4JY7A 4IIFA 4G9GA 4KN9S 4M87A 4Z4RA 4RQBA 5FBZA