1E63A

Ferredoxin:nadp+ reductase mutant with lys 75 replaced by ser (k75s)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
295
structure length
295
Chain Sequence
b'DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPESLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN-NADP+ REDUCTASE
molecule tags Oxidoreductase
source organism Anabaena sp.
publication title Structural Analysis of Interactions for Complex Formation between Ferredoxin-Nadp+ Reductase and its Protein Partners.
pubmed doi rcsb
total genus 89
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2000-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1e63A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1e63A02
1VQOB 2XNJA 2PIAA 5EMNA 3W2FA 3ZBTA 1QFJA 1QGAA 2OTJB 1ZM4A 5DSZA 1NDHA 1YITB 4U9UA 3WXMA 3SJZA 1EFCA 1GR1A 2C77A 3CCMB 3MCAA 1W35A 1ZM2A 1D8TA 4C0SA 3AGQA 2D74A 1GVHA 1YJNB 1F20A 1FRNA 1QH0A 3QE2A 2CRVA 1JJ2B 2BPOA 1NJID 1H42A 1CNEA 3AVWA 3AVXA 2YWEA 1TUIA 1ZM3A 1QX4A 1S0UA 1E62A 1UMKA 4PC2A 4WQMA 2QN6A 1YHQB 2BM0A 3E1YE 2BN4A 2YWHA 1GAWA 4YAWA 1JB9A 4G1BA 1K73D 4G1VA 3W5VA 1VQ8B 1GJRA 3OZWA 4C43A 1QVFB 1OGIA 1AIPA 1BQEA 3CW2A 1QVGB 2X3UA 5GV8A 4IW3B 1ZM9A 1FNCA 3W5HA 2BSAA 2BVNA 1D2EA 5TR9A 3CC4B 4MYUA 3I55B 3J81k 4EH1A 3JQRA 4Y9UA 1VQMB 1W2BB 4ACBA 1Q7YD 1VQ9B 4PC1A 1U2RA 3OJWA 3B78A 2BV3A 1BJKA 5TV2A 4NCNA 3U2QA 3CMAB 3LO8A 4TMVA 3WNCA 2PLFA 1KJZA 1YJ9B 4M4SA 4N3GA 1KK2A 4M0LA 4M1KA 4M53A 1OGJA 1OB5A 4B47A 4K1XA 3ZC3A 1TTTA 2OTLB 3W2IA 3QFSA 4Y9RA 2FX3A 2EFGA 1KC8D 4NBSA 1Q82D 2VYQA 2B7BA 3CPWB 1DG1G 4QHYA 2CNDA 4LC0A 4YALA 4H9GA 3ZZTA 2GQFA 2BGJA 2ZITA 3CCJB 3OZUA 4FWTA 4YAOA 4LBVA 1GO2A 1FRQA 1R5OA 1JA1A 4PC6A 3VO2A 2AHOA 1QFYA 1DDGA 2B5OA 2J7KA 1VQKB 5HXBA 5KSWB 1A8PA 3CC2B 4RD3A 3CCUB 1I7PA 1W34A 2GPJA 3ZZ0A 4RD4A 1G7RA 1QUEA 1F60A 4ZCMA 1B2RA 4RCZA 4B48A 2QA4B 5JBQA 2VZLA 1QGZA 1M90D 5H59A 1KQSB 1E64A 3ES9A 1N8RD 2HDNB 2VNIA 5H5JA 4TN1A 4AF7A 2OK7A 3WNBA 1G7SA 1TVCA 4HE5A 1VQPB 2BF4A 1E63A 4B4DA 1HA3A 3CXCB 4M2LA 2DETA 2VNKA 2C78A 3AGPA 1VQNB 3AVTA 1FDRA 3U6BA 1Q81D 1KK3A 2QTZA 1XB2A 1XE1A 1VQ5B 4TMTA 3I1FA 1KTVA 1JA0A 4LBWA 4ZCIA 3MHPA 4FK8A 1K8AD 2R6HA 4LBZA 3A1FA 3CC7B 2BM1A 4AC9A 4ZV4A 3E20A 1EXMA 3CCLB 1S72B 1D1NA 2B7CA 1QFZA 3WYAA 4P3YA 1IJEA 1OB2A 3W2EA 3W5UA 1N0UA 1G7CA 2QDXA 1FNMA 5GV7A 3G6EB 4PC3A 1M1KD 4N3NA 1EWYA 2QTLA 1TLLA 2YWFA 4RD0A 3VO1A 4RD2A 1YI2B 2DEUA 2EIXA 2PMDA 1R5NA 3CCQB 1KK0A 3OZVA 4TMWA 2BMWA 1YIJB 5FA6A 3CCRB 1R5BA 4HE6A 4TMXA 3PENA 1EP2B 2DY1A 1ZUNB 4BPRA 3G71B 3V76A 2E1RA 1H85A 2RC6A 1QG0A 1BX1A 1J9ZA 1VQ6B 3QFTA 1EFUA 1VQ7B 2OK8A 3ZBUA 3P27A 2HMAA 3LVBA 4ZGQB 1Q86D 4PGOA 3G4SB 1IJFA 3MMPA 1G7TA 4QFMA 4ACAA 2RC5A 2QMUA 4RD6A 3B82A 1QGYA 4R71A 4DQKA 1B23P 4ZCLA 1AMOA 3CCSB 1QUFA 3B8HA 3AVUA 2VNJA 4PC7A 4P6VF 2QEXB 4UAJA 3LRXA 4B3XA 1KD1D 1CQXA 3OJXA 3FJOA 3QFCA 4RCYA 2DCUA 4F7DA 1YJWB 3FPKA 1VQ4B 4G5GA 1FNDA 3ZZUA 3I56B 3AVVA 3WBJA 4FN5A 2BGIA 1EP3B 3CRZA 4Q7JB 3JQQA 1BX0A 4RJLA 3P26A 3CCVB 2XNCA 5TY0A 1K9MD 3VMFA 2VNHA 4LBYA 3VNVA 1DDIA 1DARA 1CNFA 1EFTA 4MYTA 1WDTA 3W2HA 3WBKA 1SKQA 3JQPA 3U6KA 4AF6A 1KK1A 2HCJB 1KRHA 2XEXA 3LYUA 3WY9A 3OW2B 4J0QA 4Y7CA 3CD6B 4B44A 4RD1A 1SM4A 3QFRA 3QSYA 3AVYA 2DERA 2YWGA 1FNBA 3VNUA 4B43A 1JNYA 3W2GA 3CB4A 3WNDA 4DQLA 1GAQA 3CCEB 1ELOA 1N0VC 5AN9A 1VQLB 1EP1B 4YAUA 1W87A 4YAFA 2NPFA 3CMEB 4YHBA 5THXA 1IB0A 4ZGNB 4TMZA
chains in the Genus database with same CATH superfamily
1Q2UA 3IRUA 6REQA 1U4NA 2Z98A 3L49A 5EVCA 5HJEA 1XD8A 3AHDA 1CK4A 1LQTA 2O06A 2EC5A 3L1JA 1ZEJA 1G2IA 1QFJA 1OC4A 2BZGA 2O3UA 3UEOA 3QVXA 1JXMA 4FCVA 4PW0A 3AOEA 3T34A 1A7UA 4LFCB 3KR9A 1SWVA 2PV0A 1F8GA 1K08A 1QGUB 1RQLA 4JFRA 1GZ6A 2XUZA 4MQBA 4DWJA 1V6CA 1XU4A 4IIHA 3RRBA 3MJVA 1Q95A 1AQNA 4QBTA 4X92A 4FOLA 1WIWA 3CVWA 2QM7A 2WMOB 3IBGA 4P34A 4BZQA 1GKIA 1M2GA 3I0MA 2FPLA 1ZIYA 3WOVA 4B6OA 2HHLA 4MPJA 2H5EA 2Y1KA 2I54A 3HVRA 2Y77A 2V7XA 1QNFA 1ZO8A 3P2OA 2KW5A 3V97A 4N48A 3UUEA 1BROA 4K9DA 4U6SA 2V7TA 4XIIA 4TSKA 4P80A 5LYJB 1DLJA 2R8YA 4W8OA 4E31A 1V4VA 2ZYHA 2C84A 4H7PA 4XNFA 5KSZA 1D1SA 1Y9EA 4GBED 4FYXA 2GAIA 3HJFA 3ILVA 2FPPA 4U2KA 2ZWAA 5F7JA 2DP4E 3KOUA 4CUZA 3IHKA 4TS4A 6GPBA 4CODB 5ENZA 2ZXHA 1V1RB 1Q0RA 4ZIRA 2WRZA 5HIIA 1W7AA 1M8JA 4NCAA 2CD7A 2GEJA 1GU7A 4WXYB 1YDFA 4JDUA 3ENKA 3UHOA 3DFUA 4PF1A 3SDBA 3HB0A 2PE5A 4EMUA 2XF8A 3D8TA 3A4NA 1KAMA 3VKWA 4M99A 1Q7TA 2NWQA 4C21A 2XYHA 3HPQA 5JY6A 2VBTA 3IQGX 3K9QO 4RK6A 2Z6AA 3ZZMA 3H6KA 1KR2A 1IXRC 1IN4A 1NPTO 2NQ8A 4ZAFA 3B1ZA 3HBJA 4I50B 4LS3A 1XD2A 3VPHA 1J21A 1EVLA 4KSYA 5D3ZA 5F5LA 4M8SA 4WK6A 4BS9A 4GDFA 2WMDA 1EVYA 3OLCX 2VR1A 2BBSA 1J23A 1A82A 4NCJA 1CQPA 1JU9A 2Q49A 3GJ6A 5FFFA 3BC1A 3RC2A 3EIUA 4RKRA 2ERYA 2OKCA 3HYTA 3BCFA 1T4CA 4JEHA 4EAQA 3N2KA 5JAZA 3CG4A 5J4LA 6CHYA 2ZM6B 4FFLA 1TJ4A 2V4UA 4GRDA 5B2FA 5IC4A 4X91A 3OZBA 4YCSA 5AI8A 1N0IA 5EJ9A 5HNKA 3VGPA 5AKLA 1C3OA 3RSLA 4ESHA 5KSYA 2QLFA 2XWPA 5K4HA 5L3SB 1EX6A 2M98A 4ZEMA 3WGQA 2QPAA 1M6VB 1VQMB 1SVOA 4HDKB 3UPDA 5CDSA 3O3MB 1YTLA 2ATXA 4IUDS 2GDZA 1Q7YD 3R4CA 4NX2A 1NZFA 1VQ9B 2WA2A 3GO4A 3LBAA 2VDWB 5BSXA 3ACBA 1RI1A 4FFWA 2QR5A 1U2RA 5AHXA 1OA1A 5ALKA 4C08A 4AXXA 4Z1OA 1M2FA 1VA4A 4ITVA 3SZRA 4BL5A 4BB0A 4PGFA 5JG7A 1HSOA 4B87A 1U7HA 5KYNA 4PIVA 1I13A 4DA0A 4Z4GA 5CVCA 2LPMA 3OIVA 4H08A 1YRBA 4HWGA 5IBRA 2J3IA 4C7VA 3PPXA 3WB9A 2RGGA 3JQAD 3HZHA 5DGCA 1RP7A 1M2KA 1KK2A 4M1KA 2PLNA 5EMLA 2EL7A 2VHEA 2IV2X 2H07A 3T5PA 1A7AA 3THWA 4AJNA 1JTFA 1YVPA 2WJHA 1F48A 4PN7A 1TF2A 6PFKA 1DFGA 1YRHA 3IUQA 2ILVA 3K1TA 3K0BA 2O2XA 4LNUB 2ZE6A 2BBOA 3NT5A 1UFRA 2EWWA 2MSWA 3CGWA 4EG3A 3KEWA 2IIPA 3R8XA 3U4MA 3B1KA 4R54A 4ROSA 4IOJA 1W29A 4D41A 4EZIA 4ARIA 1QE5A 4FDLA 1C1XB 1I4DD 5E6RA 1PD1A 2HMUA 4OMFG 4XB2A 5AK5A 1NGSA 1F4PA 1BVYF 1TQ6A 3HS3A 2IELA 2VEDA 3HRIA 2H0RA 2BMEA 2FR0A 2IOFA 4JP5A 3ECCA 2Y1XA 3T7EA 1XYGA 4DSNA 2XKAA 4MINA 5L8VA 2Q5EA 4YASA 3RSCA 4D99A 1JHYA 2A30A 2CMDA 2Q6IA 1K3UB 5E9QA 5ELMA 4YALA 4GI3A 4Z4CA 2RGNA 5ITSA 1SXIA 1E3XA 1Z4MA 4OB8A 4UW9A 3C15C 4EATA 1DQPA 3LWNA 1X7YB 1P9RA 2WWGA 1ECPA 3O38A 3RVSA 1JJIA 4FWTA 5DF1A 4YAOA 2XHZA 3TOXA 2WJ3A 1Q6YA 4G0QA 1R5OA 3I04M 3HXOA 4OL0A 2CWWA 5FUQA 5HKKA 3IMEA 4X44A 3UMSA 2Z2JA 3SC6A 1V43A 3V8VA 1R7RA 1LTHR 1Z29A 4YDSA 2IUYA 1NX6A 3X2SA 4ZRNA 2P27A 4D3FA 1UF9A 4D5EA 2DHDA 3PQDA 4XQFA 4CNQA 1R00A 2IS4A 4NYMR 4O3MA 3FLAA 4PSDA 1ZW6A 3G49A 4RPBA 4LJ7A 1TYCA 4EHHA 1K5GA 4ZZIA 4HNGA 2FR8C 2XWBF 4XUEA 4HVLA 1N2CE 1TUBB 1W6UA 2QRKA 3L4EA 5DM2A 1W34A 5EFZA 4PEVA 5DXJA 2Y8EA 3PSAA 4WACA 3G6KA 4R01A 3VR5D 1W8DA 3LCMA 3VAYA 3DD5A 2JAUA 2V7PA 1JFVA 4RD4A 2P2DA 4GYYA 2NP7A 1BX3A 1ESMA 2X58A 1J1IA 1QC5A 5JJIA 1I6KA 2HEIA 1XU9A 1XQYA 5F51A 5GJWC 3D3WB 2RIPA 4WLFA 4ZI7B 1QGZA 3GLFA 2PG3A 3OUZA 3IQHX 2JCVA 2VTKA 4PLWA 1VIYA 3ENQA 5DEIA 4BQQA 2QS9A 2NVOA 3GT3A 4Y6SA 1E64A 5IC5A 4OJTA 3ONWA 2XB6A 5CH3A 3WGTA 5LQJA 2EZUA 1N7IA 4BYGA 3E8MA 1E2FA 4MYRA 5C1BA 1AC5A 3GLQA 4TSFD 5EXDA 3RYTC 3SS7X 1YXMA 4C4SA 2NTVA 2QVXX 2IZ5A 2JFOA 4OKNA 3TCNA 3N28A 3PL5A 1HDXA 2VDQB 2H4JA 3CVOA 5K2MA 4L8GA 3TE7A 2Z2XA 4GIBA 2P2LA 4IRUB 1YS9A 2OCBA 3HABA 3ZLUA 3ASTA 1E63A 1R6DA 5IYQA 2OP1A 1DDOA 2PNFA 2Q45A 1HM5A 2QN8A 3HSYA 4HEJA 4LQDA 3MRXA 1X6VA 2SCUB 4RZHA 5FEMA 4AG6A 1NOJA 1JFLA 3OE1A 3OZXA 4I2VA 4K40A 1INLA 2XGMA 1GL7A 4XD7D 5C8YA 5BVGB 5HWSA 3H16A 4PFKA 5ICCA 3G0OA 4YPVA 5KWIA 4I9FA 5DNVA 2V6IA 3S99A 1XRNA 4L3OA 4KO3S 4LHZA 1JA0A 3WGJA 2A5YB 2R1UA 3I53A 4K6FA 3WL5A 4LBZA 1RXIA 4NKRA 2BM1A 3TPCA 2XCLA 4F45A 5L7YA 4PYIA 2H9AA 4MLCA 1NV8A 1J06A 2C0QA 3W6NA 5ILOA 4UCWA 1ADYA 3NWJA 4RYDA 2ZJ8A 3CCLB 1S72B 4HVAA 2G0AA 1JX6A 1TLTA 2IZ6A 4EZEA 2RK3A 1KIAA 3H86A 3ODPA 3FIJA 3TEFA 5BWCA 4XFJA 4M9CA 3H7IA 5KREA 5A3RA 1Z25A 2V45A 3GNSA 1Z15A 3L0YA 3WMXA 1ZHHA 1CRQA 2LD4A 3U16A 1O94C 3Q7TA 2P3OA 4I1YA 5U4QA 3JYPA 3GAAA 3NWOA 5TQ2A 3OKAA 5AICA 2OWEA 4ITUA 4LZWA 1E7MA 3FF1A 4JJAA 1HUQA 1FNMA 1L7DA 3D2LA 4KLCA 2OHIA 4JXZA 3PQ5A 4BKQA 3WGMA 1W4AA 1YQWA 3RKUA 3ITEA 2QD1A 4NCIA 4L8WB 2AR9A 4IDQA 4FXOA 5JRZA 2V96A 1NMSA 4N3NA 1U2SA 3AVOA 2LVBA 4HDMA 5KYUA 3U56A 2BFWA 3MUNA 4EPRA 1DRVA 3WGGA 3IJRA 1BPLA 3P94A 2JRCA 1S02A 4BPBA 3OZGA 5AW1A 1DUSA 2FUEA 1KH2A 2A1UB 3VR3A 5DI3A 2AWOA 1V5EA 3U3ZA 3OOSA 4FGJA 2Y2VA 3U13A 1DQZA 5IZCA 2R85A 1ZN2A 3B9BA 1N5LA 3O7WA 1SZJG 1TUGA 4CM1A 1GFWA 3PS9A 3QOXA 4JVNA 4MZXA 3ZD7A 5JSFA 4RD2A 2PMDA 1GGKA 3E27A 4HR7A 1PFQA 3HJCA 1NJ5A 2ZSHA 3L7IA 1Y1PA 4AK9A 4JN6B 4LHWA 4QYXA 1NOIA 4CM9A 1DBQA 5D1HA 3DZDA 2BMWA 1UT8A 1T9ZA 2EG9A 2JIMA 3CCRB 1NL3A 2V3WA 4A10A 4DMLA 4YJGB 5F23A 4QT0A 3ROFA 3KQPA 3VHQA 3ZDEA 2CLHB 3D8NA 3WLEA 1D07A 1CDEA 4A03A 4UEJA 3PPVA 5F1KA 3JCZA 1SOAA 2ZTNA 1OT5A 1C0EA 3RIGA 5EEHA 4BC0A 5LFAA 2M9MA 3IQZA 2B6HA 4LWQA 2PKEA 2CEAA 2ZR8A 2EKDA 2ZYTX 1KI9A 3I6ZA 1OZHA 3LF2A 3NXKA 4UQOA 2ZUTA 2IUTA 3VYSB 4Q66C 5DNUA 4DY4A 1PNTA 3R76A 1TLFA 1EFUA 1PJTA 4C3ZA 4F91B 3MIZA 3GY0A 1BYIA 5AH0A 1VQ7B 4DF3A 2A94A 3CB2A 5JPDA 4X71A 1ZISA 2VAPA 3NAMA 4EGAA 1DXOA 3O4FA 4K8OA 2O5RA 3HAGA 5EUCA 5FWDA 4BFZA 5AI9A 1P7PA 2M5SA 1Y1QA 5TX7A 4GKKB 4M0PA 5KJ6A 4H15A 4OP2A 2ADOA 2GPAA 3BXXA 5ESRA 3SF8A 4E6EA 3DLPX 3I23A 1LBEA 4UE6A 1K28D 4UTPA 3T54A 2V7GA 2FMTA 1LVUA 2WJGA 4RIGA 2A1UA 1FMFA 1SAYA 1CRWG 3I2JA 1ZGCA 2AMJA 2PR2A 3FDFA 3R24A 3BSFA 4OI2A 5CVUA 5AP9A 4AULA 2VCHA 4FNAA 4NC9A 4L0MA 1BGVA 2B99A 1DKOA 2G83A 3G9XA 5FLKA 2WTUA 3WL4A 4NE9A 2P4EA 1QIIA 4G7WA 2OD2A 3AVUA 3B36A 1K5PA 1SCDA 2WU1A 1ZJ5A 2INGX 3R2JA 4L2IA 4AG5A 5K4GA 2C0CA 3B6MA 2QBYA 1G9TA 1C2TA 1TGVA 1WPQA 3K1AB 4LXYA 1PR1A 2AZDA 4FOTA 2NU8A 2IEIA 1SVIA 3LU1A 3MJRA 2YV3A 2FPKA 3H9GA 4KWTA 3I4FA 2GCOA 2O6HA 221PA 2GPNA 3MRSA 3PFBA 1YT5A 1ZIDA 3BULA 3MJ4A 3Q15C 3PR2B 5KWJA 3GFQA 5U4XA 3MCTA 1U0LA 2QRHA 2CBGA 3AHHA 2PUAA 3RVOA 3O2QB 3OQ1A 2PL1A 4OJKA 4GPBA 4ZVUA 1BH2A 1CDOA 1E3SA 3EXFB 5H70A 1LV7A 2WD8A 3HY4A 3E1GA 3EB9A 4Q19A 3QU2A 3HCFA 4MR9A 4MVJD 1XK6A 3RYHA 3UK0A 1UDWA 4OGLA 3SXPA 3TMAA 4ZI2A 4TT3A 3UPUA 1IOLA 2QX6A 1ZH4A 5BV0A 3O93A 2XLBA 3CHYA 4MR7B 1P2SA 1G64A 3IKVA 2X8WA 2NU8B 4BNDB 5A9SB 1N5IA 3F5MA 4JLWA 1MB9A 2HADA 1DIRA 1RYBA 4Y1GA 3OIUA 3QUQA 4GF5A 1KQGA 1QU3A 1HQKA 2OE2A 3ZHCA 3KYDA 1YBHA 1FU4A 4DK0A 1RLMA 1TC1A 2GJAA 3P9ZA 4D0NA 3NH6A 4RA9A 1TZMA 4EJ0A 1CY1A 4NF2A 4JBHA 3JPYA 4J1QA 2B83A 3QF4A 3EVTA 1SMKA 2OBLA 2Y0DA 2L82A 3VR0A 4ABYA 4CG0A 2P77A 4DJTA 8LDHA 3C6XA 3EBOA 2VUUA 3Q3GE 5LL6P 5JFTA 1K6IA 1OF1A 3CGGA 5AOBA 3D6JA 3F96A 3KC2A 3L93A 2FKAA 1T3ZA 2VXYA 2HFKA 3ZJVA 3KTDA 5FTMA 1MQAA 4DSAA 3CW8X 1T43A 2IDMA 3MWJA 2QDKA 3PYLA 3M6AA 3U9LA 5K99A 4KRGA 2VSQA 3GJTA 1KK1A 3CZMA 4GFDA 2DH6A 1T1RA 2Q0XA 2EKPA 2XVAA 3BBLA 5G0SA 2DXIA 1XFOA 2BTQA 4IINA 4FE3A 4YRLA 4AT1A 2G71A 4BJ6A 3HWWA 3MTGA 1SVWA 4DV3B 2VP4A 2MSCB 1EWTA 4XDZA 4R7TA 4L5AA 3R6TA 3BL6A 4YCNA 2AW3A 1UL1X 2YZMA 4W6ZA 2F6RA 4DGSA 3F2IA 421PA 4B43A 3E9DA 1NXXA 4GZ6A 5KNCH 3ZIAA 1KDOA 1WF3A 3JQ8A 4U8HA 4GWLA 4L4YA 1GA1A 1ORDA 4DQLA 4YJHA 1DS6A 1N0VC 1D9ZA 4MRSA 5EKTA 1T1SA 2EQBA 4F1WA 4CQJA 4Q4JA 3DE2X 4M0CA 4NJMB 2BYTA 3A3YA 4ZANA 4MS1B 1ESDA 4C4ZA 1X74A 2NUPA 1T5BA 3I9V1 5DHRA 4GGMX 1GPYA 4IGIA 4P86A 3RYCB 4MUJA 1GNSA 3FFXA 3OFND 1T4DA 4QEDA 1XHFA 2PD3A 3DBIA 1XIVA 3ISTA 4WOJA 3GP8A 1YR6A 3L7JA 3IB3A 4PQYA 2N9UA 4PSVA 2X7XA 3I0ZA 4XDHA 1WDLA 1Z8DA 5E9AA 1YZVA 4IS2A 3HP4A 3N6VA 4ZU1X 2F8MA 2NXJA 4K6HA 4FFDA 4RY8A 5IYZB 4U0JA 3QI7A 1FP7A 1ML4A 4NHOA 1BA2A 3T3IA 3KD3A 4MV7A 4YT4A 4ZYZA 5JAHA 2ZCJA 2O8CB 3IO5A 3WWCA 2FU5C 4PE5B 5HM6A 2RGYA 4GH5A 2FRVA 1RI5A 1VIAA 3U4IA 1RKUA 1XHLA 2RBGA 3BHMA 5CIQA 5J23A 1HZJA 4NZYA 4MCAA 1Z6ZA 4O4HB 1Y9JA 3NZEA 1C9KA 4YFVA 3FNHA 3VSCA 4XORA 3IVGA 5F35A 1J24A 4X8IA 1W2GA 1Y33E 2AOUB 3WNVA 3KL2A 2PKWA 1PJ3A 3RFUA 2HLDA 1PLKA 2WU8A 4RIFA 1NJID 4EABA 2GJ4A 1NONA 3K2BA 4KLRA 2WAOA 3S2EA 1O2DA 3L0CA 5IYWA 1UMCA 2CNWA 2WWFA 4YAIA 1POWA 3D1JA 4FZ5A 4HCJA 4PLHA 4EMTA 2YIVX 1DJMA 4MAFA 4N49A 4DAOA 3KB2A 2O3SA 3NMUF 1I9CA 1YZUA 1ZYUA 2A86A 2YUIA 1WPXA 2B1GA 3HJUA 3NQ41 1ZM3A 1EZ1A 1USKA 4UTZA 2FLVA 3KUXA 1XVTA 5EPEA 3TGPA 1P9LA 2Z57A 3GUZA 2B8EA 1RW4A 3RUEA 2B3DA 5F1YA 4CF7A 4HRYA 4TGLA 1DTWB 5HFAA 1Q17A 4ETNA 3WKCA 5K6AA 5DJ5A 4D92A 1FP4A 3MRVA 4UVEA 1AGRA 1YHQB 1NF9A 3AXSA 1LD3A 3CXRA 3EF1A 4IFIA 5IM4F 3HZRA 4RHTA 3WLSA 4PG7A 4OQDA 5DH9A 5FUMA 4D4HA 3BD6A 1OXMA 2RHHA 4KGZA 3GGSA 1TJNA 3KT3A 4PM4A 1JU3A 2WHEA 3LHFA 3CUVA 4GXNA 3OCCA 4PS1A 1E9RA 4XW2A 1Z22A 4K0RA 2DQZA 2WNIA 2FQYA 4BEWA 1JE1A 1M34E 1QO0D 1M2OA 1SHUX 3KLOA 4MIYA 4TSRA 5C2JB 6ADHA 4J0JA 3QITA 5AESA 1OGIA 3BD7A 1CQIB 1JG6A 1XTKA 1D7OA 2O48X 3LA6A 2FSVA 1G8KA 3A0UA 3FSEA 3RTAA 1FNCA 3T3MB 3U7EB 4YBZA 5KINB 4D8UA 4EX7A 1KEWA 1MC1A 1RCFA 2J41A 4RFSB 7MDHA 4E51A 3TM4A 3CC4B 1M6WA 3AJEA 1FFDA 2HMSA 2W83A 4TTIA 3IAXA 4KB5A 4RAQA 3OZDA 4CTMA 1VE6A 1U1IA 1YFJA 2CE7A 4UHDA 4X7MA 2I2DA 5EXEA 3EEQA 3ORHA 3V8PA 1NVWQ 1EQUA 2TSYB 3CN7A 4J9UE 2DBZA 3SC4A 3TD9A 1IFXA 2OV2A 4PBSA 2I7XA 3PXXA 3RIXA 1LQUA 3G2MA 4XVCA 4XOTA 2VHJA 5DHQA 1ECFA 4PCVA 2FSSA 3DZKA 3BXEA 3GFVA 5FPQA 4D9KA 2WNHA 3MWEB 4RX1A 3RYIB 3J80A 5K6AC 4G86A 1YACA 3VR2A 1T3SA 3KKKA 1Q0TA 2XVZA 3GLRA 3FWYA 4MV0A 3R9IA 3H5VA 4A15A 5F7XA 3ANNA 1KETA 1ZD4A 3N5CA 4OU4A 1R6XA 1WSAA 2AB0A 3F3SA 1AE1A 3TTUA 2PANA 4LY3A 2Z6BD 4LZPA 1BKSB 2F90A 4DPKA 1U8FO 3A1DA 3NM5A 3SJAA 1VE1A 3SNHA 2FH5B 2XGJA 2CLMB 5I5EA 3IBCA 2NTJA 4QLOA 3BE6A 2JAHA 1N34B 2PKXA 2DFTA 3K9LA 2VHUA 4WI1A 4WZAA 4YRCA 3TRJA 4DFDA 4EFMA 4PHFA 4L7QA 5L95A 2O8VA 3DE7X 3KPVA 3U31A 1K6XA 4OYHA 1RZ3A 4D2IA 4GQNA 4B09A 1HG0A 5H4GA 4X6LA 4B75A 2B7BA 1LC0A 1ZONA 3K0CA 2UYYA 2JLWA 3HA7A 4EGQA 3DBHA 3Q5GA 1EXVA 1I3OA 3KFVA 3FVQA 2XNDA 1EVQA 2ZWPA 2IEGA 5C81A 3EA5A 2UVDA 2OBTA 5AW5A 4C0QC 4Z2AA 2AOXA 1HDCA 3BMNB 3QPUA 3G7UA 4RGQA 3T1OA 4YR9A 1VBFA 2QAGC 3LUBA 1E2GA 4Q47A 4TWJA 4IG4A 1CR1A 2EJWA 5J58A 4DIFA 3C1AA 2H5IA 4G4GA 1U0OC 3D7RA 3V48A 2CLCX 1C8VB 3DUFB 1L4MA 2PPLA 3IAS1 2YVKA 3HCPA 3R3HA 2PS0A 4C87A 5CDYA 1ZH0A 4X0CA 1QMPA 1KMHB 1JQDA 1VSUA 4EYOA 5HXBA 5CT8A 3LCRA 4CM4B 3K0SA 1C41A 3UMFA 3K09C 2GXAA 1R10A 2KMLA 3A2NA 3EZNA 4GZ3A 3OY2A 2E4YA 4A8JB 3OUUA 1T9HA 1USIA 5L6MB 1AV7A 2OILA 4URYR 4F3NA 4CM5A 1BG6A 3BOSA 3LOQA 4BNNA 3QUCA 3BREA 4DG9A 3MTIA 3MT7A 2DLDA 5L40A 2HLHA 4OHOA 1D2RA 1VQ1A 3QBJA 2AZTA 4TLEA 3K96A 4RE5A 4LF9B 3RS8A 1EFAA 5CT6A 3GPBA 1XCBA 5SY9A 2OTCA 4ZP1A 2CJYA 2GVDC 2JGNA 2UVPA 1G18A 3EMKA 3O73A 4JEIA 3AUYA 1NQOA 4JY7A 3QV2A 2HMTA 4DC0A 1FJGB 4FIDA 4AO6A 4UNSA 1JQJC 4YCLA 1W5SA 3IAUA 2BBWA 4RMIA 2J5RA 3MLEA 5TJHA 5HOQA 3FMVA 4IIJB 5LLTA 1E2BA 4U7PB 3HGTA 1SZCA 3DC2A 4D8XA 2XRFA 5K0EA 2ORED 1ZNWA 2A84A 1OWPA 1Z6PA 3C1TA 3D1VA 5F5NA 1OASA 4PIPA 5I7VA 1NJGA 2DG2A 3IIEA 4D97A 1GA6A 3GDOA 1JALA 5LYJA 4Z53A 5BN4B 2Q29A 1L0BA 1RFLA 1L1QA 2EGGA 3VFDA 2PL3A 1G3QA 3CZ9A 3GJZA 4RK1A 2E5LB 2PWPA 4MUIA 4LXUA 3NVKI 1M2WA 1E9DA 3WNBA 3HU1A 4BKOA 1NVKA 4F6RB 4M2LA 1X8KA 3P4YA 2NG1A 2B3TA 1P4AA 2PUFA 1ZC4A 4LZAA 4EQZA 2DKFA 2Q5LA 3JU4A 1CRZA 3C4QA 3C6QA 1WZCA 4Q12A 4ALLA 1ZH6A 2YY5A 1E6KA 5D3MA 4P7JA 5AK6A 2W2TA 2JJ2A 1P4HA 2R2GA 2YVLA 4HLNA 1QCYA 4Y1RB 3E1SA 4YO8A 1P73A 3VYTB 5HCNA 5CA1B 2ZUEA 3EAQA 2GHRA 3L7OA 1YKFA 1W96A 2QZPA 5KU1A 5TC4A 3I52A 1IH8A 1WDKA 1N0HA 2CEKA 1ZHFA 2JF0A 4N03A 5CVJA 3VGJA 3KQSA 2JI7A 2GPWA 4RZQA 1FX0A 1JHAA 2A7XA 5JEDA 3EIFA 1MH9A 1J42A 1DIBA 2RHGB 3EPJA 3R6JA 2P7IA 3PGLA 4BJ5A 1Y0YA 2J6IA 2QQFA 3UKOA 2BI8A 5KYTA 3MB8A 3RQSA 1BDJA 2OHJA 3ECAA 3ME5A 3UMVA 1J2EA 3LSTA 2CHUA 4HWSA 3O47A 1UJ4A 3UC9A 1QFZA 3UB3A 5AK4A 4BFTA 1GZHB 2CXPA 3G0DA 1ODCA 1JMYA 2AXNA 4UATA 1OB2A 3IPLA 4II3A 4XZ3A 5DHUA 5HIJA 2H3HA 1OXXK 2DLCX 3WMFA 4HPWA 2P5TB 3QLJA 1LNSA 4Y9DA 3EXEB 2HSGA 2OCPA 3JRXA 2C2GA 1IMJA 3CTAA 1E1MA 2ZSIA 3ETEA 1OV4A 4GKBA 5CLFA 1MENA 3G9UA 1HLDA 3JZMA 4HFNA 4HX5A 4ZK2A 2PZJA 1R27A 3NKLA 4YP0A 1KA9H 5CD1A 3TLKA 3ABZA 1P9OA 2XF2A 3CWZA 1IBCA 3DHVA 4GE0A 4IV0A 5DNDA 3T3PB 2AA3A 4KNVA 5KSPA 4P3IA 2OV4A 2WVAA 2MJLA 4P58A 3HKEA 3NXSA 2OYRA 4ZN6A 1HYHA 3ZWNA 4EI7A 1OI2A 3LLMA 4H6PA 2GZSA 1GQOA 3NG1A 1Z18A 1R3DA 3LA8A 5EIOA 4QDTA 4IZ6A 2QTLA 1QIMA 2ZBRA 3KV1A 4YA6A 3GJ5A 1RADA 3O7MA 4GGOA 1E89A 1PZFA 3FPAA 5E7QA 2IYPA 1RI3A 1OIVA 1YJQA 4KPUA 3U9SA 4RZSA 5EWMB 3WLIA 1O5IA 2R62A 2QUJA 4U7GA 1MV5A 3DMHA 2WKRA 4MPDA 3EGXB 3M6LA 3VRHA 3WK7A 4TMWA 1JSRA 3EC7A 1NRXA 1SU6A 4D96A 2X7HA 1AK1A 4DNRB 1B8UA 1UBNA 3EAGA 4PZ9A 4U7WA 1XZCA 4DBZA 4F11A 3QLVA 1S8OA 1TA0A 4G1UC 5HSGA 5KJCA 1X1RA 2FKNA 1M7GA 2IXDA 5JDCA 2BT4A 3C87A 4NFYA 4WDRA 3MOGA 4KL8S 5T3UA 4CM7A 4O0LA 3AKEA 1QHFA 2W6JD 4OQ4A 1KPGA 1P39A 4EZBA 2F59A 4RM2A 5DW0A 4BRWA 3B6IA 4K0KB 1SCIA 1MVOA 4FUTA 1KWKA 2M6KA 3WRWA 2VUHB 1RWOA 4FLEA 1NF3A 3P2KA 1EH5A 3Q6QA 1KU0A 2VP9A 2JJYA 4HF7A 3LCVB 4YP1A 2YN0A 3D31A 4I5IA 4KN6A 5C52B 1TEVA 5AW6A 4ZZ0A 2OK8A 3EZ6A 3F5SA 3JQBC 1GEEA 2UVQA 2O1WA 1X80A 1FW8A 1QK3A 2NU9A 3L3BA 4I55A 2IBMA 4XI9A 4ZGQB 3OI7A 3RGWS 4PGOA 3TKLA 4TS3A 3TWOA 4EHAA 4DA7A 2O2SA 3CNHA 4FYYA 1BXZA 1TZCA 1WNFA 2Q2NA 3MJCA 1B42A 4J0IA 1SUWA 1Q7RA 2VDRB 5AJVB 4EB6B 4OQEA 3BXGA 2WIDA 3FFBA 4IMIB 3ZTWA 3R3JA 4MICA 1TCVA 4AZ0A 3HL0A 2W42A 3BXPA 1MB3A 4OJNA 4A3SA 2NO9A 2CLLB 4WV3A 5CTAA 2VBUA 2A88A 3REQA 1I32A 4J1TC 4X5OA 4EQ6B 1PFWA 2RKBA 3HKDB 1JJ7A 4HJXA 1W44A 3A06A 3DPIA 3TLJA 3V7WA 4HSEA 3UJ6A 4AZTA 4EGFA 1E1DA 1NPDA 4M98A 2JJ8A 1G4UR 3F4BA 4MKZA 2H0QA 2HSEA 4Y2XA 5SZHB 4AUEA 3IESA 5AKZA 1Z4QA 1JHVA 1NX9A 4RTPA 3NWPA 5JYCA 4II2A 4B3GA 1ISSA 2IKSA 3ELYA 3ODGA 2VDPB 3ESBA 1GFZA 3DEKA 4BB6A 2C7BA 2YTZA 4V0SA 4C06A 4EB6A 1W4RA 2GZAA 3KQNA 5A7GA 4NABA 2HPVA 2G1JA 4O2AB 4X41A 3OLVA 3LC2O 4K9PA 2YFHA 1GILA 1QQ7A 1TIPA 4EYSA 4MKRA 1PAUA 3NHFA 4NDNE 1PJBA 2BC9A 1LQ2A 3QLTA 4CMHA 1QP0A 2HJHA 2E82A 4UBMA 1HBJA 3W3AA 4W8HA 4DMKA 1DO0A 5ITZA 4ND5A 1XU7A 1VLLA 1JL3A 1FU8A 1R8JA 3K2QA 1BFUA 1BOFA 2EERA 1C8LA 3LY5A 4GD3Q 1R9MA 4OFWA 4Y9SA 4HUQA 2F7SA 3ZWAA 5C4IA 2VJOA 2R1VA 3GJRA 5A4IS 3OM0A 3T9EA 2CFOA 4R31A 4NBNA 2NZVG 3ZHQA 2JVJA 1BMTA 4QAQA 4D6XA 1E61A 1ETHA 1N4DA 4HNAA 1DLIA 3OLZA 2R7KA 3PNYA 4WK0B 1QP4A 4RJLA 3P45A 3E03A 1C4KA 1C1DA 2HL6A 3NP9A 3N76A 3HYLA 4K1LA 2GO7A 3BB3A 1XNRB 1G2PA 2BJVA 2N42A 4R1SA 3REQB 4B73A 1JN0A 1VHOA 2JAXA 4NZZA 1S3GA 3DOCA 4OKIA 4RMNA 1BW9A 3GZNB 3DJYA 3CX7A 3S70A 3W1VA 4BNIA 1IAQA 1YMUA 1QVAA 1VI2A 4Z4WA 2P6UA 3O31A 4KV9A 4FJ0A 3I9MA 2PBLA 4YRZA 3SX2A 3ZDQA 1ZGZA 3DL2A 1XEAA 2GDJA 4GLLA 4PXSA 3UV7A 3ZNPA 1D1PA 3HUEA 3LLSA 1YB5A 3U6KA 3K9BA 5M29A 4MH0R 4D3XA 3GHHA 4I9UA 3RRYA 3ZK8A 4GECA 7GPBA 1OIWA 5HYVA 3D4BA 4NG5A 5DLDA 2J9ZB 3K6KA 1XZPA 3GEGA 3LYUA 5AI4A 4NECA 1YASA 1OOEA 1CVIA 2KLHA 2ZJ1A 1ABEA 3FSRA 4M9XA 1RKXA 2Q7OE 3QH4A 1ODTC 1IBKB 1AURA 3BXHA 1KP9A 3ETHA 1Z75A 2YW2A 3F7OA 4ZVSA 1NWCA 2VSYA 3CO0S 3IAM6 4B6FA 1U7XA 4HB0A 4J75A 3ZI4A 1LJUA 4PZYA 3VBEA 3IT0A 4S0XA 5DYGA 1Y8RA 4JJ7A 4D45A 3A4VA 3QPVA 1ACJA 5C5DA 3MTDA 4I5EA 2CXNA 4XWGA 2QQEA 3QOYA 3F73A 2C2OA 2FPIA 3HN7A 3GJ7A 5JASA 1E2EA 3BHJA 4G0VA 2QTVB 1N2SA 3O1JC 1Q0PA 5CJ2A 1R0WA 1K7SN 1KERA 2WJJA 3LDAA 1N75A 1TYEB 2JZCA 3DKPA 3RG2A 5EJ7A 5JW6A 3OY7A 4FB4A 1AQUA 1U11A 3JD1A 2CJWA 2WSMA 1LK0A 2IY7A 2Y1CA 4PU0A 1VJGA 2CLKB 4LPSA 1B3BA 3D7KA 5KVQA 1A8SA 4P4SA 4YFYA 4O4HF 5TXGA 5THXA 1NQWA 3AVQA 3AW9A 1U8UA 1TKCA 4DCPA 3FZNA 4BO5A 4LTDA 4MV9A 1NQXA 4Q7QA 3H0CA 2PIAA 3FKQA 2J4FA 4QPNA 5DULA 3RH0A 2OY0A 1TF5A 1Z4JA 3ADPA 2V54A 4POAA 2EKLA 4CTNA 5GY7A 1R4MA 4B8ZA 1LW7A 1FFBA 3D02A 3L9XA 1PO7A 4ZZ3A 4EI2A 3AY6A 5A2QA 1ISIA 2ZSUA 3MBKA 3N5KA 3ZVRA 4FB5A 1WTHD 3R3YA 2NX2A 2XCSB 2CXOA 2P6RA 4RPCA 1W0JD 3SR3A 5EHXA 1P8JA 1GNLA 3OP4A 3TQSA 4C5CA 5M2QA 3STHA 1BCRB 3KB6A 3Q3IA 4Q24A 4C0LA 1QYXA 4B31A 3TM5A 4GZ5A 2OT3B 2JBHA 4MV8A 1R4NB 2P3QA 1XBTA 2WI8A 5CIWA 3SK0A 4CKEB 2CRVA 2ON6A 2BE9A 2QN2A 2X8BA 2BMDA 3F0TA 3D4NA 2Q1XA 4EF4A 4R81A 3KEOA 1VZ3A 2BBTA 2ZIXA 2X0RA 3JQAB 1NW9B 5HZKA 1BS1A 5F33A 3OCYA 3SVZA 3Q6IA 1I4EB 4ENSA 4C78A 1MG0A 1X9IA 3PL1A 2ZB4A 10MHA 1WU7A 1VHWA 1ZG3A 1QX4A 1K7FB 3R4VA 3JZAA 4YVFA 5DIFA 1D2GA 3PFGA 5I7AA 3W4JA 1WR8A 1T2UA 2GREA 2BM9A 3ID6C 3ZOZA 3BILA 3E8XA 4F2DA 2ZB8A 5EIWA 4DPLA 2X23A 4EI8A 1E0DA 4RSHA 5DBIA 4B7ZA 1RQ2A 5A0TA 5KYXB 1G9XA 3SZGA 4ZCRA 4O59O 4M7OA 5DCUA 4NMMA 3MM4A 3WFZA 1PT7A 4HGOA 1XROA 6LDHA 3DG9A 2P2YA 1G8FA 3PQ7A 2X41A 3RYFA 4CDGA 1XMIA 2NTEA 2P9EA 4DQDA 1OH6A 2NQ2C 1UWVA 1DHRA 2NAPA 3C8DA 2YDYA 4HMPA 1NBHA 5LWHA 3KKLA 5EP1A 2XCIA 4ZQFA 2PT7A 3VZBA 1UKAA 3JASB 1VIDA 2AEEA 3GUHA 1PDWA 1JR3A 4PPQA 3IL2A 3WC4A 1PL7A 3LH5A 1DXQA 3BVPA 3UWOA 3O4HA 1QM5A 1OYWA 1HDYA 2JLRA 2FF7A 2REBA 2JG3A 1XJ0A 5CCEA 4L9AA 2FG5A 1F6WA 1OX6A 1QVGB 1SRRA 1WULS 2WU4A 2ZYUX 2PZGA 3EOZA 3LNTA 5AM5A 4QATA 2XUFA 1JWBB 3RDPA 1VKNA 2Q41A 1UD4A 4PAAA 1WCWA 4DLSA 4ZQCB 1LLDA 5I4CA 1M7HA 4CKEA 4V0ME 1CQIA 3V6MA 3BJRA 3M83A 4KIFA 2NUAB 1RNLA 4X20A 5H02A 3T3DA 3AFMA 1PL0A 4AF8A 1J22A 1QLWA 2Z3VA 4MYDA 3SIWA 2Y3IA 3UXHA 4BZWA 5EQFA 1EWVA 3BF8A 3BRQA 1TIBA 3NATA 4DG8A 3CEAA 1G17A 1UZMA 1PJRA 2VJQA 4LHSA 2OCDA 5TT0A 4CMIB 2I4OA 3I5AA 1EK5A 5HKKD 2C07A 3KYJB 2GM5A 5E38A 3QE3A 1Q83A 4B2LA 4EJ6A 1FCJA 3EDQA 1O0CA 1N6LA 3HVHA 3K5IA 3DYIA 4N0DA 1TX4B 2CLDX 1CG6A 1R0XA 1VC2A 2ODBA 4M53A 2CXRA 2XJ4A 4V3CA 1BN6A 1RHMA 4HNVA 5JAOA 4DV5B 2G8LA 1U9JA 4UOQA 4EGCB 1DC7A 1ORTA 4XGKA 4IWYA 1U94A 1TEHA 3O9MA 2QORA 1Y6JA 2IIBA 1V1JA 2OTLB 2FPPB 2XSZA 3KWFA 3OZIA 4MVJM 3LBYA 5BSUA 3TW0A 1SQ0A 4DCSA 1BU8A 4Y3UA 5TF0A 2BR5A 5DGIA 5DYNA 2IEYA 3H2HA 1AKYA 2VQFB 4TV8F 2D2XA 3LKVA 1OROA 3QNMA 4NJEB 1QKKA 1JAZA 1O77A 3HRHA 3SIRA 2ZIXB 5IKOA 1LK5A 3ZV6A 1E69A 4GU5A 5JYBA 5DYWA 1X7WA 4XB1A 4M88A 3T3NA 2XGGA 4E4YA 3CPWB 2DR3A 3TZBA 1S2NA 5IYPA 1XRRA 4HYEA 3QUAA 1BS2A 1L6IA 3K70B 2J48A 3LM8A 4FHFA 4XCQA 2A0UA 2G04A 5F4BA 5H81A 2HRDA 1GL6A 1M2HA 1DG3A 1V95A 3KLMX 1FDTA 4UD6A 4YUVA 2C7OA 1E96A 2WMYA 2XMGA 3H18A 4TSFA 3U4HA 3VI4B 4H7IA 3LTNC 4LJLA 1Z4LA 1EUDA 3RVMA 4QUAA 3HUTA 2KB0A 1UK9A 1XELA 1CIPA 2FZWA 3CCBA 1M0WA 1P1RA 4X24A 5DLEA 1UPXA 5T6BA 4BCBA 1KPIA 4ZJPA 3VVBA 4KVAA 4TQ9A 4GXQA 1NW8A 2FK7A 2QTRA 3WLNA 4EEZA 1W2HA 4B2PA 1V96A 1A0OA 1JLLB 1Z33A 1SPXA 1FDIA 3ZWYA 3BMOA 3SCZA 3SDSA 5JZMA 4LPKA 3T7TA 3D2AA 2VAWA 1HMYA 5HF8A 3VVLA 1U9CA 3WSTA 3DW3X 5EKUA 1GNRA 3TLGA 3P9KA 4QXAA 4CFZA 4DBLE 3K3PA 2VDMB 4NL4H 3WYDA 5A7FA 4IIBA 3TW6A 4DDTA 2O2CA 1JLHA 1QYRA 1ZGBA 4LHYA 1VG9B 4DXDA 5K8IA 1GTRA 1X70A 3ZDBA 2R7AA 2AUNA 4HPXB 3OOWA 5SV2A 5F2KA 3LP8A 4D25A 4UBLA 2BFDB 1JHUA 1YR1A 2Q5IA 3Q9SA 3ZUPA 4OU5A 5J5AA 4D6YA 1IM2A 1EEHA 5DVZA 4S05A 2YZNA 2AZXA 2VYVD 1OVMA 1T2NA 2PX3A 4MYHA 1WOYA 2ZAOA 2W8BB 4NAUA 1Y8ZA 4JB0A 4MP8A 1U8XX 4NMXB 2JAOA 3B13B 1AGNA 2VNIA 1UBUS 4X90A 4QGBA 5D01A 5EY5B 1QF6A 4R3NA 3EXG2 1L1EA 2HTEA 3HCWA 4EJMA 2CDCA 4Z6KA 2UYQA 3G0CA 4HX2A 4J0FA 4TRMA 1Y9DA 2AC2A 3W6ZA 2HLPA 2XYGA 3OIFA 5AJYA 5ESWA 5J1TB 3AT1A 1BO6A 2W2KB 1SQ6A 4R8RA 1P4GA 4CEIA 2ZZMA 1XFAA 4P9NA 5CH5A 1UXHA 2JLUA 1P5FA 1XTVA 3VR6A 4QA9A 3RSFA 3A36A 4M6WA 1XN4A 1QPBA 4L9SA 3ZEIA 1UC8A 1A98A 2B34A 5DT2A 5FUBA 2PDAA 3OWOA 2WWWA 1WOPA 1VQ5B 4N8EA 4A7PA 3EQ7A 1PBNA 4Q3KA 3C8UA 4DUZB 1KTVA 4EY3A 5IWCA 1OLOA 4QFBA 1HDGO 1TO6A 1XMSA 5A6VA 3QUTA 2Q1SA 5DB4A 4C4AA 4R1NA 4F5ZA 1JH8A 2W2KA 5FBHA 2H54A 2XQKA 5BW5A 2KE5A 1GGHA 3BZWA 3RE1A 4N39A 1IHMA 3RARA 2AD5A 5C18A 2GBLA 4HEA6 2H31A 3T1TA 2ZATA 4FMBB 2V0GA 2OEPA 2FMKA 3QE0A 3MWLA 2Q3JA 1KAQA 1S4MA 1QGED 4DA6A 4XASA 1RQRA 1UKZA 1VJ1A 2JGKA 2XMBA 1O7JA 4P08A 5F1PA 2FZKA 1M6YA 4J0DA 3PSHA 1ZGHA 2PGIA 2EQAA 4JITA 4FXUA 1QC5B 4ME6A 4K9LA 4LXHA 1LXCA 4HAXA 3GPLA 2E2WA 2CVHA 3QFHA 4YV1A 1SCUB 3P9RA 3TCKA 3SEJA 2WKSA 5I3ZA 1T4MA 1I3NA 2W6ZA 4KI7A 4D7AA 1KJ9A 2V7WA 3AG6A 2ZZGA 4PCLA 2V74B 4RSGA 2H1OA 1L7VC 1CB0A 1IQPA 1R0YA 1I6MA 2YV2A 3F4LA 3EASA 1XTZA 1T4GA 5KQRA 1MB2A 4NOJA 1CHDA 1KP3A 1I7QB 5SYNA 2HA3A 3ET5A 4GI7A 2W4IA 1X9HA 3H5NA 1J8MF 4GLBA 2Q2WA 1XEWX 1LNQA 3M5DA 3E9QA 5BPHA 3VNRA 3OW7A 2HWUA 4A2CA 3KD2A 4QE3A 1ZCBA 5BXYA 1Q12A 3TLZA 4PSAA 2BHNA 4TUYB 4UQPA 5GTDA 3PK0A 4I8IA 1XAHA 4UEWA 5HUJA 3PENA 2ZIFA 2H2WA 1EHCA 1TPZA 2L0XA 2QTBA 2ZP1A 2P78A 1EZ4A 3N6XA 2HOQA 3OQIA 4I50F 4QYWA 1ZUNB 4ZQHA 3DAOA 1BKYA 1NJ8A 3UJNA 1E59A 4KSBA 3H5RA 1MF7A 4G36A 3REOA 3ANXA 1Y4ZA 2G6BA 1H85A 3D8HA 1VLQA 1E5XA 2W37A 4GE3A 1NVVQ 3HR8A 1E1YA 3NHYA 4M86A 4PX3A 4QTYA 4ZDKA 4DN6A 4FINA 2VXBA 1SH7A 4YCCA 5LD2C 4C7MA 1V9SA 3ZDCA 4MV1A 2KPOA 1AB5A 2R1TB 4BFXA 4H3KB 4UM9D 1XLUA 1IHXA 2OGSA 2WNSA 3E4CA 4LW8A 4ZVOA 3VNQA 1ZPDA 3U3DA 1RABA 1V8OA 1B2LA 4C0HA 1V0FA 4H35A 1HYGA 4YUWA 3PRYA 2VQSA 4Z9BA 4CDNA 1M1NB 5BN4A 5I7HA 5EGSA 1U2GA 1ONSA 2H2GA 1K5HA 1G7TA 2CDBA 5FBZA 4QFMA 3RSSA 3SFVA 2DUNA 1P9NA 4EO9A 2LCQA 5SZKB 1MW8X 1RM3A 2RCYA 3KOOA 3WRYA 2QMUA 1MAAA 3P4XA 2BUBA 3V5NA 2CXSA 2XCQA 3MBOA 5GZ3A 1E0KA 3KEMA 3A28A 1DGQA 1WW8A 2C8VA 2VYNA 1WB4A 1DCMA 2IPNA 3FW1A 4XKVA 1T5IA 4CI0B 2PUHA 3WB0A 3C3EA 3KSZO 3OO0A 1T9AA 3NVDA 4O0MA 3DWFA 2EZ8A 3LY9A 4KH0A 1G16A 5TMBA 2ZWOA 5FFMA 5DOVA 2UVPB 2H5JA 4OVKA 2VJPA 3IBYA 5J63A 2IUSA 1FMJA 1TMGE 3KEFA 5HQ3A 4JEMA 3L7DA 1TECE 1RHRA 3DOJA 3FN4A 4V39A 3JX9A 1G1AA 2FEXA 1UP4A 3QBEA 3R0ZA 3KB8A 1DAPA 4ILEA 1SUDA 4G5QA 4MHSA 3UB2A 5JSQA 2MR6A 2QTNA 4R0NA 2I62A 1R8SA 3E70C 2G9QA 3GSIA 2NXNA 3IPCA 1DI0A 3ZLJA 1FFXA 3K0AA 4CKBA 5K0ZA 3B3GA 1THMA 2R47A 4KO1S 3EWIA 2QG4A 1SXPA 2D0IA 2RGBA 4ZDJA 3OU2A 3ZIAD 3WBJA 4I4TA 4UUOA 2SNIE 4XLZA 4E70A 4I3FA 3ANSA 4U2GA 4L0CA 4GOJA 2ATEA 1TO1E 3RBAA 4WK4B 1ZN8A 3DFMA 4LRWA 4S1TA 3JQQA 2I34A 2IODA 2ZRBA 4WZZA 4C4RA 5CDUA 2B5WA 4LF4B 1FFYA 2F67A 1U7OA 1T6YA 4WCVA 1FRFS 2JIPA 3SZOA 4NRDA 4WXEA 3WJ2A 4EJSC 1VPWA 4TYQA 2PGJA 3AF0A 4IQGA 4J9VA 2IOYA 3VNVA 1HI9A 3W5IA 2GR9A 2XE4A 1FUUA 3NAZA 2YHSA 2Y9MB 3DE1X 3TUZC 3CP8A 2WAXA 5COBA 3T7JA 3BMXA 4IZOA 3L5OA 3ASSA 4D4MA 2C95A 2N46A 3IELA 3NYIA 1WG8A 2A9JA 3RKRA 1X13A 2IE8A 1WD5A 2DTEA 3MS2A 3HJGA 4HH4A 4B3IA 4JYAB 2J8ZA 1LNZA 4KE7A 1Y8QB 3WIOA 1U8YA 4EG1A 3X1WA 4UASA 1HFJA 4ZARA 1RAHA 4B35A 2IEDA 3O2JA 3F5DA 3DLIA 1I2AA 3WLAA 1NBAA 1H0RA 4V2UA 3H87A 3HXMA 5MF6A 4JYZA 4EKGA 1H94A 1WSWA 3JVVA 1GG5A 2C3OA 2EX1A 1YU6A 1J0CA 1PE0A 1QANA 3BH0A 1GQRA 2XTAA 4Q4HA 4CCAA 2R79A 5KJFA 4ALJA 4LC1A 2Q3DA 2RI0A 4WJLA 2OLJA 1WCXA 3L0DA 2HD4A 1MXFA 3PKZA 1ELOA 3AOGA 5F4JA 3KZVA 3GGOA 3DWIA 4HRAA 4P5EA 4QQFA 3U7JA 1DRWA 1Y7HA 2RGNC 1C9MA 4R5MA 3U7QB 2XOKA 3BWXA 3F97A 2ZBVA 3L8FA 2P65A 4WXRA 4UFNA 2B8NA 5DYIA 3VH4A 1XCPA 1Y37A 1Z37A 3IOBA 3TZLA 1X1BA 1YCDA 4M0KA 1NY6A 2QTHA 3EPKA 2OPHA 2C9ZA 1B7GO 1XTRA 3MGCA 2GSWA 3D81A 4YHBA 3TBHA 5ES3A 5I45A 1Z4PX 5EE0A 1PNRA 1AH2A 4JBLA 4X1IA 3QEOA 1Z9BA 4TWBA 4JLOA 5EMNA 1VL0A 1I01A 1X1DA 5EG5A 4EJSB 1QHNA 3MWFA 4B6PA 2CHGA 2WYUA 3BNWA 3FPSA 1QYWA 2FSVC 3U3KA 1ITZA 2GNOA 4GX0A 4KE8A 4ZRMA 3ZCXA 1ST3A 4KXXA 2HV8A 3S1AB 1YITB 1WP4A 4I66A 2ASVA 3WMWA 3P0IA 5H9WA 2FWAA 2JDID 4IOMA 2C77A 4NBRA 3DGFC 2QJOA 4WLVA 2DBYA 5DKFA 3IEPA 3DAGA 3UT0A 2QVZX 5BMOA 4Q3CA 1JIJA 1TVKA 1TXGA 4ZT7A 4DW8A 3N75A 5KTYA 5EN4A 3QJ5A 1JIQA 2FXIA 1L4EA 1N2HA 3NHBA 2CLOB 3RFFA 1UEXC 3FPGA 3NBQA 4Q4HB 2W6OA 4EA8A 4D9HA 5D85A 1W25A 2ZSAA 4RL4A 4J2OA 4RHEA 4DR7B 1KYVA 3PRJA 1DQYA 1A97A 2QSUA 4AY5A 3FCSB 4IXWA 4AECA 4MR7A 5FULA 3TNJA 3SP1A 4ZHQF 1F14A 3GLIA 3DH0A 4FKBA 1DKUA 3L07A 3OCWA 1U2EA 2A0WA 4HQ6A 1ZJ6A 2XD4A 3LC7O 4TV9A 1KE2A 3T61A 2WSSD 2JIZA 4J0CA 2ZJBA 3A7DA 4RVSA 1GGEA 3KHKA 3SYLA 5HXAA 5AUNB 5KKCA 3AR3A 5JTTA 2C94A 3MQ2A 4PZDA 5CM2Z 5EIXA 1IM5A 2LXNA 4L3WA 2PV7A 5BOSA 3T52A 2O07A 4R2HA 4OX9Y 5JS1A 4ZAWA 3H6HA 1F1JA 1GPAA 2HF8A 3NEJA 2BONA 1L7PA 1PGOA 2ZJAA 2Z3ZA 1ESCA 1T2FA 2B20A 3E1YE 1UP6A 2FA9A 2Z9CA 2VJJA 2GZ2A 2ZB2A 3H5AA 5D5PA 3ZLVA 1RLOA 2YWHA 5K2OA 3EODA 4PS0A 1T9GR 2D3TA 3A1SA 4ZAGA 2AR0A 1YZHA 1WBBA 2HA4A 1Y6RA 3UNXA 1RYYA 2HRQA 2ACWA 5AJXA 1UD3A 2QZJA 3L7MA 3X2EA 3K32A 5EJ2A 3JVEA 4LDZA 3ZCPA 4AKEA 1VE9A 4GKAA 1ZR4A 1T3HA 3ZPXA 1Y7LA 1IRIA 2R65A 3D4OA 4X9XA 3SZLA 5K6TA 3GCXA 5K3SA 5TGZA 4G0XA 1II8B 1Q14A 2QX7A 3SM3A 5AD1A 3ONUA 3WLJA 2H9IA 3LECA 3LK7A 4FD3A 3V8MA 1D2EA 2E0IA 1RJFA 4F60A 1CBUA 5JZBA 4EM6A 3T5GA 2A5JA 1K8QA 2YIMA 2CC2A 4RHFA 1P2GA 3O5AA 1PS0A 5IUKC 4HSGA 3DZJA 2WZNA 1PZNA 2F3QA 5K3FB 3WGVA 1U3CA 1E6CA 1P8AA 1UXOA 3NDIA 4RGBA 1CWUA 4QHTA 3E1KA 3PHIA 2YHIA 1J39A 1WZIA 4IH9A 5CCDA 4PGHA 2X9LA 2WJIA 3EVCA 4JA2A 3C5VA 4MWCA 5LMZA 1GSIA 3MJEA 3UFXA 5IULC 2P30A 4J16A 3RSHA 4RTMA 4URXR 2ZZEA 3IKMB 3TOZA 2DZDA 5IMSA 2WHPB 3FVVA 4F56A 3AESB 1MPXA 3D6UA 4E4TA 5FO1A 3BKWA 2OZKA 4B0OA 2J6HA 3BA1A 2R96A 2CJFA 4AAYA 3SVLA 1RLTA 5ELXA 5KYKA 3DZIA 2P3LA 1F0NA 1KYTA 4EY7A 1JI3A 2FFHA 4JQZA 4BIMA 4EVRA 4E7PA 4M1YA 4U8GA 3KOMA 2VWQA 3W2IA 3PFNA 1X2BA 2O2HA 1RC8A 1J2YA 2F4VB 1K3FA 3BCDA 1KZYC 3TZHA 1RFGE 3QE4A 3W78A 3PNLA 2GAAA 3ETJA 4NBSA 5TS2A 5AOCA 4OIFA 4YRTA 3MWKA 1MTZA 1NC3A 4QNRA 3K16A 2AZMA 3B7GA 1AQ6A 1T9BA 3BCSA 2G06A 5AVRA 3A3NA 2R6R1 3PUMA 3Q5EA 4OATA 5FTLA 5EZSA 1EFLA 1SU7A 1MAHA 3N8DA 4ECAA 1QCDA 4MUXA 1W46A 5BV2P 3CNEA 2ZI5A 4E2FA 2ERXA 4AUKA 4N7MA 3ZZTA 3L79A 4Q3DA 3V34A 1UOEA 2R9VA 1ZXLA 3TD6A 3WR5A 4F3KA 4PPGA 4UHKA 1S5PA 4OGGA 3N2EA 5B4UA 4LBVA 4FJ2A 5AVOA 1A9PA 2GXQA 4AJPA 4UD2A 3OZFA 4MO9A 3ADBA 1PR3A 1WXHA 3DMFA 2FQ1A 3EVZA 4TWIA 1XJWA 4JR1A 4MXDA 5ALTA 3DZ8A 5I9MA 3MTAA 5HRUA 5E6SB 1PVVA 1N6PA 1WLSA 2EZ4A 5BSMA 1KQPA 3AF6A 2FZ4A 4DANA 1SR8A 1KU6A 1KZ4A 2PBFA 1EB9A 2PMBA 2YXEA 2ZI9A 3DZHA 1AXEA 3OMLA 3PV0A 2IPLA 4IIJF 4NSNA 4LDJA 3SJCA 4CN8A 1ODFA 3O75A 1V16B 1MZPA 1EJBA 1L4YA 2MYNA 4TV9F 1Q7EA 4RETA 4WJZA 3V9PA 2HJGA 3ZD9A 2BP7B 2QVGA 3NJ4A 4PAMA 4UBNA 5KKNB 1ZUIA 1DIOB 2P6PA 4JOQA 4MKGA 4UU0A 4C22A 4BVLA 4H60A 4D4LA 1IY0A 2J6CA 2H1WA 2IYQA 1Z0FA 2BZ0A 2PGOA 2WKWA 1ZZGA 3M3DA 4KBGA 2XT6A 1N2IA 4ZCMA 3WIBA 4DHWA 1VHJA 2LTAA 4KQMA 4AW9A 1ACMA 1RBYA 5JBQA 1E1NA 5DLQC 1YQEA 2G17A 2PPVA 2CHQA 2C5EA 2DPGA 4PTZA 4UBIA 1YRLA 2O23A 1E92A 4DB2A 3CURA 1E3MA 3WL6A 1BS9A 1VRWA 2VDJA 2YASA 3KJXA 2DHRA 1ADCA 1A72A 1HMPA 4G41A 2CMKA 4B33A 4QBFA 4ZT6A 3ICVA 2QD2A 4XJXA 3NHZA 2PRYA 5JLAA 1WPCA 1AK9A 5BQ5A 3GZTB 5DGTA 4TN1A 3GGDA 1KYZA 3PT9A 3NUZA 4BV9A 2AUMA 3R5FA 1PKEA 2OKGA 4OK3A 1SXJA 2QNRA 3GA0A 2GRUA 4AF7A 2YYYA 4RHXA 4WWHA 2BKVA 1P77A 4OLAA 3GEDA 3ITDA 3ND7A 1QOQB 5AXBA 1T0JB 4ZK6A 3RLIA 2G63A 1P74A 4NAHA 3WKAA 1HA3A 1TAGA 3R6GA 4ODIA 1MOSA 2BFOA 4QASA 5YASA 1ULHA 2A1TR 1ZXBA 2BMFA 2C78A 3AGPA 1DOAA 1P1CA 3C3MA 4RCVA 5J47A 4I1IA 5T67A 2NSHA 3RRXA 1UBJS 2IZ0A 3E4DA 1Z28A 3BDVA 1KK3A 1IIRA 1YZKA 2M1ZA 2W0MA 1HRKA 4RJJA 1RLIA 2XAUA 2EU8A 1C4WA 3N7AA 4BDSA 1F6BA 4TMTA 3TSZA 3V4ZA 1GOTA 4QXRA 3RG8A 1SXGA 3I1FA 2C9MA 2R7MA 3BPSA 3KALA 1CR4A 4G0PA 4Z0PA 4ZI7A 3NRBA 3A37A 1XDUA 3CF4G 1BD4A 2LRHA 4DJEC 1M54A 1KZ6A 1QAQA 2CFCA 1IYZA 4KW7A 1FB5A 2QJWA 4EHBA 2PX5A 1K6MA 4HZUA 3ZCUA 4NATA 2QMZA 5JV5A 3U3MA 2BFCB 4QU5A 1RAFA 3ST7A 3PEVA 5L3QB 2FWIA 4BX8A 1ZA2A 3ZLBA 2Z2YA 3EXAA 4EVSA 3E6AA 1GL3A 4EA7A 3FPCA 1MAVA 4IXMA 5FYDA 1ZVQA 3O4JA 2PEYA 4UHEA 3BWBA 1GKLA 3FMFA 1JQEA 1JT9A 1KGDA 1U7PA 2GBPA 3GVHA 4GBGA 3PQFA 2QL9A 3USES 4PFSA 2XMSA 4F4DA 2Q2VA 3LXMA 2UZ4A 4AY2A 1OBCA 3PJEA 3DBRA 3A9RA 4YYZA 4BWGA 4ZRDA 3WLRA 4FEGA 2HT1A 1UMBB 2XVYA 5KC8A 4LK3A 4O8ZA 3I9KA 4Z9AA 3IOCA 5JBNA 5JALA 5C8YB 2WOOA 1CLUA 4KI0A 5BVGA 1B00A 2AOUA 3N2GB 1RYHA 4XQEA 5I7WA 3M4NA 3VR4A 4ZAXA 1CUHA 2C9YA 1I2BA 3UJPA 1C7ZA 1I0LA 1VYTA 2JH8A 4ZT5A 3TOSA 1OI3A 1NJ1A 1PDOA 1XZFA 4XM3A 2HRBA 3DMPA 3L6EA 4JSTA 4Q1VA 4LE1A 4WBSA 2HNKA 1Y34E 4YCBA 3ROGA 4EWLA 2LW7A 1JQ3A 2ZBDA 4FMPA 1C7FA 2Z5VA 1W76A 3RSGA 4JYCA 3CF2A 3V6LA 3LBIA 2E3JA 4DG5A 4DQVA 5C4MA 1XPOA 1RM0A 1SQGA 1T2DA 4IIVA 1EAYA 1BJRE 2XY4A 2XITA 3ROTA 4ZJUA 2HWYA 1DADA 1RJWA 2N1MA 4A1OA 2JLVA 1R5NA 4EKEA 5F4OA 4HZIA 2CHVA 4WCFB 4LVUA 2RKWA 4NU0A 3MD0A 1KEVA 2DBRA 2QE7D 1RLUA 1MRNA 1KZ1A 4QU0A 1B8VA 2QYOA 2HU2A 4YH1A 1QVZA 4UARA 2ZYDA 4TMXA 1Y7TA 4XL9A 2WFLB 5COQA 1RKBA 1A5BB 2H1FA 3OTIA 1T2VA 1ESZA 1Y82A 4O02B 2YHUA 3OT1B 1Y9AA 3VTKA 2QMQA 4Z0NA 1P4RA 1J6UA 5ENDA 2NTYC 3KCQA 5DTJA 3ROKA 3LV8A 3MILA 4Y1RA 3ZCVA 2VC2B 1E43A 2E1PA 5T3YA 3ESRA 4WZLA 1THTA 2BEWB 1U3VA 2CE2X 3KTAA 4W82A 1UH5A 4KPFC 1Y1SA 4NOKA 5B7GA 4X93A 5AJUA 3AUKA 4YROA 3UJBA 4CTKA 1M1YB 4I3GA 1GU1A 3W3AD 2WQ7A 1OJLA 2E9SA 3JS5A 2JGRA 2PD6A 1SKUA 2HF2A 3C1OA 4C05A 4Q9LA 3SXUA 4D3ZA 3TUIC 4TKOB 4YBRA 1IJBA 2AZ4A 3L0BA 4QGAA 3RVJA 3X1DA 1O97C 2PUEA 3UENA 1TGYA 3E05A 4XRRA 1NNUA 2YXDA 1MJ5A 2ZULA 4UBJA 5CJPA 1AZSC 2DWUA 1FSZA 4LY0A 4M8NE 5ERXA 1JXOA 4HWKA 4P54A 1W88A 3PEFA 1GCOA 2PU5A 2REQB 3O8LA 3HLYA 2RHRA 3SE0A 3OTQA 1Q0UA 5EMJA 4RWEA 3V8NA 1JEQB 4LOKA 1ZS9A 2KQUA 1T0BA 2JKZA 5H3LA 3TXXA 1OLSB 1JH9A 1OPRA 2CMHA 4XGQA 4R9VA 3FZGA 1V5VA 1B8PA 4D80A 2ZREA 4MW2A 4GMHA 1ATZA 1KY2A 3MWDA 4FSDA 4XGRA 3TO5A 4E08A 3I4LA 5I4IA 5I8WA 1PCXA 1GPJA 4H59A 2EW8A 1DWUA 1I51A 1NV9A 1XA0A 3DCNA 3DM9B 5A05A 5BP7A 1NFRA 4J43A 2XUIA 1NKSA 3CTPA 4C7OB 1KORA 1J07A 2X9NA 4OQXA 1SC9A 4HQFA 1CPYA 2R8OA 4DC1A 3A0RB 3SR0A 1YQQA 2Q27A 1OLUA 1ODIA 3WAKA 2H85A 3OFKA 4HGZA 1XMQB 4XVRA 1YBFA 4Q3BA 1GWNA 1LU9A 1FMTA 1R6BX 2ZJ7A 2I99A 3NWBA 4N6NA 1WTAA 3F6CA 4QGGA 3A58B 3QVMA 1R4AA 3RC7A 2JD1A 4Q1FA 1IWPB 1A4IA 1DEHA 4L6CA 4M9SA 1YVRA 2C5HA 3ZY4A 3NI2A 1C5KA 1NQVA 3KPWA 3MELA 3KQUA 5ADUS 3E2PA 4QXQA 1B16A 2P8JA 2GASA 2BDEA 3JATB 4HQRA 1Z16A 4QYTA 1I80A 5C0OE 3FSGA 1DBIA 3BMNA 3HDQA 3NV7A 1RWQA 2QP4A 1OLUB 2FPGB 3DE5X 1A04A 1EUCB 3TNLA 1RD4A 4IDNA 1N5MA 1Q2XA 3WKBA 3OQNA 4HMQA 3G85A 1JKIA 5EP3A 5DM60 4CV1A 4MLZA 3IV9A 2Z4RA 5BSEA 1V8FA 3E22B 1W4LA 4B2IA 3DQPA 5JSKA 1M6VA 4LBYA 4YMLA 2BI4A 4C7KA 1N1DA 5JECA 3DDYA 1C3VA 1JR4A 1QSGA 4XYGA 1T5SA 2QRVB 4PINA 5GONF 5LR6A 1QVWA 1R3UA 1RHKA 3LC1O 4O2BB 3DFZA 4YT2A 1WS6A 2QN9A 1BOOA 4WCDA 2I03A 2DUMA 2ODTX 3FTCA 5H3CA 2PLWA 3WBFA 1R0RE 4QU9A 2HW8A 2JLBA 1L3IA 1S2MA 5DWQA 1RC1A 1T4CB 2IY9A 3RVKA 3ZVLA 3C3CA 3IEKA 4YREA 4HDOB 1FNNA 4HXEB 2L69A 3B2NA 4EUHA 2VBGA 2FZGA 4V0LA 4CDRA 1GTG1 4MAMA 3BH6A 3IUEA 4MDYA 3D26A 3EZXA 3AM3A 4JC0A 5FRDA 1Z82A 3IOEA 4GEKA 4R2LA 1S3SA 4BLUA 2YJGA 4JGGA 5JJBA 3VYRB 4D9GA 2AN9A 2HF9A 2N75A 2XNKA 2YWGA 2DBQA 1CSEE 5F12A 4NFHA 4JP1A 2CFRA 2PFSA 3CCFA 4WVLA 3K2EA 2OFOA 1U8AA 1LPOA 1UXGA 4I9NA 3F3MA 1JHRA 1G59A 1XLTC 2IP4A 3M82A 4R6WA 3CCEB 1ONBA 3TS1A 3BTSA 1I2DA 4K6KA 4QXOA 4QFCA 3HUFA 4WOPA 2EBFX 3B2QA 2JN9A 3VPCA 1Y4DE 2F3UA 1LDYA 1QHEA 1UT6A 2ZRKA 3GARA 4YMIA 5IASA 3IH5A 3M9WA 1A77A 1MP0A 4RU1A 3SF0A 4BOYA 1YDGA 5BNZA 1MKYA 1Y8AA 3IVCA 3L2OB 2X4LA 4U2EA 1PV1A 4TVSA 4YQFA 3PDUA 4TMZA 2YBEA 4FQ5A 1RSZA 3L7BA 1CLEA 2X9GA 3M2PA 3AL2A 4I9GA 3FMOB 2GXSA 3E5HA 2EDAA 2F1LA 1F3OA 2A3RA 3PI7A 3BE5A 3ZBTA 2DHQA 2KVOA 1E8NA 4PLTA 1O6ZA 3WNQA 2Y0EA 2FJ0A 4E15A 5LYYA 4I3HA 3GDGA 1E2KA 4K5QA 2WZDA 4D8TA 4AU1A 1OZ0A 1E2MA 2CCJA 3R3ZA 4L8VA 2I3GA 3M1IA 2GF0A 1T1JA 2AVDA 2JCSA 3R1IA 3L0ZA 3ON5A 3QP9A 1J2TA 3HBMA 3LKDA 2DLNA 2MINA 3ONEA 3UWSA 1EFCA 5JATA 4ZVRA 5KTPA 1JR3D 2X2EA 4KQIA 2Y1GA 1BZYA 3N8HA 3D6HA 3EWAA 1NXVA 1W35A 3U4QB 1JSCA 4N65A 2WM3A 2YWJA 4U2CA 2CDNA 3JR3A 4KR9A 2VHTA 3S68A 1H9AA 1D8TA 4GYWA 3EAFA 3SJPA 4LWOA 5G0VA 3V4RA 4MWOA 2C9DA 2X4IA 3ZGZA 2R5NA 5KX5B 1J0AA 1YFZA 3LY8A 1Z08A 4KE6A 2GM9A 4CMBA 1JLMA 4PO3X 5KMGA 3I92A 4R40A 3GZJA 2R1TA 1H42A 4DCUA 1VI6A 3AILA 3SMQA 3ZI0A 4EW6A 3DSRA 3AVXA 3NRCA 1AKVA 3UA4A 1V0JA 4W5HA 1KKLA 2KYRA 2REXB 3AEXA 3EIEA 3HRKA 3I9LA 1DQRA 3EXEA 3AJ9A 3R6LA 3WL7A 4B79A 1SHLA 3GNLA 1E94E 3K0FA 5ALSA 5BW8A 3TBFA 4O4LB 1SC4A 3IP6A 3R7WA 4PRKA 2PZKA 4NZMA 4PR0A 1PD0A 5FBLB 1NZDA 3UT5B 2YHBA 3Q72A 4HDCA 5IG2A 2Q8NA 4OLJA 5A3VA 1XDWA 4WBNF 5KAMA 1E1QD 2G5GX 4MIKA 2ZBUA 3H9QA 1EFPA 3ZWVA 1NJ6A 1QG6A 4W63A 2H4HA 5LP6B 2V7BA 2WSIA 4IOKA 4Q16A 4XYLA 4CLEA 4GOND 2H4XA 5JPCA 3KZMA 4RHUA 1HDEA 4L6AA 3RU7A 3TNYA 5KZMB 1APBA 3ICQB 4I5FA 4JGBA 5CHEA 1JB9A 3DAHA 1ABBA 1XDSA 4BQFA 3EUEA 3S5JA 1J49A 2PK3A 4UOZA 5LJLA 4TLMB 4J0EA 5B3JC 3K9HA 2OHVA 3GCDA 2MDTA 2JFZA 1QAMA 3B1VA 4RY0A 1NC1A 3GLGB 1UPCA 4XSHA 1EG7A 4BB9A 3GK3A 8OHMA 2IYWA 5IYNA 4C14A 4LYFA 1AIPA 2HQRA 1PX2A 2O7QA 1BQEA 4NYMQ 1LBSA 1X7DA 4F0JA 1CJKC 1E5DA 1Q84A 2Y71A 1GQYA 2FJUA 3F5QA 4BDTA 2QN7A 4CG3A 5AUPB 2V0CA 4GM1A 5HK9A 1UBHS 1D04A 2A9VA 2EFCB 1BE6A 2J30A 2QRUA 5IXSA 5LQMA 3I55B 5I4KA 2GCOB 3LWBA 5JAQA 2Z4TA 1KZLA 3DB2A 4ACBA 4B7XA 1PLJA 2P41A 4R1UA 2EFHB 3BB1A 5B3AA 4BCDA 3DMTC 3R7NA 3HU2A 2ZL7A 5JMTA 3VUFA 4B7CA 4JR0A 4RTOA 5SYMA 2DMRA 4J2HA 4DM7A 5JADA 1I18A 4JJGA 2GF9A 3AIIA 4FGKA 3ND5A 4X7CA 2Q3HA 3L05A 2AQKA 5BSVA 2VTBB 5TQ2B 3M0EA 2ESRA 1RWNA 1AKNA 5L9AA 2D5CA 3BTVA 4TWRA 5J2TA 1PR5A 3IA7A 3CU5A 3HCAA 3ZBPA 2J3QA 2VT7A 1XAIA 1BKDR 4UZFA 4WWVA 1OUMA 2CXTA 3A9UA 3B8EA 4L5YA 4RJKA 4Z4YA 4EPWA 1DE0A 1AGPA 3K5PA 3QVTA 1O94A 4H7DA 4RV9A 3IFSA 3ZGLA 2Y2UA 4EUKA 2XCRB 4HGNA 3QFSA 4FFSA 1EXDA 4X6UA 4V2IA 1YAJA 3NE5B 1KC1A 1W4BA 4D4KA 1OZAA 3VU9B 5BWOA 4P0TA 1WUHS 1N6KA 3H1AA 3U81A 4BZPA 3E7WA 2G5PA 3M5PA 3S29A 1KEEB 1ZD9A 2MYPA 3S6JA 4UFPA 1MC8A 2BISA 3G5UA 4QUEA 3VHXB 1JWLA 4Q48A 1KYIA 2ORYA 2J9YB 1ZVKA 2PYIA 3QLVC 3CKLA 3WTCA 1H2YA 3IUBA 2YBDA 3GCZA 1TCCA 3INYA 2IDZA 2NT4A 2XNSA 4HDRB 4P93A 1ZJYA 2RGRA 3FLMA 6REQB 2BGJA 1Q15A 2GN8A 2WT9A 2MYUA 3PTZA 2CVOA 3QVSA 5CYOA 3OLQA 2JCGA 2Z4SA 5B2EA 5L7WA 3SQWA 4QNMA 3A8KA 4XVQA 3SFZA 1A4XA 2DAPA 2GA9A 3D5TA 1NP3A 4EDFA 2DT8A 2WSBA 5TQVA 2P9ZA 1E2QA 4OCZA 5ESXA 3QHPA 1ATIA 2X6TA 2Y93A 2JFNA 4GXRA 5KOJA 3BIFA 1W94A 2WKPA 1LDMA 2WFAA 4S12A 1A8PA 1ULZA 3ZCSA 3VKUA 1S8AA 1WXWA 1WY7A 5A5FA 4FZVA 5BV8A 5CB8A 2XOEA 3E18A 3KSUA 4GOKA 2FSIA 2JZOA 3I64A 1CERA 2M2IA 3SG0A 3T7IA 1XQBA 4X00A 1ORRA 4L57A 3TLAA 3A6PC 4HNAB 5ED4A 3RYFB 1OFUA 2H18A 2XIQA 3WFIA 5AKEA 4WBXC 2XJ9A 3EH2A 3Q39A 3R6KA 1MZVA 1TNDA 5HEKA 3W5AA 3KXDA 1BH6A 4QUHA 4WE3A 2GYUA 2VHZA 2ZSDA 4D9CA 5BSKA 2H29A 4XJVA 4FGLA 3JASA 4UJ5A 1BSVA 3AJ8A 5IEJA 2VPQA 3THYB 4KO2S 2BCGY 1ENZA 5EJ5A 1O8BA 3QX7A 3ASRA 1ONNA 4I1UA 1LVHA 2WJVA 2RMKA 2FUKA 2WAMA 4HUJA 4UREA 2PKRA 1YCHA 1C7IA 2GK6A 3GELA 5K7SA 4DUGA 3ORYA 4HIZA 3K2IA 2P9TA 1BA3A 3ZWOA 4EHDA 1G1MA 2QVYX 1SEPA 3A1CA 3BWCA 2D1SA 3MD9A 1IEXA 3WVNA 5ABPA 2OD9A 4NU8X 3UCFA 4JU9A 3DKVA 1Z45A 1HDZA 2GF2A 2V9CA 3OZAA 2GOYA 3KPUA 4KJZA 2R84A 3PFWO 2OMKA 3OEHA 4TXMA 1C7JA 2WTXA 2IHBA 3GWZA 4KQXA 5EHQA 1WWKA 2X0DA 5FYQA 1MFPA 1Y89A 4HADA 2VHVA 1NATA 3TXYA 3GN1A 2WF5A 3OJEA 4H4EA 1N3IA 1VIMA 5EJEA 4UXHA 2JZNA 1R6VA 2KX7A 2R11A 3I83A 3JARA 4D98A 4FFNA 2RONA 1UPUA 1MIOA 3URKA 5FWNA 1LLFA 2WEKA 2C8JA 2RGWA 2Z8YM 4D43A 4XQ9A 3FGZA 4TRRA 1MX5A 4Z86A 3NONA 3TJZA 1F06A 4PYOA 2V3CC 5TVGA 3T5BA 1CR6A 3JAWA 4MRRA 1C3OB 1XHEA 3UCXA 2YJTD 4BV8A 2OMEA 4ZMRA 3MHPA 1VIVA 3U5TA 5KI6A 3P32A 5C1PA 2QXTA 2ZRLA 3DDOA 2QAGB 5DSTA 1GKYA 4BVHA 3UIEA 2BFPA 3CC7B 1NBMD 2ZQ5A 3GX1A 2D59A 3EQ2A 3NCHA 3O74A 4CL2A 2XMRA 3TW8A 4BZXA 4X1YA 1XSEA 4YRGA 4CEJA 1MDFA 2TECE 16PKA 2PFGA 1VL2A 4G2NA 5MN4A 2IV3A 3WYAA 1NBWB 4DSTA 1F38A 5ADHA 1HR0B 4LVOA 3IULA 1JSLA 1B15A 3CWCA 3VZPA 4GM4A 2YVUA 4IR7A 4NLLA 4OSOA 5ED0A 2JGMA 2RIRA 2XCOA 3ZU2A 4EX6A 3FBWA 4TXHA 3TUJC 2AFRA 2ZU0C 2ZSBA 1IXSB 1MA0A 1GRNA 2QDXA 1IDN1 3T4UA 2YJ5A 1P0IA 5JYDA 4BKPA 1HT3A 3JZDA 1E1CB 2FN4A 5EFOA 4FE4A 5BQOA 3DZCA 4EY4A 4TL8A 3FKSA 1QIFA 3FCUB 1KYQA 1V6SA 3ORFA 1KOLA 1GP2A 3IMKA 3CKMA 4WZBA 3N0WA 2Q4EA 2ZR9A 3P9PA 4MI1A 4N54A 3CF4A 3V33A 1COZA 4KGXA 3K71B 1QF9A 3GA5A 9ABPA 2NT3A 2WIJA 4ZHQB 1T10A 4JT4A 4C4XA 2GN6A 2JEYA 2YUTA 3Q9NA 1ULSA 2ZYWX 3ZWCA 3UWMA 4O8CA 4XWYA 1VHTA 2ORIA 3IAFA 1NR5A 1DBVO 1F51E 4U7JA 4UNPA 2BFFA 4IJ6A 4JXXA 1QDEA 4J3JA 3AJDA 2NV4A 1YI2B 3DT6A 4NZNA 4TYWA 1D0SA 3O8OB 1IBRA 4K3VA 2AX3A 2VYND 1W0CA 1T8SA 3BJZA 4DWOA 4I1VA 1M5UA 3W9SA 1CJTC 5JS2A 4DV0B 1PUIA 4HTFB 4MS3B 1JHMA 3GQVA 3CJTA 4WH0A 3U37A 1Y48E 4WXMA 1GL9B 5FORA 3SHOA 2V3VA 1PUXA 3NTXA 3WNZA 1MAWA 3WA7A 5KSOA 3QU7A 1R88A 3N2YA 1H6CA 1ZU4A 2X5OA 2EF0A 3HADA 5B1IA 5B3LA 3KT6A 2A5LA 2VUIB 4OEHA 4QU8A 5M7EA 4BRUA 5EMHA 3MUEA 1VL1A 1JHZA 2QUAA 3AWDA 1EK0A 1GUAA 2I2CA 1A9SA 1DSSG 1JVBA 1VJ5A 2DQYA 4NQRA 3HNRA 1Z0AA 3EVEA 5FUXA 4DV2B 3HCOA 4YV2A 1VQ6B 5BURA 2VRNA 3NB0A 3W7BA 1XL1A 4MI6A 1ZBQA 1Z6QA 3D4LA 1HURA 5CPFA 1PTJA 3KYCB 1JZSA 4FFVA 5I48A 2BZSA 4FR5A 3H3FA 3IVAA 1G20E 3GJYA 3RW9A 1W49A 3G4SB 2CL0X 4Z4UA 2AGVA 2QV7A 4JUAA 2QAJA 4BMOB 1O03A 1XL0A 3A04A 1G5FA 1UT5A 4OQYA 1SN7A 2FJPA 2F48A 1E2JA 4L7VA 4HS4A 1N25A 2EG5A 3F5FA 2V8OA 1PZEA 4K8RB 1GUBA 4RORA 1YCFA 3DTVD 5BRNA 2FLKA 3B82A 4FDUA 3CVYA 2OUIA 3CE6A 2GBLC 1KZGB 4XQGA 3LGXA 4HJRA 1CUVA 1Z0JA 1MMFB 2CYAA 2HWWA 2AFHB 3ND8A 5LQNA 5DBHX 1OBHA 1QUFA 4Z8YA 2I3ZA 2CBZA 1BEEA 1P6QA 4QEZA 4YC7A 2X1LA 4NIMA 4KVFA 4A8HA 1E4OA 4MI3A 2UUAB 3CR7A 4QVJA 1SKYB 1AUPA 3D54D 4RADA 4LXIA 2Y1EA 2WBLC 4UVIA 5KTSA 2IPOA 3GL9A 2K87A 3IUMA 2ZAGA 2JEZA 4UULA 1QB8A 1U2ZA 3OX4A 2O8BB 1UC5B 1XVLA 3MUOA 4J0KA 4O4JF 4LHXA 3PA2A 1IAVA 3PHLA 1N5RA 3HQ4O 3FJOA 3COPA 1AO0A 2ONZA 4BUJA 4AB1A 4F7DA 3SEFA 1TAQA 1GDHA 3STUA 1FSPA 4OHKA 1ZRSA 4BUCA 4EGJA 5CA0B 5DGXA 2P79A 4MVJH 2W6NA 2R8PA 3MJTA 4DIUA 2ENWA 1F12A 3HPRA 5ERYA 3PVCA 3JRWA 3LUDA 1SEVA 1KFCB 1BGXT 3BFPA 1JVNA 3F98A 5JPIA 4EFNA 2GVZC 4GKVA 1B6GA 5G0TA 3ZPNA 3QE9Y 4E5UA 2AEFA 1RWPA 2GTPA 1SB9A 5C37A 1P9WA 2JARA 3GRYA 3KWLA 4AKIA 4Q1CA 4ZOAA 3QEJA 4E4RA 2OOKA 5C5CA 5CB0A 2J9RA 3I8OA 3M49A 2Z8YA 4RF4A 5BN5B