1E63A

Ferredoxin:nadp+ reductase mutant with lys 75 replaced by ser (k75s)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPESLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FERREDOXIN-NADP+ REDUCTASE
publication title Structural Analysis of Interactions for Complex Formation between Ferredoxin-Nadp+ Reductase and its Protein Partners.
pubmed doi rcsb
source organism Anabaena sp.
total genus 89
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2000-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1e63A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1e63A02
4PC6A 2X3UA 4Y7CA 2PLFA 3OZUA 1QFYA 2B5OA 1VQNB 1QG0A 1ELOA 3CC2B 1R5BA 3ZZUA 1OGIA 3WNBA 4AF7A 2OK8A 1VQ6B 1QX4A 3OW2B 4PGOA 1EFTA 3W2EA 4RCYA 1YITB 1DDGA 3CCEB 4AF6A 1EP2B 2QMUA 1QVFB 4YAWA 4YAUA 1JJ2B 1A8PA 5TR9A 4YAOA 1YJ9B 2OTJB 3OZWA 1VQ4B 4ZGNB 1VQMB 1TLLA 1BX0A 2C77A 1OB5A 2HCJB 3CW2A 2BMWA 3B78A 3E1YE 4U9UA 1VQ8B 4C0SA 5TY0A 4PC1A 3CCLB 2OK7A 4B47A 3ZZTA 1QGYA 4ZCLA 4NBSA 3U6KA 1QUFA 4P3YA 1KTVA 4J0QA 4RCZA 1DDIA 1Q86D 4PC7A 3CCRB 4G5GA 4M53A 1BX1A 4B43A 4ZCMA 2QN6A 3W2HA 2YWFA 3VMFA 1YJWB 1E64A 1ZM3A 4WQMA 3LVBA 4LBWA 3JQPA 3LRXA 3LYUA 1YHQB 3WYAA 1OGJA 1E63A 2B7CA 3OJWA 3W2IA 1KQSB 1KJZA 4R71A 3CD6B 2BM0A 3W5HA 4M1KA 4G1BA 2XNCA 3ZBTA 3B8HA 1XB2A 4F7DA 2AHOA 4FK8A 2BGIA 3VO2A 1M90D 5AN9A 1CNFA 3LO8A 1TTTA 3AVXA 3JQQA 4IW3B 2BVNA 1KC8D 3AVYA 3G6EB 1D1NA 4N3GA 5GV8A 1QVGB 2VZLA 1E62A 2BPOA 4ACBA 3WNDA 3CC4B 2RC6A 1FRQA 2CNDA 4ZCIA 3B82A 4ZV4A 1QH0A 3ZZ0A 3CB4A 1VQ9B 2HDNB 3AVTA 3CCSB 1H42A 1CQXA 1Q81D 3G71B 4YHBA 1D2EA 1G7RA 5KSWB 1JA1A 1SM4A 1CNEA 4MYTA 3QSYA 1VQLB 3SJZA 1VQKB 1QFZA 2BF4A 2YWEA 1ZM4A 3W5UA 1EFUA 1FNBA 5FA6A 1J9ZA 1QGZA 1N0VC 1GAWA 4MYUA 4TN1A 1VQOB 4Y9UA 1EWYA 4UAJA 4HE6A 4B44A 3AVUA 1WDTA 3QFRA 5TV2A 4HE5A 3OZVA 2GQFA 1FDRA 1R5NA 2DEUA 3WBKA 3ES9A 1DG1G 1YJNB 4FWTA 4EH1A 1ZM9A 2VNIA 3W2GA 1XE1A 1FNMA 1TVCA 1EP1B 3WBJA 4B48A 3JQRA 4BPRA 3OJXA 3CMEB 4LBZA 1N0UA 1AIPA 4N3NA 2XNJA 3AGQA 1VQ7B 4PC2A 1GR1A 4LBYA 3QFTA 1Q7YD 2BSAA 2CRVA 2DCUA 1K73D 1IJFA 4H9GA 1GVHA 1U2RA 3U6BA 1BQEA 1QUEA 3VO1A 1ZM2A 1TUIA 3MHPA 5GV7A 1OB2A 1G7CA 4TMTA 3QFCA 4YAFA 2EIXA 1GAQA 2QDXA 3MCAA 4PC3A 2QTLA 1IB0A 1F60A 2D74A 2VYQA 1JA0A 2YWGA 1IJEA 1W35A 2PIAA 5H5JA 2C78A 2R6HA 4ACAA 3QE2A 3WXMA 4P6VF 1FRNA 2VNJA 2EFGA 1KK1A 3P27A 5THXA 1SKQA 1D8TA 1N8RD 1EFCA 1M1KD 4M0LA 3CMAB 1KRHA 4C43A 1G7TA 1NDHA 3MMPA 1GJRA 2YWHA 1ZUNB 4K1XA 2FX3A 3AVVA 3QFSA 1JNYA 2B7BA 1VQPB 3U2QA 1B2RA 4YALA 3WNCA 4TMZA 2DERA 5EMNA 1YI2B 4RD2A 3J81k 1I7PA 1W2BB 3CCVB 3ZC3A 3FJOA 3CCUB 1FNDA 4M2LA 3W5VA 1BJKA 4M4SA 3I56B 4ZGQB 4RD3A 4RD1A 2GPJA 2DETA 2QEXB 4LC0A 1F20A 4RD0A 2QTZA 1K9MD 1QFJA 4TMWA 4TMVA 1KD1D 2E1RA 4QHYA 2BGJA 1VQ5B 2OTLB 1JB9A 2VNKA 1KK0A 2BV3A 4FN5A 3AGPA 1UMKA 1YIJB 5DSZA 3G4SB 1B23P 1EP3B 4TMXA 1G7SA 2ZITA 1KK3A 2J7KA 3CRZA 1R5OA 2DY1A 4B3XA 4RJLA 2RC5A 3W2FA 2BM1A 5H59A 1QGAA 2QA4B 1Q82D 1H85A 1W34A 2VNHA 1HA3A 4RD6A 5HXBA 4AC9A 3E20A 1EXMA 3P26A 2PMDA 4DQLA 1NJID 2HMAA 3A1FA 4B4DA 2BN4A 4G1VA 3I55B 1S72B 1W87A 3FPKA 4RD4A 3CXCB 2NPFA 4QFMA 4DQKA 3WY9A 4NCNA 3VNVA 3CPWB 3CCMB 1S0UA 1DARA 1K8AD 3AVWA 1KK2A 3CCQB 3I1FA 4Y9RA 3VNUA 3V76A 5JBQA 1FNCA 1AMOA 2XEXA 1GO2A 3ZBUA 4LBVA 3CCJB 3CC7B 4Q7JB 3PENA
chains in the Genus database with same CATH superfamily
1J1UA 1FS6A 1LC3A 1HZEA 1IBSA 1P74A 2RCNA 3BH7A 3RO7A 3V1KA 3TW8A 4PZAA 3SQWA 1UZNA 4MYCA 1YA6A 1N7IA 1ECGA 2I5PO 3A0RB 3O8OB 4MLDA 4TQGA 4CQLB 4NXNB 3R9WA 1EQUA 2OB1A 2P9QA 3WVNA 1FU7A 2JKZA 5A9SB 1U8UA 4BMPB 2QX4A 3FETA 3T41A 1R64A 4Y0NA 3GVCA 5J2TF 5CB4A 3ONVA 2VG8A 1YR1A 1ELOA 4P3PA 4S1TA 5JNUA 1VA4A 3IPLA 1CZKA 1EIZA 3ICCA 3O92A 3OLCX 4MTCA 2QM7A 3OPNA 4WOPA 5KU7A 4EMUA 4ENWA 1H3NA 1NR1A 3K0AA 4IY1A 5BW5A 4J1TC 3TQHA 1EFTA 3IURA 3WRWA 3KPYA 4BO6A 4MHSA 3MT8A 1YITB 5AHWA 4TYMA 1THMA 3IAEA 4B81A 2ZRJA 4YMLA 1ECJA 3NWOA 1JFTA 4Z4WA 2BZGA 2A0XA 2IPAB 1A8HA 1MHTA 3ZLJA 1KIAA 5EC8A 4BBZA 5BW4A 1SBHA 4GZ6A 2QXTA 4X8MA 2UZ1B 1UQRA 2L2QA 4BEWA 3MHTA 4PM4A 3HY4A 4R8MA 5C35A 3A1UA 4JROA 4YEJA 4Q21A 5KIAA 4XD2A 1RLOA 3NDBB 3R3JA 3NU1A 2OE2A 1U5BB 5LLDA 4BASA 3EPPA 2FX2A 4H6VA 3TFWA 3GG9A 1KQ3A 5B7PA 2GJ8A 3L18A 3FBGA 4QTUB 5AVWA 1E7WA 1N3YA 3GZNA 5DU2A 3LCUA 1NP6A 4JWKA 5LU8A 2O9JA 1J22A 1KFJB 1WDWB 4TYNA 3MSCA 2H9YA 4DXAA 1GQ2A 3ER8A 2YX1A 2P0EA 1R1DA 3AB7A 3Q0TA 1L4UA 4TGLA 5LP6C 5C5CA 2CV1A 4B80A 4KPYA 1FTQA 4RAQA 5FTMA 4DSNA 2CLHB 2OO5C 3WKAA 5D51S 3L9XA 1SUIA 4LHSA 4RO0A 3AKDA 2Q0HA 1EGMB 4Z4HA 3H7IA 3BA6A 3ZZTA 2FG6C 1DCMA 4XN3A 2Y68A 2QYOA 1UC5B 4ZCLA 2G6BA 3UA3A 3U6KA 2JLZA 1KVRA 3VPHA 2V1XA 4H17A 5C8YF 3RU7A 1ISHA 2X1LA 2DCMA 2V7TA 1KTVA 2GLTA 5F4ZA 4E11A 4EG6A 4QXQA 5EKXA 3LPAA 5CT8A 1B76A 1Y4ZA 3S2UA 1Q86D 2C5SA 1LFDB 1DT5A 5LR6A 3QHAA 4PR0A 4J7AA 4KKVA 1GUYA 4Z4YA 3D8HA 4NMWA 2Q62A 2NAPA 4L75A 2F55A 5IJ9A 3H5VA 5JS6A 1XZBA 3K53A 5LPNA 3U39A 5JSQA 1B15A 3HCEA 3GUYA 3V2IA 2BZ0A 3SC6A 2IS1A 5FI3A 5K4GA 2REXB 3H5IA 4WJLA 4DNRB 3EWSA 3LJKA 3SJCA 4ZZ0A 1B3BA 4RBNA 1QCCA 1UXOA 2COEA 2QQ0A 6Q21A 2O2SA 3TNLA 4V0MA 4DBLE 1DC4A 4F1KA 1AN0A 2P9CA 3MCZA 2LR0A 1M1XB 4KODA 4QFDA 4QUDA 4TL9A 2OXTA 4BLVA 1BMQA 3ZD6A 1E63A 2IZ5A 4CDGA 3HXQA 4XWAA 2R97A 4D57A 5CPFA 2PL5A 2WE7A 4BNVA 3REOA 2X5XA 2YNMC 1I2DA 1JLRA 3DFMA 3ETDA 3KOOA 4GOND 4U7FA 1CERA 2FN9A 5ECYA 4WDQA 1XRPA 4HV4A 3EASA 3O4RA 2F62A 4R1QA 1VPLA 2XR1A 2EWMA 1CVRA 1TT5A 5AJZA 2WF9A 3ZHOA 4G1BA 2XNCA 3GUHA 3VZDA 5I45A 4JVMA 3I2HA 4JYZA 3CX6A 4HQNA 1L2TA 3IKLA 3I2GA 4DCCA 2YC4C 1AGYA 3WRXC 3VDRA 2ZIXB 2ZFUA 4PZDA 4ZQEA 2Q8PA 1DQSA 5EE1A 1RQNA 2ZJ7A 5A3SA 2ZJ0A 2DQZA 3PPYA 4BNGA 4DYVA 5B7NA 3NONA 1E32A 3OE1A 2CB0A 1B16A 3AEQA 4D26A 1PJLA 2J48A 3FM9A 2Y0DA 4PU0A 3ZE2B 2A84A 2C57A 3GLHA 3JALB 1T2FA 3HB0A 4R1SA 4ZQFA 2GYYA 2RI1A 3CRRA 2NGRA 4Q01A 4C78A 1UMCB 1PR5A 3G7SA 2WB2A 1Y34E 5B2FA 4RDXA 4WZAB 1O94D 4QU8A 4R5MA 1Y0BA 1ZJ4A 1Y8ZA 3VOTA 1S8OA 1IZ0A 1G8GA 1HDCA 4B3BA 4QDXA 5CT9A 1D2RA 1NN5A 2OZPA 5EJMA 3N2KA 1GSAA 1XTBA 4J0KA 1A4XA 3VPAA 4R7GA 1JFVA 1FRQA 4FFVA 3UPTA 3UMJA 1ONPA 1USUA 2GXSA 3A1TA 1QF6A 1M8PA 1KQFA 4JT8A 4EMTA 4CFYA 2YDXA 4RH0A 1GAXA 2H2GA 4FXOA 1XEWX 3ZZ0A 3WGUA 2DWPA 2WV7A 4OA5A 4FIDA 2RI0A 1KZ4A 2Q41A 4GI1A 5IC5A 4ZT6A 2NU8A 2ZRBA 5CAEA 2Y9MB 3EMKA 1OUMA 2OO3A 2Q4TA 4LXUA 4UOZA 1FDOA 1TA9A 5FLEX 4BQPA 1BN6A 2H1LA 3VSBA 4F45A 1P1FA 2G1JA 4HYQA 3D7SA 1M1NB 2PXHA 4IEEA 4QPCA 1U98A 4DJDC 2I4OA 4L4UA 3CYFA 2RH8A 3KPUA 4XJTA 1PNRA 4MVCA 4CMIA 2G1KA 1Q0TA 1FE8A 5FLXA 4Q9AA 3K9FC 2QMYA 1IXYA 3BJIC 4BN0A 4KQCA 2O8DA 3UV3A 3V2UA 4XFKA 1RZRA 2YV1A 1W9HA 1HDGO 4BE4A 1AN9A 2BKAA 5FOWA 3LCMA 1GAWA 4MYUA 3PGA1 3UY4A 3RODA 1AK1A 1EWYA 4ND3A 5HIAA 3EX7C 1K08A 1S9HA 3OPYA 1OILA 1P5ZB 1V9SA 2HSJA 4WZBE 5AW1A 2W83A 2PM8A 5BO5A 4ODIA 5D00A 1ZD9A 1L5HA 3F78A 3QWBA 3OX4A 4TRJA 3KX2A 3GEMA 2J5XA 4RNDB 4MKZA 3RIHA 3SSNA 5KYWB 1SXPA 3QQPA 4A8JC 3OOYA 4BNFA 4XWKA 5LQAA 2ZYWX 1VRWA 2FPUA 5CLQA 2A59A 4PSUA 5CEFA 2D2FA 3PJEA 2Q1TA 5FL3A 2ZR0A 2AFRA 2BMDA 3NYIA 3W7BA 4LHYA 1YJNB 1TQDA 2CHGA 2LKDA 1Q91A 3EVZA 1TA0A 4ZRMA 4RTJA 1VKRA 4KVGA 4RORA 2DB3A 1SIBE 3EGIA 1C80A 3SHTA 1QQ6A 1O0CA 3A6DA 1P73A 1FRFS 1YK1A 4UE2A 3UW1A 1QPGA 4BPRA 3OJXA 3EVAA 5DULA 3NH9A 4DWOA 3LLVA 3X44A 1UPUA 3EC1A 2TRSB 3NHPA 2CFSA 4OMUA 1IVYA 1NJFA 1KHTA 1JBKA 1YJQA 3LVFO 5LB4A 3RVRA 4CCYA 1M6HA 1LSJA 4OJYA 4MW4A 1GR1A 1JEOA 2G9RA 3WJ2A 2ZCJA 2BSAA 4PZLA 2G4VA 4OGWA 3WDMA 1EGVB 5IXJA 2YIMA 1WWKA 1PR4A 2HKIA 4F5EA 2NYUA 3M6FA 3DR5A 1ZXBA 3QVVA 4ZO4A 4ZODA 5BR4A 4OGLA 3SQLA 5CJPA 5GTDA 3OOEA 1DZ3A 4HNRA 2GESA 1KMHA 3F46A 4HEA6 1IN7A 4RLQA 1J06A 2DQYA 3ZWWA 4A10A 3HXMA 4L5CA 4AG5A 2ARKA 3ZWBA 3CUWA 5T4EA 3C3PA 4J3JA 3DDYA 3BQJA 1OOEA 3PX3A 4TKLA 3LT1A 5AR1A 2C7RA 4MUBA 5LBIA 1TK9A 3OKXA 5ED4A 1C9JA 3DJYA 4U0JA 5L6LB 2B37A 3THXB 4QDJA 1ZBQA 3F9CA 1WSWA 3QG1A 3PNLA 3QXSA 5K6TA 1PRYA 1XTPA 2CBGA 2QLFA 1ZO8A 1T36B 5AD1A 5KNBD 2HK8A 3QLVA 3T9CA 1F5NA 4J6FA 2RIPA 3D8RA 4MQFA 2PSJA 2GCOA 1WPGA 2I91A 2QXYA 2VSXA 3L8MA 4XIIA 3U7EB 4F9EA 1ZG3A 1Y8QB 4QXAA 5ESDA 2PIAA 1Z56C 1KYVA 2P9JA 2JGDA 1N78A 3V97A 2C78A 3EG9A 5HEKA 1N2CE 4IF6A 1WBJB 4MWSA 1ENPA 3EEQA 1BTOA 1K4YA 1C3OB 1SFRA 2PUVA 2VF4X 3HJTA 3PHCA 5M04A 5IT9A 4G01B 1X2BA 2AQHA 1LQTA 2R5FA 1KK1A 4M9RA 3KJHA 4OK3A 2NZ2A 3C7DB 2X2FA 3G89A 2JA2A 4IX1A 1WZEA 4GOMD 5CX4A 4O3FA 4QYIA 1XTQA 2JLUA 4C20A 1UXHA 3DLHA 4A4DA 5BWBA 4MHTA 1TYBE 3ILHA 2C2WA 5L3ZA 1Z2EA 4UJ5A 1S2LA 2XZLA 4TTTS 3ZN2A 3L46A 3MMPA 3RSHA 1E8NA 2BGLA 4R8VA 4FOTA 3OFNA 2Z3WA 1QVRA 3COZA 1TZJA 4C0XA 3MMZA 2OO7A 4B87A 4EJSA 3E9CA 3KEMA 2R8ZA 1SXQA 1L5NA 3AJ9A 5TARA 2IOFK 4REQA 4G97A 2AXPA 2XKJE 3D7RA 2NU9A 5AI5A 4F9GA 5JI3E 3VKHA 1RZVA 1UWLA 4E70A 1X1RA 3M9XA 4ZVOA 5K2MA 4JLWA 5JD4A 1SBQA 1MX3A 4KRFA 1ZDMA 3R0ZA 4BHTA 3UKOA 2XCIA 4TKUB 2XBMA 2G4CA 3RRXA 5EMNA 3ZD8A 4PYRA 2J45A 3HP4A 1Q44A 1T2VA 5JO0A 2P9FA 1JMKC 3AEKA 1Z82A 3IAM6 1VLVA 4MXDA 1W2BB 4S24A 3CRVA 1W47A 3Q8LA 1ZOIA 1EMDA 2B3TA 2NX2A 2XZTA 3P0IA 4S0ZA 2N46A 1JNXX 1VG9B 2ZYGA 4L51A 3CMMA 1JILA 2R4QA 4RIFA 2QPOA 3I9MA 4D4IA 4YT8A 2Z9CA 1D7AA 3TTUA 2X1HA 1SOMA 4LC0A 3D4BA 5I47A 3LLUA 3SYLA 4Z2AA 1PFUA 1IPEA 4PRLA 2PT7A 2CL5A 4WZ6A 3TDMA 1YZVA 2XF8A 2LCFA 2OV2A 4YLEA 2OBYA 5EWLA 3TOCA 1FFWA 1EDEA 2YCBA 4ARIA 2DT5A 1PKXA 3IAFA 3USZA 1U1IA 3UJCA 4RHCA 1EK6A 3ETJA 4F8EA 1NM5C 1YBMA 5EL0A 5BN3A 1YS1X 2X0IA 1Z13A 3HG7A 3X1WA 3UANA 1KI9A 4FFWA 3W4KA 1YR2A 4BFZA 4XM3A 1B1AA 2A5DA 4IICA 4B8WA 4D9EA 3Q6RA 3GW8A 1DAEA 5KOHA 2UAGA 4OCZA 5KVQA 2Q4OA 2IJGX 2VK8A 4RABA 2GT1A 1VA5A 1TFRA 4KB5A 5F3RA 3ZE6A 1F1BA 2P9HA 4DJEC 2D5AA 3CF2A 1KPHA 2XUJA 2A88A 2GCEA 3C6XA 4QLOA 1YZGA 1SA0B 4KR3A 5CYOA 1TM2A 1AT1A 1AS3A 1BH6A 4UNQA 2WY2D 1E43A 2CB9A 3S8MA 3BK2A 5NULA 4KX5A 3O8DA 5DX8A 1R9GA 2GNAA 3TNYA 3GRAA 3AM3A 3ISJA 4P8RA 2G9NA 2DULA 3SIRA 1RHMA 1IK6A 4FMBB 3HC7A 1FDWA 4K9SA 1E0SA 3JZFA 5TT1A 1SCQA 1XT6A 2B21A 3Q41A 1ZSNA 2GJAA 1QGAA 1A5AB 1L6IA 2PRIA 2LZJA 3UFBA 3C8DA 4OV6B 1BKDR 3F7OA 2UU9B 2RHLA 1PFQA 4KIGA 5FJJA 3EQZA 4WV3A 5FXMA 3RU9A 5JSHA 3DAYA 3E22A 3MWEA 1AKVA 3UJPA 4UQPA 4C04A 2RIRA 3AUAA 1C3LA 4CCWA 2NG1A 3FPAA 3E20A 2KX7A 2YQZA 4LY3A 2EQBA 1RJ9B 1UMDB 3EZGA 1X2EA 3TRJA 3O3NB 2AJBA 5LOVF 4UE3S 3K6SB 2XDYA 2QVZX 4QYXA 4OP7A 4X7BA 4BDSA 2HIHA 2DPMA 4ENVA 3EUEA 3E3OA 1SKYE 2WVGA 4H4CA 1V5FA 3IFSA 1Z08A 1T8PA 2W2LD 3UAWA 4I5DA 1ZH6A 4DMKA 1E3QA 1WDKA 3FHLA 5ALMA 5CA1A 4JR1A 1CX9B 1U8CB 2NPFA 1MABB 5EJIA 3RFVA 2Q6IA 3A6EA 3G5AA 4R2IA 5DT2A 3I9OA 2H1OA 2VZ9A 3A9TA 3EARA 1NW9B 3RJZA 3WK7A 2NVBA 4G85A 4BMDA 5JR3A 2AKEA 1EYZA 1NWCA 1JIQA 2I3AA 4Z53A 1WETA 1A76A 3DEKA 5KEIA 1FQOA 3T0FA 1FUYB 2C82A 2XTNA 2C95A 3RG2A 3KJZA 2G07A 3EYWA 3FGZA 3TLEA 2RMKA 4PSDA 3X1XA 4B3TB 3FYUB 1SCNE 3I1FA 1G5IA 3D02A 3OE7D 5HKLA 1M74A 3GZ4A 3L8EA 4WXRA 4HDAA 1CUHA 5I4BA 4UEJA 3GARA 3ZPXA 1Q0LA 4LBVA 3C7KA 3OC6A 2O8CA 1XI2A 4MS4A 5I7WA 1NNEA 1H2RS 3O9MA 1W9XA 1GRQA 1YQXA 2X7XA 1ZLXA 4RZQA 4YQYA 4OQNA 3M2PA 4FC6A 5EJ9A 1GLVA 4FQ7A 5E2IA 4RANA 2IXDA 1L4FA 2C9OA 2D00A 2IE8A 4FJ2A 2D06A 2BGWA 1LVHA 4DQUA 1MG5A 4JUIA 4UAUA 4YO7A 5EGNA 5EFOA 3LQKA 3U37A 4AJ9A 2IOHA 1XNRB 1E9VA 3ZNPA 3NCTA 2GARA 4LOAA 1WUYA 2E87A 3NBXX 5IBPA 3ZWXA 4AMBA 5BWMA 1ST2A 1D2HA 3M2TA 3N07A 1EGHA 4M38A 3WYFA 1OGIA 4KWIA 3T52A 2PSFA 1YJ5A 2OK8A 5AO9A 5LD2B 3BGVA 3FFXA 4KIWA 2R7MA 3V00A 4OHBA 4F96A 3MFYA 1NC3A 2WVHA 2ZYSA 3W5JA 3THWA 3TTYA 1WLYA 1V8BA 4HADA 1PDVA 3O8LA 4IGAA 4CPDA 3EEBA 1DEXA 1HBJA 4H60A 3CX3A 3CCEB 2I87A 4YIKA 4ESVA 3CX4A 1SXGA 3ISTA 2DZDA 1VE7A 2FQYA 4XAQA 2QMUA 1EZ1A 3ZX4A 2RHOA 1KMNA 3BL5A 4JEMA 3QWFA 1JJ2B 1JFSA 4UCFA 3NVMB 2VDVE 1A8PA 1U6JA 2IYOA 1G5QA 3ZGVA 3WL4A 4G41A 1RMTA 2QUKA 1F12A 1W29A 5ISMA 2R6CA 2B5WA 4POOA 2OR3A 4LI3X 4EVRA 2GBPA 2WB4A 1GNQA 4DQVA 5CT5A 2Z04A 4F4IA 4QUIA 2JI8A 4O5AA 1YTUA 2VH5R 4ER0A 1YQEA 4MZXA 4MR7B 2C77A 1Y1PA 2HCJB 2HM7A 4WY5A 4IFIA 3TIVA 2RK4A 2YFHA 3PUYA 3U61B 2W0SA 5I51A 1PJSA 1U94A 2ISQA 3HRKA 5AKHA 1EUQA 4MS1B 3VR5D 4IIUA 2PGLA 2QLJA 2HLHA 4LJ9A 1JG6A 2F1KA 4X65B 1DUVG 4J90A 4BQRA 5FTWA 2AK3A 3U7RA 4EGJA 3FCUB 4LZAA 3D5QA 4D0RA 1VLLA 4UM7A 2AOVA 5EIOA 5LP6F 4GL4A 3KB2A 5CYPA 1O08A 2XRMA 3UBMA 2D0PB 3TM4A 1V35A 2J5RA 3JQ7A 4DF3A 1RAFA 5C1OA 1XJQA 3E84A 2NNLD 2AXQA 3P1JA 4RMGA 5H9WA 4XH9B 3E5RA 3R9XB 2Q9BA 3IDQA 2QMOA 1NWHA 3E7FA 4MVWA 3GL9A 3U7GA 3HGQA 2CUKA 3L0IB 3JZIA 4MUIA 4Y9DA 4ZCRA 1B0AA 3PFKA 3HL4A 3FTDA 5FBKA 4HX9A 4Z1OA 2GD2A 5GZ1A 4BWVA 2X8KA 1N9GA 2QAGB 3OCZA 2QUAA 2Z1MA 2FJUA 1CRQA 2CYBA 2GEJA 3COSA 3H0EA 4DHWA 1CY8A 3P7MA 1C7ZA 4OJNA 1ZUNA 2OP0A 3N2GB 3AHCA 5SICE 2NUAB 1ZIPA 2C3UA 3TPZA 2HF9A 1VKJA 4Y1RA 1E7SA 1OGYA 3TZBA 4L27A 3A9SA 3K6KA 5E1MA 3JQPA 1GRRA 2V4UA 3QJGA 1PO7A 3LRXA 3X1JA 4YJFA 4XVCA 3ZHZA 1ZA1A 3E48A 1RQPA 1GTMA 2BWJA 4LC9A 4K86A 3ZUGA 2PU5A 3AHHA 1B1CA 3R3UA 3FUTA 4EL5A 3UAZA 2BH2A 2GJ9A 1WPRA 1YIAA 1Z28A 4KBGA 3TQRA 4RF4A 2CXOA 3CPHA 2W2MA 3W5HA 1R27A 4M1KA 1XR3A 2GJSA 2PX0A 3LL4A 4ZAVA 3RW9A 5KTOA 3SF0A 5IWCA 3M4ZA 4A2CA 3UJDA 3T3NA 4P86A 3TTXA 4GPIB 2YWBA 2ZUSA 5CRIA 1OA1A 1Z47A 1L4GA 2WE8A 2FPIA 3DT6A 5CPBA 1J8VA 2PWYA 5BVGB 2GXQA 3P0JA 1ABBA 2BBOA 4TYWA 3WMEA 1GADO 1XAGA 2DKNA 3MQFA 3VSAA 2YICA 2X9QA 4DRYA 1I7DA 3IR5A 2JBAA 2YJTD 3QXJA 2ZRAA 4ZT4A 3CF6R 1XZIA 4I14A 3ZI7A 1T2EA 1U6KA 3LLSA 4P36A 3ORRA 4KE9A 1UEXC 1QIDA 3F74A 2DTDA 2VJMA 4NH0A 3MQ4A 2GEKA 1N2ZA 3OIFA 3EOAI 2P78A 3NDJA 5TVGA 3F7MA 1WPXA 3H9UA 3VV3A 5B64A 3LS2A 3JU4A 2XSZA 3RT9A 3FWPA 3Q2IA 3S2YA 2JI4A 4DNTB 4BVLA 1TQ2A 2HO4A 3A9RA 4ZRDA 1EM8B 4BNIA 3WNDA 1C2YA 1EM6A 2F1OA 3DOJA 4L7VA 4MICA 4ZAZA 1C81A 1WDLA 1YCHA 4LKOA 4RSMA 4ZIRB 5JSFA 2BFDB 5JVDA 2AOWA 1N32B 4QVAA 1S2IA 4QWWA 5AK4A 3BEDA 2WKSA 2OGTA 2FTKE 2RI6A 3QY0A 4CL3A 2QX7A 2XCRB 4NPCA 1SEVA 4D4KA 2FPLA 2ZJFA 5JCJA 2BFEA 5FWDA 3RWBA 2ZRQA 1KOFA 2V6BA 4WVFA 4EGSA 1WM1A 1A2QA 1XPJA 3SHFA 2X0NA 4YHBA 3KVNA 4I81A 1PV4A 3OX3A 1GZ3A 3VKFA 1F9EA 4TL7A 1J8MF 5TMDA 1JKIA 1SC3A 1W19A 3ROXA 1VQLB 2FPXA 5IYPA 5DB4A 3UUGA 2EBHX 4URVR 3EIEA 4E5YA 2A78A 2CMHA 2N42A 2TS1A 2P9ZA 1QE0A 4ZVUA 1AQJA 4MQEA 3OP4A 2HRCA 2ACEA 2C4WA 2VP3A 2VQ3A 3BNWA 1JDTA 4IQGA 4KXVA 2Y6UA 5GJCA 5BV8A 1IZ7A 1PJ2A 4JS0A 2LTAA 2O1WA 4TN1A 3GF4A 2PS9A 2GDJA 1UD2A 1PNTA 2O14A 2Q5OA 3OTQA 4V38A 4JBWA 1LNSA 3HDJA 1UBKS 1N2CA 3DG9A 1K3UB 1SQFA 2RHDA 4ZEVA 1IZYA 1OH5A 3TNJA 4CM9D 4WZEA 5L40A 5TV2A 2B20A 4YMHA 4LFAB 7REQB 1DEOA 3MYRA 1VP3A 2OFFA 4FYXA 4LMPA 2FMKA 4OP3A 3D81A 2CBZA 4LE2A 4BFLA 5HNKA 4PLGA 4YHHB 1PV2A 5FD8A 2BFCB 3CEMA 4J0FA 4WOCA 1OC2A 3SQOA 3VKUA 3AG6A 1KYWA 3U7IA 2FEKA 3MOSA 1PFKA 3HO6A 2FRDC 1XMPA 2H1VA 2YH2A 2RKBA 4MDFA 2I67A 3WS7A 3WA7A 1NW4A 1AKUA 2X6WA 3I9V1 2QBYB 4W5TA 3MJVA 1N2XA 1PUXA 2B6HA 3A2MA 1HZZC 2IFTA 2WZNA 1KJ9A 1NRKA 4OGGA 1A5ZA 2V6JA 3PDUA 1CKEA 4FDMA 1M0WA 4L76A 4M1QA 4AP5A 2O20A 3OLVA 5HUHA 1HETA 4NPHA 1VHDA 2DH6A 5AVSA 2C7GA 1M73E 3K0BA 4MW0A 1V4BA 2QMQA 4ZV7A 3KQMA 3AI7A 2WG1A 5CCEA 3KFXA 5IG2A 4PHTA 1ADFA 1U9YA 2MYUA 5BSVA 1FJGB 1VE1A 1OLUA 4PHCA 2Q7DA 4FLMA 1Q7YD 1K73D 4AS1A 4BYGA 1ZNQO 3L1KA 3G0GA 5M29A 5IKOA 1XL0A 1SURA 1L3BA 2PCJA 3M33A 3VFDA 4AD8A 4DNOA 3BIOA 4HRXA 4RQTA 1RAAA 3ZD7A 2H85A 4AZ0B 3I58A 1ZSVA 3BCRA 5FWNA 4FN4A 1SUEA 1XELA 3VO1A 5C8YA 5AW0A 3U4CA 5LKRA 2H9AA 2O54A 2FU5C 4D81A 2H4ZA 3KM0A 5KX5A 5FPTA 5LFAA 5GQSA 1E1QD 3S2GA 4N82A 4F5ZA 1H2WA 2OORC 1U11A 2VRWA 4EP1A 3COVA 2IYTA 2W8BA 3AV3A 2OMEA 4ALNA 4HDMB 4Q7QA 1WHSA 3NBAA 4ONEA 1K8YB 1CETA 1Q57A 1UC4B 3R3SA 2O2GA 3C85A 2H2AA 4HR7A 4X00A 4XPIA 4QM6A 4KDFA 1WD7A 4UEKA 3UMMA 3SXUB 4EABA 5KNDA 3E9NA 1XD8A 3FPHA 1IJEA 1Y6RA 2H1CA 3M6XA 1JIKA 3RUPA 1HMPA 3WKBA 4M22A 1USVA 4OXRA 4HNGA 1K2WA 1Z0ZA 2NSYA 3JYNA 3OY7A 3R77A 4RENA 4A16A 4PG7A 1KP3A 4C0KA 5JEDA 1G98A 2HSZA 4DA9A 1HURA 1ZJWA 3OMWA 3PNVA 4O4JF 5KTKA 4KXWA 1T9ZA 2H3EA 2FQ1A 2VTBB 2VNJA 1JTVA 2Q5HA 1JPUA 2ZU0C 1Y5RA 1PCXA 1MJFA 3D3KA 2WJGA 3FIUA 1X15A 2QI9F 4N03A 5F9MA 5JFGA 1YVDA 4CM4A 4FZVA 4MMXB 1C0PA 4KCGA 4NRDA 4N4AA 4V1CI 1Y8AA 3AUKA 4TTPA 4FOLA 2R1UA 3DL0A 4C5BA 1WQ1R 2VHVA 5K0TA 5EPUA 3DMTC 5LDHA 2VJYA 4Z6KA 1A50B 3PYXA 1X1EA 5FWAA 2DJ5A 3WO1A 2H57A 5HR5A 2J3LA 3IXLA 2GPBA 3E1KA 3H19A 1VIVA 4DVGA 1FQJA 1OBFO 2YWHA 2PR7A 3KHKA 3QXHA 3JX9A 3ZDEA 3ZU2A 3I1JA 4EB6A 1TO1E 3HO8A 1XDGA 4LQ4A 4XIFA 4I6GA 1C0KA 3GI1A 3H3FA 5JWOA 5JYEA 1QMPA 1TNDA 5F23A 2RDMA 4TSFA 3A05A 4YJ2F 3A3OA 10MHA 1O54A 1ZK2A 2JFGA 3AVQA 1C30B 1PJ6A 3JQAB 1PBTA 5A6SA 4FUTA 4G5HA 4GF5A 2Q1YA 1W36D 4RF5A 2B1RA 5HRUA 1F2TA 1LBQA 2L19A 3OM0A 4YS6A 1YI2B 1KY4A 4RVNA 2P91A 2Q3DA 4IDDA 3IDSA 1NATA 4J75A 4LZJA 4QECA 3JQ6A 4BUJA 1JVSA 3ISVA 3EYAA 3ZHUA 4DMUB 3OFJA 2EP7A 3D0RA 4GGPA 3NUQA 1VL2A 5AYVA 1JQJC 1YHYA 2NV6A 3DC2A 2I4IA 5DNDA 2PUDA 1GTL1 3LX8A 5TQ2B 4CM8B 1L7PA 3DO6A 1YDWA 5TRDA 2UYOA 2YUIA 3DUWA 1MA3A 1KEWA 4N3BA 4OLFA 1KJQA 3OIGA 4GM0A 1AA9A 1ECLA 2GKOA 2HCFA 4FC7A 4OQDA 4WK0B 1OA0A 1HYEA 4CMEA 4AKSA 3CW9A 4OOVA 3G6KA 4HYEA 4X92A 4NF2A 2FPPA 3I92A 3R0XA 4XB2A 3DMFA 3WZLA 3ZVMA 4ICIA 5GJBA 2I6UA 5B3AA 1N2EA 3T34A 3MRXA 1YJBA 2P4UA 4MEAA 1AHPA 3IQIX 1YXMA 2C5AA 3G2LA 3I2YX 4C6HA 4KDEA 2WWHA 1YZUA 3DMPA 3PE3A 3TW8B 2OHHA 4YA6A 3KR0A 5G1PA 1GG2A 2QYSA 3UO8B 5ESXA 3FOAA 2QL9A 3GU3A 4IWXA 2QGNA 3BL8A 1LLUA 1WBDA 3HP7A 1Z73A 3Q3EA 2OCBA 4MV1A 4GX1A 1DQYA 1KJWA 2I78A 2VNKA 3KTFA 1Z15A 3CN9A 1J33A 2VAXA 3AVOA 2W70A 4A2QA 5KQMA 3QX3A 1SXJD 3KQOA 3W34A 4A2PA 2J4DA 3AGPA 3A1CA 5CB4B 3EZXA 2PUCA 3TR0A 2JAXA 2EEZA 3WHLA 5A88A 1E89A 2W93A 3BWXA 3W4JA 1VMIA 3ELWA 2RARA 1C1DA 3K0AB 2IVFA 4D9GA 4RA6A 4BLRA 1R8YA 2QL5A 2V31A 1UBFA 1RZ3A 4AMYA 5JZVA 2CSXA 1YWGO 4Z4VA 1W5EA 2PBRA 2ZSHA 2C61A 3IALA 2A9KA 4A91A 2D5LA 2HN9A 4C2BA 2NPOA 5FOSA 4YDQA 1QR6A 2SKDA 4K6MA 4TLLB 1KDVA 2UXCB 2B36A 3NHYA 3PTAA 1YQQA 4KXLA 1FSZA 3L6EA 4AY2A 3QNWA 1SCKA 1UKVY 3LCRA 3LY9A 2G7MC 3IUSA 1W1UA 1E9FA 4O0LA 5SYMA 3PEYA 3RK0A 3DVRX 4EARA 4PG6A 2BH9A 4ZYZA 3F6EX 3ENKA 3OOJA 5HXBA 3TUIC 4CIDA 3CVWA 2CD7A 3KU4A 2D1YA 1XBTA 3CZAA 3ONNA 1DPFA 4L6IA 1TLTA 2BEUA 1G8SA 3A9VA 3NDPA 1TF2A 2QMHA 1CY0A 3KNZA 3OQ6A 4UBKA 1K5PA 3QNUA 5T57A 3WC4A 2VHCA 2DBYA 1GVNB 1L7VC 2FSVA 1MB4A 1M2EA 2HWKA 2XVXA 4HRYA 2PRSA 4JP2A 1V5GA 1Z4LA 4LZLA 1U0NA 2I7TA 1DFHA 4G26A 4OREX 1XVVA 1AZSC 2IHKA 4Q7KA 4XX0A 1NBEA 1USGA 3ASUA 2AG0A 4QGBA 5FOXA 3DMRA 2WTEA 2C94A 1JKFA 2XT6A 3DONA 4JL5A 4KQ9A 4X90A 3W5AA 2WOOA 2MSKA 2CLSA 2AN1A 2JIQA 2VJAA 3DOCA 3NIWA 4FWBA 4AJKA 4I6EA 3U1BA 4MJLA 2NLOA 1I3LA 5FI0B 1JI0A 3CRW1 4N0QA 3BZBA 3DTTA 4XCQA 4JOCA 4GDFA 3Q3HA 1ZMXA 3CVVA 4E32A 2V03A 1EA7A 3MCTA 2ZUBA 2XODA 3SJBA 4DREA 2RGNC 1UJNA 2E37A 2DQSA 3NWPA 4MO9A 5BSHA 2HO5A 1QHEA 4D0GA 1QH8A 3KPWA 1P5JA 3L5OA 4B85A 4OJQA 2PV7A 2B82A 2BZ1A 4IVQA 5IJ9B 5EOVA 3L6RA 1T8TA 2FOXA 2P11A 2C4KA 3TUJC 3SPXA 1ZN7A 3VTKA 1PGJA 4Y9RA 2JZNA 2PUJA 2X5NA 5MN6A 4Z2YA 2BDTA 2QG6A 2X4LA 5K3EA 1QF7A 1Y80A 3EQ8A 3NORA 1JG7A 3AF6A 2GCPA 4M6WA 3JD1A 4RFVA 1V25A 4LYDA 2F8TA 1LV8A 1RYDA 4TWIA 4U8HA 3ESQA 4R84A 4ZD6A 3V42A 1WXGA 3DCYA 1KE2A 3TK1A 3FUXA 1QS0A 4WINA 1UWCA 1J56A 2XUZA 4OMFG 1KDPA 4LYAA 3ED5A 3QA3E 4ZT3A 3VX3A 5K05A 1GQOA 1V41E 2HLNA 1XN4A 2VPPA 5AOAA 1TT5B 2B94A 3QEOA 3UGJA 5HK9A 1VJ5A 3FSRA 1PW5A 2Q3BA 5F5XA 2Y0CA 5AM0A 4D9HA 1ZP6A 1R0XA 5F7JA 5H3HA 3EEFA 4XR6A 1R5BA 1NY5A 1WEHA 3KSRA 3W3AD 1Z33A 5E4JA 2XUOA 1I2BA 4PHFA 4GSKA 1HTTA 4G1UC 1TEVA 4N3AA 3WGVA 4EOGA 1A04A 1Q21A 3F2VA 1Q7CA 3AEQB 2K2WA 1VIMA 4LXYA 4YJ3F 1HLPA 3DV0A 5EJ4A 1RU3A 2IEBA 3GLHB 3A8TA 1YJCA 4DCUA 2GILA 5JTUA 4M7RA 3OSUA 1L4BA 1N08A 1OT5A 2FK8A 2D3NA 1O9HA 4OI4A 4WL0A 2GN0A 1JSXA 3ONWA 1T1IA 1U04A 2VXOA 3LUBA 4HEHA 4WGGA 2OTJB 1PYOA 4GMDA 3N2KB 2COKA 3NAZA 3OHPA 4HFNA 1NR7A 1QAOA 4YRQA 1IBKB 4N6NA 5CLHA 4IFTA 1E6KA 1PYGA 1OI7A 3K1ZA 1U1FA 2WEKA 1OVGA 2W2LA 1IY2A 2BMJA 3U3OA 2Q27A 1G5HA 3LKVA 1N9KA 4U02A 5JY6A 3SR4A 3EB9A 5CAEB 1NBWB 4MUAA 4WCFA 2H5LA 1K75A 1D0SA 1R3DA 3QYAA 2IYQA 4KEAA 5EUCA 3UCFA 2VP0A 3HL0A 1HFKA 3R6DA 4AJNA 2WTBA 4O4HA 2ZYTX 4OM7A 4ZDJA 1HQYE 4CMIB 1QGYA 5IDQA 3GJSA 5J4HA 3EIFA 1YQUA 4C03A 5LZ9A 2QUHA 2YYZA 4GZ3A 4QQFA 4Y8VA 2JGEA 2P8JA 1VLOA 3GP5A 4JLNA 1QGUA 4G5QA 4BNWA 4CKBA 5INTA 4W5OA 1EFAA 3FF4A 5CYFA 4MAAA 3B7GA 2J6IA 4K1LA 4UHDA 2V45A 3DOHA 4MEJA 1CUXA 4RZ2A 3QOWA 2OCYC 4GMKA 5EVJA 3OPYB 2GVDC 4FZ5A 5KNCD 4MVJF 3W2HA 2IKQA 2NTJA 4LHZA 3RLFA 6YASA 3I5AA 5HDBB 3FCSB 3DDWA 1L5HB 1E7RA 1U7WA 3GFFA 4ILEA 3W05A 2R60A 1F2UA 4NOKA 1LX7A 1PE0A 2FRVA 2OLEA 3FE2A 1OBCA 3K96A 1E64A 1S2GA 2QD3A 1WY7A 3CNOA 4GLJA 5DP2A 3D2LA 5H81A 1NTRA 4DCTA 1G55A 3QLEA 1U8AA 4RPBA 3QLJA 2Z5GA 3TYXA 3ET4A 4IEFB 4E15A 4FZJA 1OFUX 1RWXA 3RFTA 3T5AA 1SHZA 3LYUA 1YHQB 3IOYA 1MB9A 3L6UA 3O8NA 4AYXA 3BF7A 5DZSA 1A7KA 4S35A 1KY3A 1HLDA 3HRHA 3QVJA 3V8MA 4L8GA 3KVOA 1FNNA 4FNOA 2NW6A 3GSIA 4QBFA 3ZWKA 3N8HA 5AXCA 3W9SA 1Q9SA 4BQFA 3BWDD 4YONB 2HLDA 1JEYA 4QOSA 1KQSB 1LLCA 3RTBA 1KY5A 3ZHSA 3CZRA 3IE1A 4JL8A 3HO1A 3GIWA 2FMIA 3DW1X 1NVBA 3L77A 1HG0A 2YWRA 1V6SA 1ZOOA 2J3HA 2HK7A 3KELA 4LPKA 3RJTA 3HKEA 5D6NA 3V8BA 3QTTA 3L9WA 2PKRA 4R8SA 4DR4B 1E0DA 2WF7A 2HTEA 3NKVA 1YZQA 3G0DA 1P1JA 3IIEA 1YACA 4NABA 4A6EA 2WKRA 4Y2UA 4CCYB 2WVAA 1TVKA 4RKQA 4Y9SA 3PWZA 2YFKA 4BNTA 3D6NB 3MWYW 3Q6MA 3HZOA 4TXMA 2WIFA 1N8KA 1QP4A 1ORDA 3JQQA 1KO1A 2ZRMA 3B1JA 1KAHA 1YFZA 2JEYA 3ZE9A 1KMHB 3H2HA 2D8MA 3P9SA 4CG3A 7AT1A 1NW3A 1GEGA 2BJWA 1KC8D 3G6EB 1OU4A 2UYQA 2Q9UA 3NIFB 2C4UA 1V6CA 4AJJA 2XNKA 4D41A 2PR2A 3EW7A 4BLTA 4WK2B 1QVGB 2WYVA 3EH1A 4GZMA 4RK1A 2Q7OE 3G7UA 3RE1A 1DBRA 2QVGA 3AK4A 3UHFA 2VJNA 1SC6A 4UPDA 4Y0VA 3UNXA 5BR1A 5DM70 5E1OA 4DV0B 1O58A 2OXFA 2BC9A 3LDUA 1YQGA 4NI5A 2V4MA 3PUWA 4RLHA 4YCNA 2ZTSA 1TKCA 2XCQA 1UT6A 2HK9A 4MQFB 4D8TA 2GCOB 4H7JA 5FI5A 3FCXA 2FF5A 1ESMA 1TM7E 3EXEA 3H7AA 3MTBA 4O8ZA 5GOTA 4RQBA 2DECA 4MVJD 5K3FA 5UKDA 4BO4A 4JQCA 5B1EA 2JGDB 4P4UA 1Z4KA 2RBEA 3EG9B 2H52A 1NLZA 1G8JA 2V97A 4Q39A 1CQXA 1YR6A 1GCAA 4F11A 3OKPA 1RADA 5DTIA 2FK7A 1IMJA 3QPWA 3DNFA 4L8VA 1IUPA 3LUFA 1NASA 3K70D 3OECA 3Q9NA 1D3AA 5KAPA 5SY9A 3N2IA 1OX4A 2WNIA 4FBMA 1I5RA 4ON9A 4QYIB 3WISA 4BVGA 3IPRA 2VDOB 5H4HA 4B3SB 4UD2A 1XF9A 4ND7A 4TL8A 5AESA 1OASA 2DLDA 4FVTA 2AX3A 3AG5A 1FU4A 1N2HA 1OT3A 2A1TS 4RZSA 5DVZA 5FA5A 4DZZA 1XVIA 3PT5A 3K9HA 4HZGA 3O6VA 2OXIA 1A4RA 1QHHA 1X1BA 5J4LA 4KN9S 2GKSA 2PD3A 1CDZA 3I52A 5EFZA 4DBZA 2NVWA 1YK0A 4EJSB 2JVJA 4L0QA 2ZWPA 3GGCA 1M1YA 1AV7A 4REQB 3WTCA 3JAMA 2FGKA 1D6JA 4HE5A 1IUKA 3OQHA 1LK0A 2QJOA 2VUTA 1CJCA 1KETA 3M1IA 1CJTC 3EEYA 3PR1A 3R40A 5AT1A 2XUDA 2ZZQA 3F2IA 3KKNA 1XQ6A 3AJEA 5T4FA 4JJAA 2WU0A 2DX7A 1J4AA 2VHQA 1S2NA 3EGCA 3MPUA 5ALWA 1PJQA 2ZM5A 4ZAGA 5AK6A 1XXHE 1ODSA 3W6UA 5JQGF 3HKCB 4F97A 3AEKB 2GH1A 4Q0MA 5KSPA 4FWTA 1F6DA 4LMRA 1U8TA 1CZUA 5C9ZA 4MVYA 3KYDA 4WKPA 5WRFA 3A8JA 1XZAA 3CH4B 3E15A 5EA2A 1T4BA 3VNRA 3ZIUA 5BP7A 3S5UA 1KI6A 1PL0A 3HBMA 2Z58A 1UAYA 1C0LA 5EZ6B 1TOAA 3HI4A 4NV0A 3A1PA 3GLIA 1R2QA 5CIQA 3GDOA 3BSFA 5COQA 1JT2A 3DDHA 1AHHA 1NMZA 1NT4A 3HKBA 4MQ6A 4Q93A 4CIWA 1I2MA 2JLYA 2IE0A 4RDHA 3PQ5A 5DBOA 2ECOA 4U9HS 1N8TA 3QUTA 4TXLA 1NNSA 4P3KA 4MV7A 2EIHA 5ECDA 5EWLB 4BB9A 3A3BA 2JCGA 1R4MA 3HJRA 5LP6A 1GGEA 5C80A 3IEIA 3D3QA 1HOTA 3ZCSA 2OO5A 5BN3B 1I0LA 1JL3A 3PEEA 1P7WA 1QUEA 4YMSA 2OQIA 3W4IA 5CBKA 1FK8A 3R3WA 5DGCA 3SLGA 2C4NA 4KWHA 4RUKA 1Z4QA 3L7MA 4XQGA 3MHPA 2QTFA 2OBTA 2VHTA 2JFPA 4PSCA 4U2EA 4WLFA 4XA8A 4NEGA 5KOHB 3ABOB 4I9HA 3ZOKA 3O84A 1U0BB 1MAAA 3OPXA 1UXJA 2HA6A 2PZEA 3GK3A 1S3IA 4P4GA 4RKWA 4UUNA 3EAGA 3D0KA 3HEBA 3BFVA 3VNBA 3SIXA 5K6AC 2R47A 2A0UA 3DBRA 2ZBDA 1UKYA 4N3CA 2X9LA 4PHHA 4FDAA 4CCSA 4MA4A 3KJNA 4WGFA 2E21A 2FP4A 1EFDN 1YBHA 4G4JA 4OXXA 1TUBA 4DSUA 2R6HA 4R1TA 3S7TA 1J5EB 5L7YA 3P97A 3IJEB 1P33A 4CKEA 1ZY2A 5GM1A 1NUQA 1X74A 4MQLA 3IE0A 2KI5A 4QO8A 5EAIA 2VDWA 2W43A 1EJBA 3WAJA 4BOYA 1XQVA 3FR8A 5BQPA 5B7GA 1D2AA 1TC1A 1Z6AA 3ABZA 2NADA 3S4YA 3E22B 3MWEB 3SU8A 4FMCB 2PH7A 2Z30A 3HKDB 3GLFE 3M34A 1WUJS 2YNMA 2OV1A 2XYQA 4HWPA 4RJKA 3PR3A 1H65A 3V4PB 2GN6A 3OIVA 1XCLA 1E99A 3MAJA 3NBFA 1QP8A 2JI6A 2O4CA 2XOKA 2B1IA 4X44A 5H3CA 4PXSA 1GJRA 3LHSA 2P68A 1H6CA 5CM8B 3TI9A 2YY6A 3LWZA 2ZAGA 3H8WA 4YRPA 4MGHA 4Y6LA 1C9YA 1P9RA 3V3KA 3P2EA 2FX3A 4BNYA 2NT3A 1CQJA 3R3YA 3AERA 3WRXA 5E6RA 2ZIAA 2W6JA 2IXGA 5KS2A 1J9EA 3N28A 4QQRA 1GV0A 1VQPB 3L82B 2FPOA 1UBTS 4D8VA 2AR9A 4RK0A 1OYVA 4K2AA 4GAEA 4EI2A 4EX6A 2YJ4A 4UZEA 3OQPA 1KXZA 4FYJA 4Q82A 5AXDA 1GZ7A 4IKOA 4HCJA 1HY3A 3P45A 3QBEA 5K8VA 3CLUC 1PKVA 4NZMA 1I7PA 4UDXX 4HDNA 4LS3A 1KMCA 4X1YA 3ICOA 3PNSA 4G0NA 1V3UA 4J7CA 3CX7A 3WLEA 1MCZA 2AFHE 2LD4A 1CRWG 3JYOA 4TTVA 1SNYA 4Q12A 4ZVVA 4X1IA 1OHHD 1Q83A 3REFA 4D6YA 4G1FA 5CVUA 2X7JA 3HZZA 3I56B 5DSXA 3C6KA 2QXUA 2DVMA 5EZ5A 5IKEA 4B3MB 3C7AA 3KP1A 5JS2A 5BOVA 4LJLA 4FHGA 2H2FA 4J9UE 5E9WA 1O95C 3E9QA 4Q3AA 2GK6A 2VT6A 3UFXA 3KQSA 3PT9A 3GBSA 3WLSA 1RLMA 3LBIA 2BR3A 3P9IA 4YLGA 2AR7A 1SC1A 3UHPA 3OTOB 2DSNA 3NJRA 2F1MA 1M8KA 2B2CA 1QK5A 2O8CB 3D8UA 4MS4B 1Q3TA 4YRJA 4E4YA 1SHTX 3AVPA 3EIQA 3PUKA 2AE1A 2CVQA 2GERA 1QQ5A 4J43A 5ILQA 5KNBH 1JVBA 3R5FA 1SG9A 1MUUA 2QRQA 4X0CA 2HCRA 1P18A 2YZMA 2IP2A 1QWOA 2PWBA 2GK4A 5BNFA 2Z8ZA 3UATA 1JPNA 3VSEA 2Q3JA 4CDNA 5BQFA 3WIUA 5EXXA 4EA8A 1PR9A 1D1QA 3PKIA 1ZM7A 5EVCA 1MNQA 1T8SA 1M2FA 2JLBA 3K2IA 3OZXA 4K9PA 4F3NA 4FN5A 4GI2A 3PFFA 3Q40A 3T61A 4JC8A 4B33A 5CG2A 4ARAA 2Z5FA 1ZJ6A 2GVNA 1YIJB 3OBIA 2UYHA 4TRMA 1UFOA 4L07A 4LJSA 3OCCA 4FWIB 4M1SA 4YRNA 5DN6A 1YL7A 4L9WA 2FLKA 3LBNA 3THWB 5FFNA 1BPLA 2ZITA 2CEKA 2HU2A 3B48A 4KFTA 2VQFB 3E27A 4TXHA 1RRCA 1XK7A 1R5OA 1ML4A 2WP8J 3GJTA 4I3GA 4B3XA 2VA8A 4RHXA 4YX9A 1C7FA 4WERA 2SECE 2CF6A 3OOCA 5DK6A 1G38A 1TCCA 3CEPB 3WKCA 4A8JA 1Z4PX 3AI3A 3DE4X 3RJ5A 2HUNA 2DM6A 1KKUA 4OK6A 3ZHYA 1ULTA 1VJRA 5JLAA 3HV2A 5A06A 3ITDA 2BT4A 3UTCA 5AW6A 3IP9A 3ZDYB 5TF4A 4BC0A 3PS9A 2PGDA 1NF3A 2B4KA 4RKEA 4RM2A 1R9NA 1V5VA 1O87A 4TWBA 3C3XA 4INOA 1A95A 5CMLA 3USES 4BNZA 5BSRA 2HX1A 3E61A 3CLVA 2GD0A 1JHRA 2J08A 2FFRA 2I2WA 4CF7A 4M0CA 4BN4A 2ZKIA 5IBCA 3THRA 1SHLA 1HDIA 4KX3A 3JZAA 1XTRA 3ZYCA 4MHOA 1PK7A 1P2BA 5EQTA 3TZKA 2IBMA 1UBJS 4TROA 2WD9A 3S55A 4C08A 3G9QA 2F2TA 2QNRA 3OX2A 4OHYA 1I13A 1PWEA 3I55B 3T7JA 5KOJA 5MDHA 4D3XA 3DLCA 1I7SB 3N74A 4G0WA 3K9QO 4XL9A 2F48A 3O3OB 2O0MA 3RSZA 3JQ7B 2WAXA 3WMRA 3I61A 7MHTA 2FCRA 4OKSA 3AFNA 1I4EB 5AH0A 3IOBA 5D3MA 2CUZA 3B51X 2XNDA 3DYVA 5JY1A 2YS6A 1RC8A 4JMPA 4UXHA 3VU3A 2RKOA 5F7OA 3HK2A 2OXCA 1XOIA 1B73A 5DI3A 1RWVA 3A6FA 3FBWA 1K8AD 1N9GB 3TZHA 1K6JA 3LXMA 4E2YA 2ZU6A 3JPWA 1SKAA 4JYPA 1MKYA 4KPEC 5AI4A 1KOLA 4AN1A 1CR6A 2ZBRA 4YCCA 2XVAA 5CU7A 4XOTA 1VKNA 3ROTA 1N2GA 1WSRA 4J49A 1QONA 2PFKA 1FNCA 3A06A 1GSOA 3CE9A 4O4JA 1WTHD 3S44A 1GTZA 4UU1A 4X7PA 1W88B 3KAPA 1FVXA 3AY7A 4YJFB 5DNWA 5PGMA 5K3BA 2BTOA 2VCEA 2ZJ6A 1N0IA 3OD5A 4QPDA 2WWXA 1QQAA 2UYGA 1TU0A 1PJ8A 4MRSA 3QMMA 3KOMA 3SFZA 1O5TA 4KYVA 2YMLA 1A69A 2B4AA 1V26A 1SB9A 5IK2A 3DSRA 3QU9A 4JBXA 3QOXA 4OK5A 3SHQA 4BIMA 2F90A 1OJLA 1W75A 1XZPA 3NGXA 5MGBA 3JWIA 2GSDA 2NO4A 1CBUA 1MZVA 1NF8A 1Y1RA 3CLHA 1IAVA 1TEXA 3HGMA 4JOBA 1AJEA 3NTRA 5ES3A 3H11A 4JT4A 5EP3A 4BECA 4PNHA 2X14A 2IDMA 3ECSA 3CIOA 2E4YA 3VR3A 4EI7A 1TKRA 3DYBA 1G6KA 3O1HB 4URZR 2FPIB 5C18A 4U2BA 2X19A 4INPA 3JWPA 3HH8A 4ZEOA 1MXHA 2CHQA 4Z9XA 1J99A 1AB5A 1WKBA 2JBAB 3F9IA 4Z4CA 3FCOA 1TAUA 3A4VA 1G3UA 3LD9A 4IV5A 4R9UC 2BGGA 1QH9A 1LJLA 4IIHA 4RPIA 2IDZA 1MEJA 4YQEA 3VAZA 1B2LA 1B4DA 4QU5A 3RJ9A 1TT7A 1VL8A 2G08A 3T3IA 4B0PA 4B32A 3DDCA 2VJMB 1E9EA 3CUKA 3KKPA 4IS3A 5DLYA 3RWOA 1AH2A 2C8KA 2HPAA 2R25B 4I9NA 3RR2A 3Q6QA 1XLVA 3S2FA 3E2IA 1TQHA 4FD2A 4YEDA 4F4CA 4PX9A 5AKJA 4KK3A 2X1MA 2AG8A 3NOVA 1B74A 2OESA 4KNWA 2V7WA 4QYSA 2IXBA 2FVYA 2X85A 1TLLA 1KC1A 2XB4A 1F8GA 5DBFA 3NT2A 5B55A 2DUNA 1W5BA 3NBYC 3MLAA 1CV2A 1JWAB 3PGMA 4BRWA 3QITA 2BMWA 2J41A 2PV0A 3AZOA 3QJ5A 3E1YE 2WTXA 2ZDHA 2IHTA 4N5MA 4JXKA 1PL7A 3K35A 2Y1OA 2BFEB 5E4FA 1XAHA 1TADA 2A1TR 2VHZA 3BD6A 5DLEA 1Z34A 4G36A 3Q6NA 4B6RA 4GL2A 1RYHA 1AKQA 1BD3A 4HGRA 3QXXA 1RYMA 4WXPA 4LOIA 3WIEA 4B7UA 3Q7PA 4RGVA 1O4WA 1CPYA 1MPXA 4IZOA 1NM5A 4QXMA 2FY8A 3RRZA 1G59A 2FQWA 2HREA 3QTLA 3TQCA 4ZU1X 1HE3A 2QENA 4DIOA 3JQ9C 4MQEB 3DWIA 1A9ZA 5J2TB 5IJAA 1EUYA 1LPPA 1NUTA 3HCAA 1MAUA 1VCMA 2DU8A 2HD4A 1S7CA 3EGVA 5SY4A 4E13A 5BV2P 4QWMA 2CDRA 3DZIA 3FFBA 1F2VA 2QAIA 3H5LA 1L8QA 4EYOA 1N2CB 4WN3A 4KC0A 1IN8A 1XMSA 2BKLA 4TV8A 5BWOA 1IJKA 3EDRA 3FMPB 3RS0A 3LYHA 5DMHA 3BF8A 4WQMA 2P9EA 4KU4A 4W7HA 4Y67A 4KO1S 2PD6A 3EVDA 2LVBA 4RHUA 3UH1A 2JW5A 2QLNA 1I6MA 2WF5A 2LIPA 1HYHA 3MCUA 4DQ0A 1HE5A 1QLWA 1QIKA 1YZLA 3A28A 1OX6A 2ZWAA 4WY2A 3SVTA 1RNLA 5AK5A 3OAAA 3OJWA 1I9CA 2PUBA 1VMEA 2VP2A 2BUCA 4IV8A 3IAM1 3RF6A 2VDPB 2AD1A 2G3YA 2Y1FA 3ZYZA 4HK4A 5BPHA 1C29B 1VSUA 1LSOA 3TWOA 1GTG1 4ETMA 2H48A 2GFIA 1GPH1 3DKVA 2ZZNA 4J0IA 1U0TA 1M34B 1XZNA 3AI1A 3SZRA 2LW7A 5KYGA 3B8HA 5CW2A 1VF7A 3FHJA 4M9UA 3EPHA 3R8FA 4HTFB 3WA6A 5DEIA 3F6SA 5I7RA 3FUUA 3QV2A 3UHOA 4P5PA 1OLUB 2BFWA 4MQ4A 2HRQA 4XW2A 3WLFA 4D9MA 3BRCA 2QN1A 1CNFA 1ZWKA 3OQJA 4UAGA 4UDOA 1ZI6A 1ODLA 5AW8A 3UGQA 3AVXA 4K87A 5I9MA 1BX3A 3F73A 1VLMA 2E1PA 2WHXA 1UJ6A 1UOQA 4BV3A 4HRVA 1J5XA 3C7TA 4ZOCA 1QGDA 1V6AA 3LM8A 1MIOA 3WL8A 1XX6A 3GVHA 5C8YB 3UC5A 5K03A 1E3MA 2BP7A 1IBLB 2Z2KA 3A4IA 3VR5H 4EPRA 4C4RA 2J3EA 4Y2RA 2ODEA 4NCJA 3PE6A 2NU9B 3ZDCA 4OUDA 2AN9A 2H06A 3BFJA 3K8QA 2W8BB 3DP9A 4MPDA 3A1WA 3UMYA 1WHSB 1MW8X 3UB2A 4YXWD 2XNHA 4KAFA 1P5FA 1TDJA 1IHMA 4NBNA 4S1WA 3O3MB 4XPIB 1R00A 4W9NC 4BAUA 4CIBA 3DPUA 1P2DA 1VB3A 1GARA 2GO1A 1XUOA 3MUOA 4P92A 3ITKA 4EG3A 1VSVA 4AZVA 5FHQA 3OIYA 1W0CA 3IXMA 4DUYB 3HDGA 4J03A 4QQ8A 4BLWA 1Q81D 1JIJA 3GA0A 4DJJA 3JVUA 1G7RA 1YL5A 1JPJA 4PZUA 1CQWA 1BE0A 1U2EA 3AF4A 3KTOA 3F5QA 4MRMA 2CDAA 3SQDA 1IDN1 5DTEA 4GX5A 1A8IA 1DZIA 3O8CA 2AG6A 1DBVO 1ACMA 1S2MA 2Q29A 3NWJA 1VJTA 3PFBA 4G6ZA 4L4XA 3ASTA 5DO9A 4IWNA 3UA4A 4UTRA 1V48A 3RBAA 1ZM4A 2AD5A 5DGTA 3VR4A 1AXRA 2L42A 3C0KA 2HW8A 1NE7A 1C9EA 2PXXA 4G37A 3Q0EA 4ZMSA 2X6XA 1AKRA 2JVKA 3DFIA 4I36A 4QOIA 1C1XA 2CN1A 2KPOA 3BC9A 4UDNA 1CRPA 4UTZA 1SZPA 3FLBA 4GR9A 1XP8A 1YZHA 1WV0A 3FRJA 4CBVA 4EB6B 4P93A 4LFBB 4CM7A 2I62A 3L43A 3SR3A 1BFUA 1IHPA 4CIVA 2PSDA 4IVRA 1Z63A 2JFBA 3KWLA 2BKVA 2V0NA 3TLMA 1LDNA 1T5IA 2RSLA 3PB3A 1GCGA 4FR0A 1E7YA 4G63A 4YJ3A 3ZQ4A 5CDYA 2AZXA 4MWZA 2QL7A 4A6PA 5A6SB 3SN6A 1OH6A 3CF0A 3KCNA 1E7MA 1GGVA 3Q3JB 5EIWA 2HF7A 5ER6A 2MYTA 3BH0A 4KVAA 1GZHB 2XD9A 1BDHA 5A62A 5L3SA 4F71A 4HKTA 4M0KA 3GLFA 2ZBUA 3DPIA 2GN8A 4EH1A 3U9SA 1T35A 2GZ3A 5I4KA 1OBOA 3FPBA 1Y6ZA 3RS3A 2V74B 2KMLA 3RQIA 4LYHA 1GPMA 3JSAA 1U0OC 1U1CA 2ZTMA 4DIUA 5IM5A 1R50A 1ODJA 2A86A 2QNIA 4G9BA 9GPBA 1Y0RA 1LDGA 1TO2E 2XTAA 2XUIA 4Y6SA 3GNQA 2CK3D 2FKAA 3ZDAA 1SVWA 2J7PA 3R7SA 2NQ2C 5KWVA 2XRFA 1UADA 1M2OA 3IBYA 1QU3A 4YCLA 3QFTA 1PTKA 3DNPA 2FPPB 2DCUA 3OEED 3OT4A 4L5JA 4LDPA 5SZJA 5A4JA 2GD6A 1B8PA 3N7AA 4R0VA 2P5TB 3RYFA 5KYYA 7MDHA 1X7YA 4NOLA 4EF6A 3ZTWA 4PICA 4WCDA 1UWVA 3FCAA 4WOJA 1GRCA 1Z2OX 3CKMA 1QIEA 1ZM2A 3OETA 4RZHA 4KMSA 2HDWA 2AFHA 4E1BA 2HOQA 1C1HA 1HWYA 3QVKA 4X62B 1JH9A 5IVHA 4JJKA 4AY5A 4LGVA 2AVDA 3RC1A 2UZ4A 2ODTX 3BE8A 2QLTA 3PC2A 3FW1A 4IIEA 2EIXA 1W46A 4KGZA 1BSVA 4MVJA 1L7AA 3P4YA 2QOEA 5JW6A 2B1QA 2W48A 4QPPA 1ZK1A 3FPSA 1C1DB 4IAOA 4O63O 4HFMA 2ZPUA 5KYTA 1F9AA 3D9QX 4PYQA 3FAKA 2D74A 4RA6B 5K5EA 1P4HA 3WGKA 2W2NA 5DHFA 1W35A 1RYZA 3ADDA 4PAGA 3MJFA 5EZQA 3RSQA 1N7JA 5H5JA 1VGRA 3N9IA 2JIZA 5GONF 5K0EA 4ZKEA 2OC9A 2FCAA 2YC2C 1G6Q1 1TQ8A 2ID9A 2W2QA 5JASA 3D4OA 3GB9A 2OQRA 1IQRA 4LJ6A 3AC0A 1UC9A 3FD8A 4DYHA 1OU0A 4JI2B 2GSWA 1QIGA 2GJ4A 1PQ4A 4PPFA 4HUTA 4WJKB 1X7GA 1X7XA 3EXHB 4JXZA 2JVIA 4DV4B 1U8EA 4WA7A 4O2AA 3FMGA 3OZDA 4JYAB 1KJYA 4S12A 2QVYX 2BFBA 2ANBA 2F4NA 2P3QA 4IRUB 1GPJA 3P9QA 1DOAA 1P2GA 1JALA 3QSGA 5DNVA 3EDCA 4PZCA 3TEMA 5JRDS 3B5IA 2BEUB 2RGWA 2QZ4A 4M60A 1LK7A 2DFVA 2OG1A 3JQ8A 4W5NA 1J24A 4AG6A 1IEWA 1UIRA 3G0IA 3EA0A 5BN4A 2Y1LA 3FMVA 3VYUB 4Q7LA 5JAMA 3TPCA 3T53B 1SD1A 3IA2A 3S0JA 3UUFA 1CWUA 4EEKA 4XX0B 5JAUA 4H3VA 3AOEC 1PJ5A 1CYDA 4B79A 1DC6A 2J9XB 3QUCA 1WXXA 4RZIA 4QSHA 3U2QA 3L0PA 2WFMA 3JD0A 4CLHA 3QBDA 2GB4A 4NZOA 3KHTA 5J4VA 2OZLA 2D7JA 1PSZA 2IXAA 3MWGA 4YACA 1YZ3A 1LB1B 5AVRA 1Q1GA 1CY7A 1KZ6A 1ZCZA 3TMKA 4LSMA 1OV4A 1GCOA 2ZAIA 4ECEA 2GM5A 2X4IA 2GGSA 3NAGA 3MK31 3FMOB 3WMWA 3KUKA 2D2VA 1QH8B 3T9DA 4Q16A 1SK9A 2PK3A 3CNBA 4J2HA 2NZYA 5GJVC 4FNGA 3WLKX 3HADA 2Z09A 3O47A 1XPOA 1FRZA 3FSGD 4TVKA 2IV2X 1VE5A 4FT4A 421PA 5C2JB 1J2UA 4YJHA 1DC8A 4OGFA 3QE3A 2C5EA 4NCBA 3H6HA 1TCBA 3RKRA 1Q0ZA 3H9JA 1RLUA 3INTA 4TLAA 2XMSA 2EERA 1D6MA 2P2LA 4RD0A 4MUGA 1K9MD 1Q3KA 1QANA 1U7HA 1QFJA 4TMWA 1TYCA 3EISA 3GC6A 3M70A 4M6WB 4PAQA 5JLJA 4DT1B 2PJDA 4QGSA 2ECKA 2R3SA 3BMCA 2PWPA 1A9RA 2R2AA 2VFAA 5G0WA 5DBGA 4EG8A 4F46A 5HQ3B 2ICAA 1QS0B 3HFGA 4HXYA 2PO5A 2WDPA 3GGOA 2Q4RA 4ND5A 4XFDA 2D4HA 8LDHA 3T06B 1IN6A 4KQJA 3BGWA 1KK0A 2FR8C 3GUVA 3QEJA 2KWIA 3MWLA 3OFVA 4JLPA 5L45A 4D9NA 2HHJA 1Z75A 3DE0X 2XADA 3RARA 1KZ1A 4LHWA 3RC2A 3HVRA 1UMKA 1W49A 3OLYA 4HWTA 3IA7A 2C4VA 2CXNA 4K9KA 4P7JA 3JD2A 1GZVA 4DCNA 3NC1C 5T3YA 1NIPA 4TMXA 5BN4B 1PG2A 3BDIA 5I01A 1E2MA 4Z0HO 4JQSA 4RK6A 2FMTA 3IESA 2HEGA 1COWA 5HMLA 4FFNA 4DV7B 2WR8A 4BQEA 2ZSBA 3HABA 3DV0B 4MCAA 1RBMA 4H18A 2IPXA 1SULA 4UUAA 1P9NA 2R4UA 1RXVA 5JQGA 1NSTA 4PXYA 3EGXA 5H59A 1HKHA 4XSHA 4X95A 1QPZA 2WWIA 4KMRA 2FG5A 1E4OA 3PNBA 2B25A 4IHJF 4B3DA 5IYZF 1NMEA 3INNA 2FRDA 4URYR 4GPBA 5BW6B 5ESWA 1LX6A 4LDQA 4QGGA 3DHWC 3WGZA 3INRA 2FYTA 4Q3OA 2GRJA 5FTJA 5K3SA 2HJ9A 2Y8EA 3TLGA 2JZOA 5I7AA 4DUZB 5JC8A 4YCAA 3I2JA 1HZZA 4CHGA 3G23A 3CB2A 5TQJA 1E3TA 2C4TA 3ICPA 3TQTA 5HK8A 4BMCA 4DLRA 1A96A 2DTEA 2FWRA 2G0NA 2Y1DA 4QUGA 5HZMA 4F5DA 1J2RA 1XVAA 4UVEA 1FW8A 1H2FA 1OSNA 2ET6A 2QTVA 4IOLA 4P0TA 3AIMA 3ZU3A 2HHHB 1JJ7A 2ZBQA 4IFEA 4JX8A 3TQFA 3ZW7A 7GPBA 4WCFB 4WFIA 1SZDA 3ZHRA 5AVTA 3BXEA 1VHJA 2DF8A 2D5BA 3F8WA 2N75A 2ZRKA 4MRVA 4PLYA 1RYNA 2KW5A 5DNAA 5L4SA 4FFRA 4W9RA 3FPKA 3OP1A 4NMMA 1L5GB 5JNTA 1DWPA 4XDZA 2XKKA 3MBKA 1CIVA 1EX6A 1PR0A 2GZRA 4D1YA 2YHSA 4CIYA 4KQ6A 3GVJA 3DWGA 3FRHA 3BILA 1C4XA 4HAZA 3NBKA 5J2UA 3I05A 1JQLB 1W96A 4R8LA 1QGUB 2YIVX 5T41A 4XOUA 4GSYA 3VAYA 2PA3A 2PMEA 2VIIA 4BU0A 4DNPA 2XXAA 4X6UA 2QYTA 4B2IA 4FHFA 1Q14A 1ZHFA 4PYOA 5EKUA 2FVGA 1FX1A 3QU7A 2OORA 2QUJA 3MJCA 4I50F 1G2OA 3UKDA 5JBNA 5EKDA 3AVWA 4QD3A 1WXFA 2C98A 3B60A 3CE6A 3LU1A 1F2UB 3LKZA 2W0MA 2PWAA 4GOXA 4M55A 4B82A 3BSWA 4DM4A 3V1UA 2C20A 3VNUA 1K5HA 2H92A 2N1BA 5C8DA 1K89A 3E9EA 4JVOA 1DJOA 5FWXA 2R6GA 3UQZA 4F2GA 4PG8A 3TQIA 5YASA 2G77B 4UC0A 4RY2A 4BCDA 3LW7A 5A04A 3N0XA 1NE2A 1OB5A 2TECE 3H2GA 4UBIA 3UWSA 3ZIAD 5AJYA 2ZS9A 4CQMA 1O7JA 3ANXA 2B8EA 2YJ3A 1X70A 4X20A 3SS7X 1YD7A 4KFCA 1Y4UA 1JEYB 1DBPA 5CT6A 3ADKA 4ZA2A 4BKRA 3F90A 1JKJA 2PKQP 2PT6A 3DMTA 1QG0A 3HKEB 3AQ4A 3PFWO 3QWAA 4BUCA 4DRZA 1CHDA 2I54A 2XVMA 3AF3A 3DV2A 3IS3A 1WS6A 3UJBA 1F1JA 3WNBA 3UPDA 4AY3A 2XCLA 4I3FA 3RVBA 1Y5MA 1OQAA 1VL0A 2G9ZA 1BIFA 3LC2O 3O91A 1EJ2A 1KOJA 1T0HB 1TVKB 5B6IA 1NUPA 1XF1A 2G88A 3H13A 1FC0A 5EIBD 3ZJTA 1OFUA 1FFCA 3NUZA 4HS4A 4UVHA 1G5PA 1G9XA 1TMYA 1P39A 1DOHA 2G0AA 2A9QA 2YS7A 4CEJA 4RXUA 3V32A 4HWSA 2PHZA 4QTYA 1VCOA 3DE5X 4PAMA 4ARZA 2F1LA 2OFWA 4DIKA 1GZ5A 4XEHA 2CYAA 4WTOA 3RSCA 3L1IA 3C3AA 3DZJA 4HB4A 4HNHA 2NTYC 4N6OA 4NEHB 1Z0SA 1ADJA 3K9GA 3ROZA 1PQWA 4PN3A 5G3ZA 3ER9A 2OHJA 1FYEA 4I1SA 4P12A 4ITUA 2MT9A 5K8CA 1HORA 3AIOA 3WHPA 1VQMB 1FXWF 2Q9AA 4ZOQI 5BYKA 1U7XA 2IF0A 2JB9A 3OTGA 2BDEA 4AKIA 3EQ7A 3ZGXA 1YB4A 4ALKA 4X54A 4YUXA 3CW2A 2CCGA 1LQUA 3EXEB 5CFMA 3A32A 2ZOSA 3NW9A 4OH1A 1V3VA 5K3FB 3G0OA 2EFEB 3T1QA 4V1CA 3RU2A 3H8VA 4A1OA 3HYCA 1Q84A 1CIJA 2BHSA 5JC1A 3PU6A 1J70A 1ODCA 4L3OA 2NPIA 3T5GA 3V4LA 1RD4A 2ZYAA 3K0CC 3RKUA 3QKSA 2OPBA 1GDDA 3A4MA 1BYUA 5BWLA 3KVYA 3QEKA 4P5EA 4C0WA 3OKAA 1E5XA 1GEEA 3S2EA 3RLIA 3H5AA 4DANA 3EC2A 5IT5A 1E3IA 1ZR4A 4OYYA 4CQNA 1OX4B 4GIBA 4QARA 1C9MA 1QBKC 4WJZA 2CT8A 1T8YA 3KJIA 5DLDA 4F72A 1A9OA 5IEBA 4MW5A 1FB5A 4LVUA 1VFNA 4BC1A 1L4HA 3AB8A 2XCTB 2GREA 2XE7A 3ESZA 1NB9A 5KVVA 1Q0HA 2Q99A 2SICE 3NM5A 1QHHB 3F98A 1ZNXA 4MVJP 2ODAA 4F86A 2E48A 2I6XA 2WSSD 3O4HA 4MGKR 2UXDB 3NIDB 3KUXA 4KQEA 1BVHA 1XU7A 3NEAA 4E22A 4Z3KA 4IPTA 1R88A 1OXSC 5ALZA 5KU1A 1M1YB 2YY7A 3VA7A 2QLMA 1IZZA 5H02A 3R20A 4JB0A 3PYLA 3AKEA 1QGED 1DTEA 1XTJA 2B34A 4O8CA 1BO6A 1N34B 3ZVKA 2ZT5A 4BVEA 1CE8A 3LRTA 4YI3A 4WKCA 5CR9A 3W3AH 1J0AA 4K6GA 4Y0AA 1WR8A 4OPOA 3IBFA 4NZ9A 3RVPA 3H4MA 5AHKA 3X1KA 3W2IA 3IAUA 3PG5A 3OJOA 5KTNA 3IL2A 1W0KA 3LHIA 3KFVA 3F49S 4A8PA 1MLDA 3KYDB 2WAOA 3GH1A 3D6AA 4JITA 1E2JA 4IMRA 5DWDA 3TSWA 1KI6B 3ABSB 5IKPA 3RTCA 3EVGA 3GLGE 1YTLA 1KFCB 1Z6GA 4Y2SA 3GLIB 2WZQA 4BO7A 2CLFB 2CNWD 3HKBB 1PJTA 3QF4A 3G0CA 1CLUA 2F00A 2UZIR 4CFZA 2HWUA 1E58A 2QSJA 2RAFA 1JLMA 5F5LA 3CJQA 1XIVA 1B42A 1BDJA 1NXTA 1Z3IX 4FT2A 4BYMA 3GDHA 1HYBA 1R4MB 2JFQA 4BLUA 1KH2A 3N0WA 4WK4B 2VTKA 5BYAA 3K72B 1H93A 1N57A 1ZBDA 4AQDA 4IJKA 5EJGA 3A4TA 4NL4H 1BQ3A 2YZKA 2XB2A 2EKLA 4TKVA 1WY5A 2D3TA 3SEFA 3VPFA 1X8XA 2WG2A 4RE6A 3RGWS 1QSGA 1UBLS 4AKEA 3QMPA 1MB3A 1REQA 1NXSA 5MFZA 2Y9PB 4ZZ2A 3UEOA 1ZSYA 3F3YA 1Z45A 3RNOA 3RUDA 3OTHA 4Q3KA 1TVMA 1Q7BA 3KSUA 4JP5A 3TS1A 1Y5IA 3NRJA 1N33B 1YLOA 2RGNA 2OKGA 3H84A 4EA6A 4YDHB 1UDAA 3MWDA 2Q5FA 4ZCIA 3HCCA 4XGNA 3TOZA 2ZRIA 2Y1EA 4CT4B 5DOZA 2EW1A 3BE4A 3KB8A 5KYKA 3DBRB 4Y7DA 2H51A 2CLDX 1BXRA 1GIAA 4ESOA 1RYYA 5JXHA 2FP4B 2HDNB 5FYQA 3VHXA 1TUBB 1TUGA 3N6VA 4EJMA 5HQJA 1EVJA 1OZHA 1UJ5A 1R9MA 1XKQA 4U7TB 4CKEB 1KRXA 4CWAA 1CB7A 1E59A 2FW9A 3HLYA 3B1ZA 4LJKA 4E4RA 4H3SA 3VR2A 5KNCH 5KYNA 1CUFA 4DKJA 4HPJB 4EUNA 2VDWB 2VYND 4ER3A 2HV8A 2R96A 4XKWA 4HNUA 1IFXA 3GCZA 3P2JA 2D1QA 1JQEA 1U7PA 4R2LA 3ZGNA 4BE7B 4F56A 5DIFA 3NPAA 2A9FA 2C92A 4KRXA 1DADA 1FS4A 3PA8A 5FA6A 2FMXA 1IM2A 1H8ED 3DEAA 4DE5A 5K0LA 3PQ7A 4IDHA 3DZBA 4P9NA 3REQA 1HXHA 4OQZA 1Z6ZA 1U0SY 2QIOA 5CNKA 4L5IA 1EFLA 1D4AA 3Q88A 3Q3CA 3MQ2A 2W9XA 5FR1A 3HBJA 1EE2A 2YQ4A 3HXPA 4ZYYA 4OOXA 4BO8A 2MOKA 4ALMA 5AQ1A 3AERB 1ZCJA 1MX5A 5E6RB 4QVGA 1XL1A 3CO0S 3OFKA 5BQOA 1R6XA 2F67A 3AP3A 4FEGA 3Q8MA 3LX6A 3IEUA 3DBVO 1BFKA 3NT5A 1FDRA 3DDOA 3EUFA 4DCGA 4TL6A 4Z4QA 3BCUA 3DOFA 3GP8A 3MGAA 4YCDA 2V96A 3F9RA 2DEUA 1KQPA 3KZMA 4DDVA 1ARZA 5IASA 1HDXA 2VJOA 1W93A 1OXVA 2IK8A 4JI0B 3T3DA 3OCYA 4R98A 4HDNB 4QRDA 4X1YB 2C5HA 3RWMB 1YR7A 1KI4A 3G1UA 4ROXA 2X3YA 4QDTA 2ACKA 2I3BA 3X1DA 5F2KA 1FX0A 4AUKA 4D80A 4NV1A 3NHBA 4X1IB 5B1HA 2GN2A 2WT4A 3TTSA 1R0WA 4QDKA 4BAZA 1CFJA 3T9BA 4EIWA 3JQRA 1VBKA 3C6QA 4OHWA 1VMKA 2V6GA 3TLBA 4TN5A 4YAIA 2A8YA 4N3NA 4LXTA 4L50A 2R85A 5B1DA 5A7FA 3B1KA 1KR2A 2AS0A 3RFCA 1TZCA 1IK4A 4LCBA 1Z0AA 3DL7A 3KKQA 3O75A 5T67A 1SD5A 3NHFA 3O95A 3PC3A 2D1SA 1L8LA 2E85A 5AIBA 1E1RD 1X87A 5E1DA 2CJWA 5ED0A 3CVUA 4BGEA 2JGFA 6PFKA 1IYZA 4ZI5A 1G2QA 4KJZA 1SUFA 3D6MA 2YOHA 3ONDA 4N1AA 1JMYA 2XMZA 4J2TA 4UUQA 5P8WA 3U7QA 4XRGA 5LN1A 3ETEA 4D6XA 2ZDQA 1S02A 5JH7F 1LVGA 4BCCA 3NXKA 1YBFA 5H70A 4X61A 4TMTA 2EWVA 3KZCA 4C5CA 1GCIA 3G5UA 5GGXA 1P8JA 3MTAA 2QR5A 5FL7D 1RMQA 2DOKA 4FNAA 1S1CA 3OJEA 1FA9A 4JP1A 4RIHA 3T99A 5IAJA 1XZGA 3LTNC 3GJQA 1YBAA 1XZ8A 2O2DA 1IB0A 2TSYB 5TNXA 4M9ZA 2P3OA 3RCBA 2EXXA 2QRLA 2DFKB 2GCGA 2PRZA 2ZUWA 3AY6A 3R74A 1RHKA 1LTHR 4A8TA 1PLJA 3CF4G 3GCDA 1QF9A 5J2TA 4NG5A 3VR1A 3PDWA 3SBXA 3PQ2A 5FCDA 3AR4A 3T3OA 3U1TA 4A8JB 5BR8B 2PE3A 2QRJA 5K9ZA 3B3JA 3NKLA 5AXBA 2AQIA 1UZUA 4Z4ZA 2EWWA 4FJ1A 1K9SA 3EF1A 1UFRA 2DWQA 4HQLA 3IQZA 3G8AA 1F4PA 4JJ7A 1JR4A 3JARA 2QJTA 2XQGA 3GRRA 3UXMA 3K31A 5BSFA 3L1HA 3W9UA 3U3XA 4G9EA 4X05A 4TS9A 4IKEA 3P0HA 3Q1LA 4UAVA 2Q4DA 2HF2A 5FBQB 2CC2A 4RM3A 1Q11A 1G1AA 1OWLA 4RPHA 4TVBA 3TD2A 1G7TA 3DW3X 3HHEA 1YC5A 4EL0A 4GLFA 2H4WA 3KTAA 1DFIA 1TD1A 3RI3A 2R68A 5IC6A 4AUMA 5LYJA 3CLSC 1NVXQ 4R40A 2A58A 1CUCA 4QOEA 1JEQA 4EHAA 1MHPA 1GQSA 4G86A 1GYQA 1L0BA 4IOJA 1AKTA 1IG0A 1JWBB 2AEFA 2COUA 1YRYE 3UWMA 5KTPA 2A4KA 4LEIA 1WA5A 3SYNA 4GUDA 1SUDA 4OH7A 5AJWA 5KOJB 2HY7A 3ELUA 3BCFA 4YRMA 4YALA 2R7AA 1EI9A 1HQKA 1X7DA 2PGJA 3GAMA 1T3ZA 3DFZA 3IPYA 3AR6A 4TV9F 4ZI2A 5FX2A 1AKYA 1OVMA 3I4CA 4I4TF 4ME6A 1P1BA 4RGQA 1WQ3A 3IQGX 1Z4IA 1JA9A 2ORWA 1G0OA 3PV0A 5D3MB 5DN9A 3H1BA 1WD5A 1T9AA 5HBGA 4I4NA 1A9TA 5I48A 2YJ5A 4DR7B 3SK0A 5DI3B 3MNFA 4JSTA 2A9OA 1D1PA 1TW2A 2IIVA 4UUBA 4XDHA 1CQZA 3MVEA 3BAFA 3K05A 4R51A 3V6LA 1T1GA 2XMGA 3R2JA 4V03A 3RS4A 3U4GA 1KAGA 1YS9A 1MV5A 1NW5A 5T8KA 2XMBA 4ENQA 3FX2A 4J1NA 3U4DA 2W6OA 1XNQB 1DIBA 5JCJD 2AC4A 2CMGA 4D0SA 5KPJA 2VPZA 2OQ2A 4OLJA 4O4JB 1QCYA 1QRAA 1R66A 4FDLA 1XCOA 2JHCA 3HN6A 3V8QA 3ZKWA 3RUAA 4EPWA 4L4YA 4X7EA 3PFNA 2ID7A 4TMVA 3RBXA 4ED9A 1Q15A 1H2XA 2EARA 3REGA 4WN9B 1K7CA 1P44A 4CG1A 1ZCAA 4EVSA 1MVOA 2A57A 1IQPA 1JDVA 2VK4A 3DTVA 4KSBA 5CK4A 2AYZA 3ZGYA 3AHIA 2OTLB 2WINI 4QRIA 4DILA 1EK0A 1H6AA 5EMLA 1G21A 1MX1A 2BV3A 1FTYA 5M34A 4OIFA 3ASSA 2C97A 2XRYA 3GHYA 2FNAA 4GOKA 1SXJE 3HVUA 2Z6QA 3NHRA 3MBOA 4NDNE 3EPKA 4O6VA 2X8AA 2DG2A 4HYYA 1V0FA 1OKKA 4GVLA 2RG1A 1EHIA 4JA2A 4MROA 4DFDA