1E64A

Ferredoxin:nadp+ reductase mutant with lys 75 replaced by gln (k75q)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEQLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN-NADP+ REDUCTASE
publication title Structural Analysis of Interactions for Complex Formation between Ferredoxin-Nadp+ Reductase and its Protein Partners.
pubmed doi rcsb
source organism Nostoc sp. pcc 7119
molecule tags Oxidoreductase
total genus 86
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2000-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1e64A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1e64A02
1ZM3A 3OJWA 1EFUA 2BGIA 1GVHA 4RCYA 1R5NA 3OZVA 1AMOA 4N3GA 4P3YA 2VNKA 1VQ4B 2D74A 3B78A 1KK1A 3FPKA 2HMAA 1G7TA 2DEUA 4RD1A 4HE5A 5TY0A 1QUFA 3OZWA 1KK0A 5JBQA 4LBZA 2BPOA 4M1KA 3V76A 3JQRA 2PMDA 1TVCA 4TMWA 1SKQA 1OB2A 1KJZA 3MMPA 1QVFB 1QH0A 5THXA 2R6HA 3ZBTA 1QG0A 4TMTA 1QFZA 3CCEB 4FK8A 4AF7A 4RD2A 4RD0A 1F20A 2CNDA 1GAQA 1GO2A 2BGJA 1ZM2A 1AIPA 1VQMB 1B23P 4LBWA 1CNFA 1DARA 3MHPA 3FJOA 3CMAB 4G5GA 1FNDA 2VNJA 3VMFA 4FWTA 4WQMA 4B48A 3JQQA 2BSAA 3E20A 3LO8A 4YHBA 4TMZA 3JQPA 1QX4A 1VQ9B 1EFCA 2QN6A 4PC6A 1N8RD 2EFGA 4ZV4A 3E1YE 3ZZ0A 1BX1A 4MYUA 2PIAA 3QE2A 3I55B 4B43A 1XE1A 1N0UA 1SM4A 4ACBA 3G4SB 4QHYA 1D2EA 4DQKA 1NDHA 2BM1A 1VQPB 1KQSB 3CD6B 1QUEA 2QA4B 1EP1B 3QFTA 4K1XA 2DERA 1R5OA 1FNBA 3ZZUA 4C43A 1A8PA 1TUIA 1VQ7B 4YAOA 3ES9A 5GV7A 2BF4A 2DETA 3WBJA 3AGQA 3CW2A 2ZITA 2YWEA 1E63A 1QFJA 2RC5A 1YIJB 2E1RA 3ZBUA 3WY9A 4YAFA 5FA6A 1XB2A 1QGZA 1KTVA 2HDNB 4IW3B 4RD6A 1D1NA 4M2LA 4ZCLA 4PC1A 3I1FA 4BPRA 2XEXA 4G1BA 2QMUA 3OW2B 1FRQA 4N3NA 3CRZA 4M0LA 5GV8A 3MCAA 4M53A 2OK8A 1H85A 3CCLB 1OGJA 3J81k 1ELOA 1BQEA 1G7SA 4RJLA 4RD3A 3WYAA 1ZUNB 4B3XA 3CCQB 1CNEA 4DQLA 4TN1A 4TMXA 3CCRB 1VQOB 1KK2A 4LBVA 2QTLA 1QGAA 1S72B 2NPFA 1FRNA 1JA1A 2DCUA 4RCZA 1W2BB 3LRXA 1IB0A 4Y7CA 1VQ8B 1UMKA 1H42A 2B7BA 4ZCIA 2PLFA 1TLLA 5KSWB 4PC7A 3W2FA 1JB9A 3WXMA 5H5JA 2CRVA 3CC4B 3W2IA 4QFMA 3AVUA 4UAJA 1NJID 2X3UA 3W2HA 1BJKA 1CQXA 1Q82D 3QFSA 1KK3A 1YI2B 4NCNA 2FX3A 3VNUA 1B2RA 1TTTA 5HXBA 4NBSA 2C78A 4ZGQB 1FNMA 2VNIA 3CC2B 1GR1A 2BV3A 3P26A 4PGOA 4MYTA 3U6KA 1ZM9A 2AHOA 3AVXA 3I56B 1QVGB 1KC8D 1GJRA 3PENA 1W35A 3A1FA 5TR9A 1VQKB 1YHQB 1QGYA 1M90D 3QFCA 3CCMB 1Q81D 3CCJB 1EWYA 3WBKA 3LVBA 4YAWA 3U2QA 5AN9A 1F60A 1HA3A 2EIXA 1K8AD 4Y9UA 1YJ9B 2HCJB 4B47A 4C0SA 2BN4A 1FDRA 2QDXA 4B4DA 1JJ2B 1G7CA 1J9ZA 3QSYA 1ZM4A 3W5VA 3OZUA 1GAWA 4LC0A 1IJFA 3CXCB 5TV2A 1S0UA 4AF6A 1E62A 3VO2A 4AC9A 1YJWB 4PC2A 4EH1A 1YITB 4ZCMA 3P27A 4HE6A 2C77A 1VQLB 1VQ5B 2YWGA 1QFYA 3ZZTA 1DDGA 3G6EB 3U6BA 3G71B 1FNCA 1R5BA 4F7DA 1IJEA 4ZGNB 3OJXA 4PC3A 3VNVA 1U2RA 2J7KA 1VQNB 1JA0A 2BMWA 4R71A 3AVTA 2YWHA 1Q7YD 1EFTA 3W2EA 3CMEB 3CCSB 1BX0A 1M1KD 2RC6A 3W2GA 1K73D 1JNYA 1Q86D 2OTLB 4FN5A 1KD1D 4Y9RA 1W34A 4LBYA 3CCUB 3QFRA 3CB4A 3W5HA 2XNJA 2OK7A 5DSZA 1D8TA 4TMVA 3CC7B 1G7RA 1EP2B 3CCVB 4B44A 4ACAA 4J0QA 2GPJA 3WNCA 2VNHA 1KRHA 2B5OA 3CPWB 2B7CA 2QTZA 3B82A 3AGPA 3W5UA 2QEXB 3B8HA 1E64A 4U9UA 1W87A 3WNDA 3ZC3A 4G1VA 4H9GA 3WNBA 3VO1A 2BM0A 2DY1A 1EXMA 2VZLA 4YALA 2GQFA 3SJZA 2YWFA 4M4SA 5H59A 2VYQA 4Q7JB 4P6VF 3LYUA 1DDIA 4YAUA 1WDTA 3AVVA 1VQ6B 1DG1G 1EP3B 3AVYA 1YJNB 1OGIA 3AVWA 1I7PA 5EMNA 1OB5A 2OTJB 4RD4A 1K9MD 1N0VC 2XNCA 2BVNA
chains in the Genus database with same CATH superfamily
1SXJB 2GZHA 2QN3A 3HY4A 1A9TA 3UPTA 1BCRA 1S9HA 2BSQA 2W0MA 3NHZA 3WJAA 4AKHA 4BE7B 4GI1A 4C21A 5SZIA 5A5DA 4Z4TA 2FLVA 3IQWA 2CVQA 3KB1A 4MW9A 1ZRNA 3KQMA 3BHMA 1X1CA 4EVSA 2JCVA 3H7AA 3Q9NA 1HFJA 1NGSA 1BVYF 4XYEA 3DBIA 3V8VA 4OQ4A 4K9LA 4IIDA 3QTLA 5AJWA 3GCDA 4GRIA 4MV5A 4D98A 5JNLA 2C29D 4UULA 4ZALA 4KMSA 5AO9A 3UJDA 3MEQA 3I0ZA 1G7TA 1AX9A 1B8UA 1T2VA 1X8LA 4MUYA 2I66A 3M5WA 4P1ZA 2GK4A 2DUNA 1IK6A 1X9IA 5EXEA 2W43A 4LTDA 2ZJBA 3KP1A 1VSBA 3SX0A 4JODA 3HKEB 3QW4B 5EIOA 3VYWA 3ISVA 2LCQA 4B9EA 1E2KA 2F3QA 2BGUA 1KBQA 4QD3A 1MQ8B 1Y9EA 1IN8A 2BPOA 4NVRA 4XYGA 4F5DA 5L3SB 1KL7A 5FR1A 1JBEA 4HWKA 2DBYA 3LC1O 3ML1A 2X85A 1M2NA 1XTQA 2WIAA 3AR2A 3C98A 3DE0X 3DM9B 3PRKE 3PQ6A 3BTOA 4YXWD 10MHA 5JJLA 3VR6A 4GWLA 1CY2A 3FLAA 4NCAA 2AMYA 2QI9C 3VYSB 5KYKA 4MAFA 1X7ZB 2I5PO 4JJ8A 1TCCA 4OXYA 3U0VA 5I7RA 5KZMB 2ZVPX 2GM9A 4NHOA 1M7HA 4KPFC 3DXFA 2A1TS 3UHAA 3WMWA 5A71A 2EKQA 4GVLA 2P9ZA 2PYZA 3ADOA 4OL9A 1VJ0A 1W1IA 4IJKA 2X1HA 4RF5A 3X1MA 1WZ2A 3KHSA 4C14A 3GD7A 1QH8B 2A78A 1QNLA 2YY5A 4RJ2A 1DKQA 2P3SA 3MGGA 2PY6A 1SZJG 1K8YB 2IIVA 3O4JA 2F4NA 3OH8A 1KVTA 2XECA 4AS2A 5ALQA 2XMGA 5LVAA 3GGCA 1WY5A 1YQQA 2AXPA 5TRDA 1AS2A 2YJ5A 2VXBA 3M6IA 1E7SA 2DR2A 2XQIA 1G5IA 1NN5A 4PQFA 2ZUDA 3RVRA 1DWOA 3FHJA 3ASQA 1NMXA 3SBDA 2ZI5A 4HDKA 4REMA 4INJA 5D1HA 2HA6A 1LDYA 3E22A 5D84A 5GINE 2BEUA 3EZLA 2QQFA 1U0FA 5LZ8A 2AEFA 5ECDA 2P2GA 2ZTUA 1MC5A 3WYCA 3ABOB 1PBTA 1PBNA 2FGKA 2J3DA 3PJRA 2R66A 1J8VA 1SKYE 2GRAA 4S2EA 2BY4A 3ZCUA 2J9GA 5IBPA 1OFGA 3H2HA 3NH6A 3SXUB 4A6DA 5IM4A 4QVIA 5F9HA 1W7AA 2W0SA 3ZLTA 2XA2A 2IZOA 3GXOA 5JDCC 5AW6A 2GSWA 1TJYA 1TLFA 1NMEA 1ZMTA 2I8LA 1THTA 3P9RA 4DDUA 2R8RA 5GADl 3RHTA 1QDUA 5BWCA 1IOVA 4XQGA 3M2PA 4IIFA 3KKLA 2FQWA 4RACA 5E7IA 3RBXA 3EPKA 5TT0A 3BIJA 4G0MA 4NARA 5IASA 3W05A 1NNSA 1RBZA 2DBVO 2O0MA 1P8JA 3REQA 1I4EB 4WERA 4A03A 1ZD2P 4UBKA 1HFEL 3UHJA 1O4VA 1GEGA 1TMYA 3GAAA 3Q40A 1Y0YA 1F8GA 1EJ0A 2CB9A 2ZYGA 4N7RA 4D9CA 2JLXA 5A5VA 2VPPA 1ORHA 1X70A 2RSLA 5ERYA 2JGAA 3M0EA 1Z9BA 3SQDA 1M72A 3H7IA 1E1YA 3HSYA 4EY4A 4ZHQB 5FBVB 4BC1A 4J8PA 2P9EA 3P9ZA 4D02A 4JKIA 4UTZA 4C3VA 4S05A 5EQTA 2NUAB 4E88A 1Z5PA 3GJYA 5DULA 2Y9PB 1KU0A 5HHTA 3MWEB 3D2BA 3HGQA 5K6AC 2OC4A 1SCUA 2CXTA 3TZ6A 1EQ2A 2EGHA 3I5XA 1MAAA 1ABFA 1KZ6A 1Z4IA 2DKOA 5D6NA 2FOIA 3KS9A 1E63A 3TPCA 2ZT5A 2ZJZA 3EGDB 3V7FA 5KEIA 3EXHC 4REOA 1KDZA 4DDMA 4OXIA 3SWWA 5FL7A 3GIDA 4MP8A 4HNHA 5LBTA 2HU5A 4MGEA 3NUZA 1D5CA 4GU5A 1VPWA 4B3RB 1NQTA 1O2DA 2IT1A 3PDCA 1L4MA 3EMDA 4FFWA 4KWCA 1TYEB 1VBNA 3NBZC 4XDYA 5IUNC 4IRUB 3S55A 1QU3A 2HCFA 4MB2A 3LUBA 2YFQA 4QU8A 3DE5X 1I2ZA 1YKFA 1CFJA 4HH1A 4II3A 1T3ZA 3FPJA 4AN0A 4PYLA 4U2DA 3PXDA 4B3SB 4X7FA 3BD6A 4RO0A 3LVFO 1UK7A 3E9YA 3ZU5A 2Q6VA 3I1FA 1F8YA 1KYYA 1UOEA 1ZLXA 2BLLA 3NYQA 3A05A 4L72A 3RVMA 5E4TA 4MVJG 5CVVA 2WJJA 3RIXA 2DG2A 4OP1A 4C20A 3D6NB 2C4KA 1U2PA 5KWEA 5CLJA 1JL3A 4R2XA 3CRZA 1VPDA 4UZEA 2XQFA 2HMSA 4IHJA 4EQ6B 2SKEA 2IYXA 2PUJA 3LMKA 5EJIA 4E5KA 1I0LA 1ZG3A 1OGJA 3H1EA 3TECE 3EIHA 5FTMA 3G8DA 3ZQJA 1SO8A 2HMYB 2V74B 5DTEA 4EHJA 3IMEA 2OO3A 3RWOA 1CJMA 3PNPA 2Y6UA 3UC5A 1RWOA 2XUGA 3TQTA 3HCPA 1U0EA 4U02A 5DFAA 4IG4A 4KIUA 5B5SA 1OWNA 3STUA 1CNEA 3ZBPA 5A1TA 4S04A 4MRPA 4D5EA 4FFRA 2G71A 4C6TB 4DKXA 2CYAA 4UDXX 4CETA 4JDPA 2HEGA 1KK2A 3IELA 1J0BA 3E70C 1WCWA 1IVYA 2D0DA 1L7DA 1J1ZA 1KP3A 1PV1A 2CMKA 3U81A 1E9VA 2F67A 4PQEA 2ZJ5A 5F73A 4HTFA 2IWHA 4S24A 4JSRA 2G5GX 4TTIA 2DPMA 3BMQA 3JD4A 3NYWA 4B5LA 1IHUA 4DOMA 4F6LA 3GUVA 2P41A 3WKBA 2B4QA 2LKDA 2OD7A 4IVRA 5JSUA 3ZD9A 3B12A 5CUQA 1ZK2A 3V7UA 2AOXA 2XUZA 3ENNA 3AQIA 3GG2A 2G83A 1V5IA 1E9CA 1DCTA 1TQ8A 2O2IA 3DAYA 3AEQB 4RMIA 3TF5A 2VDKB 4C4ZA 1ZGAA 3UV6A 3L6BA 4C4TA 1GAEO 5I3ZA 4NZNA 4KREA 3A3PA 3HCNA 4LQLA 4NH4A 5FWNA 3CO0S 3I5AA 4C08A 3DEZA 1EZ1A 4I6GA 1TL7C 2ZIXB 3TBHA 2UZ4A 4WCFA 1FPMA 1NQVA 2Y1KA 2NQ8A 3HXLA 2H4XA 3IPCA 4Q3NA 5FA8A 5KTOA 1MEEA 3K8OE 3BHNA 4FGUA 3VTZA 3FHTA 2JIMA 2V8BA 1HEYA 2VFAA 3STHA 5BV8A 4JJZA 4P58A 3UMGA 4PHGA 4OPVA 4FB5A 3UT5B 4Z0NA 2OOSA 2J41A 1TYAE 4YO8A 2WZNA 2DRIA 1SULA 4KH1A 4TROA 2JBWA 3O7MA 2OYRA 4H0NA 3TNDA 1HDZA 2XE6A 1GG8A 3WLRA 4DJ5X 3FDXA 2VOEA 1EEHA 3F8SA 4H3VA 1UH5A 3HXOA 2AIRA 2QRVA 3OCWA 2JAOA 4RA6A 4AKEA 3N2IA 2HEIA 1LPNA 3PA8A 1MRNA 3E8XA 3QE9Y 2BV3A 2J1LA 2P3OA 2ZIZA 2ZWVA 1P2GA 4WFKA 3X1YA 4B3DA 5ADWA 1UL1X 4BX0A 2EOAA 3TM4A 3O1LA 4M86A 5JXWA 1VHEA 1C7ZA 1H69A 1MUUA 3FDZB 1IHXA 2HQOA 3AI2A 4EIWA 1Q21A 2YOFA 1PR2A 2AG1A 4GZMA 5JO9A 2V7VA 4F92B 2AT1A 4X1YB 5CFLA 1NY6A 2W2LD 2RHCA 4HUQA 4X00A 1KMIY 3TLGA 2A9VA 1P3JA 2PD3A 3RG8A 1JEDA 4E3ZA 5IXJA 2ZSFA 4GE0A 2MMGA 2GUWA 4LRQA 4ZVMA 1E0JA 1OYOA 2NPOA 1KO5A 2JRLA 4A16A 2NXWA 1QHEA 4ASUD 1LI7A 2FEXA 1SD2A 4H7HA 3ZDFA 4XPIA 2HMWA 4BQQA 2EBFX 2Q29A 4QBFA 2E87A 2I4NA 5CU7A 3N0VA 2ZUCA 1G291 3L07A 1B15A 4ZYWA 3TEJA 3PUXA 4GZ6A 5CT5A 3P9PA 4RTMA 2C9MA 3DMDA 4MQLA 3F5MA 2B35A 4N9WA 4JNCA 2FSHA 3W5AA 3X3HA 3PGA1 1E0AA 4LZZA 5HZHA 3SSNA 1N33B 5M7EA 2FMUA 2P7IA 2Q62A 1WUJS 1V8OA 3GRUA 1YXMA 4LA4A 4W1QA 5JSZB 3ICEA 2JGIA 3Q8MA 2HSEA 1E3IA 1JXOA 3L41A 1P60A 5F9MA 4B47A 2B8TA 3TW8B 2CHEA 4BEJA 3VZCA 3EZ7A 1C3LA 2ZI9A 2WPDA 3QXJA 7REQB 1LJLA 4IFIA 3B2NA 3IT0A 2R6CA 4HJRA 4FD3A 2VBSA 1PQYA 3E2PA 1CJKC 4DM3A 4BKUA 5J1TB 1DQYA 1G9SA 4X8HA 5EWMB 1PFWA 1H05A 3DT9A 2Z5VA 3I4CA 3SIWA 2YIJA 1UPXA 3EEIA 1DG9A 2VCEA 1DIHA 3KJXA 1SQSA 3R77A 3ZYZA 3CJQA 2I2AA 5DNVA 2Z4SA 1ZESA 3AIMA 3RTAA 1EFDN 1PNRA 3M70A 1GZ5A 3MTJA 1VQ5B 1O9BA 3PFKA 1CQZA 1BDBA 2NSJA 4O4IB 2FSVA 3N74A 3PHIA 4R9NA 3J81A 2ZB2A 4ED9A 3ESDA 4AI6A 3C45A 1A96A 3Q8WA 1MJFA 1R6XA 2FSGA 5GZ3A 2XCIA 2YJ3A 4YRKA 4CT0A 3Q7EA 5AMXA 1MCZA 2FZGA 3R5JA 4KGZA 4JAVC 2WWXA 2X8AA 3HG7A 3ME5A 4M7RA 3WLPA 4B6OA 5BN3B 3GFOA 5A0FA 3D0RA 3TD9A 1XROA 1M1UA 4W5RA 4NNOA 1KFCB 1VM6A 5JHHB 2VZ0A 1LRJA 2QE7D 2WWFA 1FFXB 1N8KA 3I61A 3ZVKA 2DHRA 4XQ9A 3I9V1 1YBVA 3ILSA 3AZPA 1XWFA 5BMVF 2W7TA 3IQZA 4RDXA 1T5BA 1VXRA 4IS2A 2JHCA 5LM3A 3CMEB 5ENVA 3RUIA 3L2OB 3Q9SA 3CY6A 5IVIA 1AQYA 1P1CA 4EENA 1JEAA 1SHLA 3ECCA 4D8XA 2B1RA 5FBLB 1WEKA 2WWGA 3HFRA 3KO8A 3TTSA 1J42A 5DM1A 4EUFA 4EB8A 4YHHB 4NCKA 3IRUA 2XODA 5I8ZA 5ILQA 4DNFA 1JAHA 3LY7A 3LQRA 4OK6A 1JQLB 1DCMA 2ZL6A 1D1QA 1V3TA 1YJQA 3OQIB 4FDMA 4KACA 4W7SA 2X15A 4D6PA 4P36A 3IP9A 3USCS 2H0RA 1XSEA 2V4MA 2A30A 1FTSA 3GLVA 3NASA 3QVJA 2FAXA 3A1CA 2PFSA 1PEYA 4ZMBA 1DJQA 4LCJA 4XL9A 1VLZA 1MXHA 3Q8LA 3JR7A 1I5RA 2ZBUA 4E30A 4YRGA 2Q9AA 1RRMA 2QP9X 3QVSA 2FUCA 4HH3C 2PU7A 1IZZA 1KMHA 4JS0A 4M99A 4R01A 5AVKA 2ISSD 4D0NA 3AESA 1Z74A 4EG3A 4B4KA 5BYJA 3IERA 1F2UB 1WLYA 3G82C 3C3BA 3KQSA 4CF7A 1FUIA 3TAUA 1LLQA 3K2EA 2OENG 4K6CA 5FO1A 3FSGA 2IOYA 1EX6A 2FW9A 2VNHA 5F77A 2NV0A 2J3KA 4E2XA 2O7NA 1LSOA 1T1EA 3E18A 4M9CA 1KBZA 3CLUC 4PLFA 4GX1A 3S7ZA 1W87A 1G60A 1Z6TA 2HV8A 2Z1NA 2R6AA 4N65A 4V1CA 2W2VA 3C3YA 1WF6A 2R6ZA 1V47A 2GB4A 4G9BA 4PICA 4XARA 4BO4A 2Q3BA 1CP3A 2N42A 5G0UA 3BORA 1UBHS 2OTCA 5B1IA 5AHRA 4EKDA 1BMFA 4L7VA 1ZM7A 4YC7A 4R68A 4QBGB 4EVIA 5TJ9A 4B74A 4NBWA 3TUJC 2B1QA 2H7YA 2Y3IA 5LYJA 1YQXA 2WI8A 1HTBA 1UBSB 3ND8A 4N5LA 4BMYA 4E5PA 3KU4A 1UEIA 3CE6A 3PDJA 2OHGA 3KHTA 4YJ2F 3H42B 3QEBZ 2W2KB 4W5WA 2VTBA 1PKXA 1T1GA 1TKRA 3E9CA 1A0OA 1U5AA 4FE3A 4DCGA 2YJNA 3OQMA 3CEJA 1OGIA 1Z5GA 4KIJA 4Z9BA 3W6PA 1IXKA 1KH3A 4JI2B 4LGCA 1RXUA 2QRJA 4QIHA 3FCOA 3ND7A 4BQIA 3U1TA 3HCRA 1X1RA 3KZCA 5EJ4A 4TS1A 3A36A 3LAWA 4B17A 5LBUA 1PJZA 3IAS1 4MW6A 2VUHB 4GS5A 3LPMA 2P69A 1P1HA 1GVHA 3FUTA 2CL5A 4LISA 5C0OE 5LOVA 3CVYA 4P4UA 3NH9A 4IEIA 3DP7A 3QEMA 3EZ2A 1MHPA 2X5KO 4RGBA 4V0ME 4XXHA 5HIMA 3EOBI 3ZBQA 1CUFA 2IZ1A 3K5WA 3EHEA 1CUGA 1KQPA 4FEGA 2EWWA 1YNOA 5EZYB 5IANA 1XYGA 1A5TA 1IEQA 2C99A 3NI2A 3PS9A 3R23A 1L3BA 3A1DA 2I9PA 3AFMA 3ESYA 3G7UA 4FE7A 3OLXA 4N8DA 5JBNA 5BP7A 1KK1A 1MRSA 3N2EA 3PR2B 2XAAA 1VL1A 4M1OA 3AKCA 1I4WA 1LVHA 4TV8A 2VTVA 1MU0A 2G4CA 5G4KB 4U6QA 2PVCA 1JTFA 1QUFA 1RTTA 2WHPB 4HFRA 4IV5A 4XPZA 4D46A 5JBQA 1GGNA 4OJKA 5TQ2B 3KYCB 2EJCA 1KS2A 4XIYA 2AMVA 1SWVA 1XCBA 2YCBA 1OX6A 5HUHA 3QTBA 3L0IB 1VB3A 1OB2A 4IV0A 3SS9X 2J0SA 1KJZA 4RIIA 1HE3A 2E6KA 3VO9A 1C81A 1L3CA 3GLQA 3DZIA 4C0HA 3WRYA 4DBVO 1COWD 1QV7A 1IOLA 1G8FA 1T1JA 4YCNA 4QELA 1YRYE 4QPJC 1WUKS 3I30X 1OBCA 5K99A 1J8MF 3NQ41 1UBCA 2FE4A 4ZI3A 1PJBA 4GPD1 1ZGGA 1CY6A 4UTVA 3SIXA 2V7UA 1AKWA 3LS2A 4Q24A 3A8JA 1O3YA 3C0KA 4I8DA 2CEAA 2XBLA 4W6QA 2ZBEA 4AUMA 1Z5VA 1SIBE 2CNDA 3HB7A 4OMFG 1GO2A 1C3EA 3M2TA 3K70C 2FG5A 3HBFA 4TVKA 5HRCA 1QFMA 2OUIA 3PP8A 4NONA 1VQMB 2JI7A 3RU9A 2FSFA 3R3XA 5CT9A 2JVJA 2VK1A 4FW9A 4L3WA 4X1KA 1XFDA 4ZP1A 3GB9A 3CMAB 1DFIA 5GTDA 4N76A 1IN1A 2ZQ5A 4RKWA 4X60A 3L4JA 3W6OA 1PQ4A 5IVKA 4GYJA 2WFZA 3D7RA 1FQJA 4WCFC 4FR2A 1Z2PX 3F6CA 3H83A 4MHSA 5CR9A 5DH9A 3HRIA 5F5NA 4AWBA 4KC0A 5G41A 3N28A 1KVRA 4GRAA 5LJLA 4ERXA 2ZUFA 1N34B 1CY1A 1L4LA 2EX0A 1S3SA 1OWOA 3LX4A 1GVNB 3O3NB 3DE4X 4ON9A 4XVHA 4O4LB 3S2GA 5C1IA 4DE5A 1EFCA 4KPGA 2HMUA 4HRAA 4P7JA 2GAIA 5CCDA 1F9EA 1UJ6A 1YKGA 4DMHA 2C7QA 1B93A 2G9VA 1AV6A 1H93A 3GEHA 1TIPA 5KMGA 4G5XA 3PNLA 4C4AA 3MGAA 2GYUA 1RU3A 3ZOKA 1M6NA 4C0WA 1C4OA 1PVOA 3OQVA 3ZGYA 1XTRA 5DHSA 1YZ3A 3HV2A 1Z68A 3KLOA 2WNSA 2AXNA 1E7WA 1JSCA 3SE7A 2DPYA 1ZUIA 4Y6PA 1NB9A 4HPXB 4KJXA 1RADA 2XCSB 1NXQA 2ONYA 1YR3A 3H5WA 1HEIA 3P2EA 4R2IA 3ZH2A 4BVAA 4XQFA 2DWUA 3DTTA 3CUSA 4UBMA 4MDYA 1DWQA 4ZZ1A 4QM7A 2O48X 5AP9A 2O0KA 1QUEA 2P90A 4EKGA 3OPOA 5KQMA 5HXAA 4Q48A 2A9PA 4EL5A 4XN3A 5AQ1A 5DM4A 3RC8A 1XDSA 3OOWA 4R1MA 4OYYA 1IDOA 1CR2A 2OBFA 4R2KA 5EPUA 2JFXA 2WY2D 4JK3A 3O0TA 4YAOA 1QZTA 2J3JA 1SQFA 4K6HA 3TK1A 3DZGA 1KP9A 4RU1A 3WAKA 4BV8A 1KAOA 3D9QX 3GBPA 5K2MA 2CDAA 3THXB 4HQFA 3OIVA 4QUDA 5JJCA 3NKLA 2GN9A 1QP8A 2G04A 2Z0MA 2FPPB 5J23A 4MW1A 4MS4B 2XD9A 1Y9AA 5CDYA 2WHYA 2EFCB 1WZNA 2O0HA 4L75A 3OFVA 3QA3E 4EHDA 1N8TA 4P0PB 3AK4A 1V8DA 4Q4AA 3WYBA 3U26A 1UJ2A 1BROA 1Z0FA 2YN2A 3JAWB 3ZV3A 1P9OA 4CRWB 2MINB 3FVVA 2J8ZA 3WY9A 4C4OA 3MPOA 4YAKA 4PAGA 2MWMA 5FA6A 2IU0A 3WSTA 5GONF 4AL4A 6REQA 3ZY2A 4BWFB 1QQ7A 3ZE6A 4KWIA 3GNLA 5CM2Z 4BX2A 4RD6A 1T15A 1YJ8A 4KXQA 4FM9A 3PNVA 3A1SA 1P39A 1P5FA 3BF7A 4UVHA 3KZXA 4N18A 2BDEA 4TLMB 5SV2A 3N2KB 4PZYA 1DC4A 4OLBA 5KU1A 4HWOA 5GONB 1Z5NA 4X63A 5CIQA 2OYSA 3STTA 3PEWA 1BXRB 2A4KA 3AXSA 4D0LB 1KIAA 2IEYA 1LJ8A 1ZUHA 2XY4A 4OB7A 5AJZA 1QCCA 4G4GA 1WABA 3FZYA 2CVOA 3MCAA 4RELA 3ITKA 1WEHA 1YHYA 1K7CA 3FMPB 2PANA 3MIIA 3OPYA 1PQWA 3E03A 4UJ3A 3W77A 5A4MS 5CHYA 5AVVA 2OGTA 3KDPA 3OT1B 2EZUA 4QHSA 4BMSA 4L3VA 3COWA 2I8AA 1KOFA 5CVJA 4IO0A 2X1LA 5F21A 3TLEA 5A4JA 2FSVC 1N1EA 2CXHA 2UUOA 2V0CA 4P22A 1QE5A 4NI5A 4AJ2A 3CRRA 3T5MA 4TYQA 3GGDA 4HXEB 5ICSA 3GELA 1RZRD 3FTPA 2HX1A 1OE0A 4NULA 5CVTA 4OXKA 1GUBA 5I7AA 2X6QA 4MRRA 2FUNB 2X4DA 3ONWA 1RAFA 4X66B 3CZ4A 1JYSA 1I2MA 1RDFA 1NBMD 3R24A 4TTTS 3CVVA 3WGUA 1EUQA 2ZRAA 2Y27A 1DOAA 2X8BA 3NTOA 4CLEA 2NYVA 2HXSA 2F17A 3QKSB 2ERCA 5SY9A 2EERA 2IKSA 2OZPA 4W9RA 1WBBA 1YB4A 1CEXA 4R3WA 5TEWA 3LP6A 3ESQA 4UAGA 1K89A 3ZDCA 5EHXA 1U7XA 2BUAA 2WWHA 1AOXA 2OSVA 1U2ZA 4COKA 1AU9A 5CFRA 2XCLA 1VKNA 2QDKA 1XTZA 3DTNA 5I9MA 2Q5JA 5EUQB 4NCBA 3GP5A 1J2EA 1RHJA 2HW8A 4RIHA 1NVAA 3ONUA 1ONNA 2VYCA 3AF0A 3BE8A 3R5TA 4RXMA 4AMVA 5KYTA 4BFZA 3FD8A 2PXAA 4IG9A 4IFEA 3AEUB 1N9ZA 3KOMA 1FYVA 5ITSA 3U4QB 1RHMA 1DIAA 1G1AA 3FOAA 3JQAA 2GN2A 3I0NA 3N0RA 4FXPA 4XWGA 2A9KA 3I6MA 1UIMA 2PJZA 2CRVA 3NWPA 4BNGA 4EX7A 2I6FA 5CG2A 2XSZD 4PAMA 4Y8VA 3WGZA 4PNPA 2QN8A 2ZYAA 1H5UA 3ANSA 4UAJA 3LYHA 3KXKA 1IIBA 2X3UA 2WICA 2QGZA 3FNQA 4PCVA 3RU7A 4KYTA 1RMQA 2NZXA 1DT5A 3PWKA 5EMLA 3OQOA 3RWMB 2P67A 1AK2A 1ISJA 1IMJA 3OFND 4HEA1 1NRXA 2OE2A 4ZT7A 1R10A 2G40A 1MKYA 3IEMA 4GVPA 1QANA 1TM5E 4HDOB 3I2FA 5CX1B 1OC4A 1DCKA 3RRXA 4L50A 1W36B 3SZRA 3GROA 3TH5A 2HL6A 4TKLA 1NVFA 1ESCA 1YZGA 3A1NA 2GBCA 4MYTA 1K7YA 3ZKWB 1JZSA 2OZKA 2F3RA 3QVTA 1Z36A 4WLUA 2DYIA 3SC2B 1R88A 1UDCA 5CLIA 1N78A 1DQSA 1CU1A 4CT5A 2XH8A 1VTKA 1QVGB 3NDPA 2WU8A 4GYWA 2GK6A 4Z3KA 3CS3A 1EFPA 2RGYA 1UWVA 2I76A 6CHYA 5AD1A 2ZU0C 5CW2A 1XEXB 3SI7A 1MA0A 3ESZA 1Z2OX 1OA0A 1YBHA 4FC6A 5BY2A 2VI5A 2PLRA 2ZREA 1KI1A 1GYQA 2A84A 1XXHB 3KZMA 2AZDA 3QU5A 4NMMA 5HQ3A 3L6DA 2OV4A 2XZTA 1P75A 4H31A 4RTPA 1SR8A 3C8DA 3HMQA 4RJIA 1C3JA 5CXSA 1X39A 4HN4B 4L0QA 4O8CA 1PSWA 1U99A 2Z08A 4O4JF 1DBPA 5B1HA 1EG7A 1J5XA 2IDMA 2V5AA 3MWYW 4B0OA 3OE4A 2MIIA 1OKKA 3QWBA 1D0SA 3B1ZA 5HOQA 3FCSB 3RS2A 3B38A 4L3OA 3WV4A 1ONOA 1PAUA 2VDOB 1T1RA 3K5IA 3NHMA 4Y1RB 4YREA 1E4VA 4ETWA 4Z5XA 3KYDA 5L4NA 1A71A 4O4JB 1VLLA 2FK7A 3F7NA 2XNDA 3DH0A 1CDOA 3AHGA 2PA3A 3TJMA 1Y8RB 3A4NA 5B1DA 1H2HA 4GZ3A 3VU9A 2O7VA 4MKRA 3DBRA 1N4AA 1QB8A 3CZCA 4AMYA 1SC4A 1BSVA 5TF0A 3TDKA 4RL6A 2BFFB 4TTQA 4CKCA 4U6NA 3Q38A 3LSTA 5E9QA 3I9KA 5C1BA 5H9WA 1N6IA 4EZBA 1Z8NA 3CFYA 521PA 4KXLA 1QQ5A 3UJHA 1E2JA 4OP7A 2XB4A 3EVDA 1PWHA 2JBAA 2YS6A 4ER3A 5KVQA 1V26A 4EY8A 1L6IA 4P35A 3Q88A 1MDFA 3ZWKA 2W98A 2O1SA 2A9JA 4GPAA 2GD6A 1SG9A 1WIWA 3LCUA 4ZCMA 4G5SA 2PWPA 3PUWA 1FXWA 1PQUA 3BGOS 1OBVA 4FN4A 1ES9A 5DLDA 3H6KA 3UK6A 1XGKA 4GYYA 4R84A 4TOIA 1L5HA 5HTKA 5B3AA 3CN7A 1FNCA 3FUWA 3HUUA 3UENA 2F4VB 3L7CA 1CE8B 4CV1A 1U0BB 2VG8A 4CEIB 4LF5B 3KKNA 4KYVA 4LXTA 1HYQA 2FPMA 4WZLA 1C9EA 3CF2A 1ZJWA 2Y0DA 1ONBA 5FPSA 5IXSA 3AEYA 1J2TA 3D5EA 4GG1A 1UINA 2DLDA 4ND5A 1FJ2A 2W6JD 2D0IA 4KOEC 1U3GA 4DREA 2WVJA 3I8OA 4WZ6A 1Z7WA 2DFVA 3T56B 1EE9A 2KBFA 2MSWA 1OFUA 1Y7HA 2Q4TA 1NA5A 1PNOA 2WG2A 3MAJA 4GYKA 1E98A 4LDZA 1EFTA 2I67A 4HB4A 4MI9A 4OV6B 5AK5A 1F12A 3WRYC 4DKJA 5F7ZA 2HFJA 1G5HA 2VLBA 3GEIA 3L7KA 2ODPA 2JA1A 4GMHA 3OCVA 4RXTA 1N2ZA 2H92A 3NFYA 4DEVA 1L9XA 1RRPA 3DFZA 2XV1A 9ATCA 4MO2A 4I1PA 1PO7A 3E61A 2RGUA 2AL7A 1BGVA 4FIZA 3LX6A 5EMMA 3PDIB 2H6EA 4NJMB 3BMCB 5IJAA 3RPEA 1P1KA 4YV7A 3LM8A 3C97A 5DWVA 2YMMA 1KMNA 5COAA 1YOVB 4B4VA 1TJ5A 4OATA 2PSFA 3I9FA 1W34A 2CNWD 2REOA 4JB0A 2O3RA 4CYMA 3V3TA 4MQMA 4X84A 2B5WA 3NNDA 4I8IA 4D9MA 1CUHA 1JFTA 2VJAA 3FOBA 4LJ5A 4BEVA 4CL2A 3X1DA 4KFTA 1O96B 2H4HA 2PBLA 3F7MA 5BSHA 1FFEA 3ED1A 4KOAA 4W6ZA 3PGXA 4BB5A 2BGKA 2QI9F 3ZWNA 2W70A 4E5DA 1M74A 4BWGA 1Y3DE 3VDNB 3NHFA 1O6GA 1W6UA 1H8HA 2E2WA 1U5CA 5D3MB 2P11A 2QA5A 5EPEA 3FWZA 1P0QA 5EG5A 2IUSA 1GZUA 4MEBA 1IY0A 2Q7XA 2XYVA 2NG1A 5A3JA 1E7QA 3PRJA 4Y2TA 3RANA 5EXSA 1G2OA 2AJLI 3EFEA 2ZIFA 1SPBS 3DE3X 4GWGA 8AT1A 3WXBA 2JFHA 4CT4B 5EZQA 1QWOA 3PA1A 1Q6ZA 2AFHE 2PQMA 3V4VB 2ESRA 1EFKA 3KTFA 4DN6A 1UKCA 3EAQA 5K3OA 2CV1A 3G17A 4C6RA 4IDAA 1JSZA 1I51A 1K6JA 4LRXA 5FNZA 2BZSA 3A6JA 3ED5A 2WE7A 1V96A 2QZSA 1Y33E 3RAPR 3E7PA 4B8YA 5IBCA 5M5BA 3AP2A 4P0TA 5JRJA 2OOKA 3IXQA 1MV5A 4UHCA 4WK0B 3QV1A 4ZAVA 2G09A 5FR2A 2X7HA 4RDIA 1O87A 1DIBA 3KR0A 4KI0A 4UEQA 3ZHXA 4JLPA 2WYRA 4DA9A 3LTNC 3UT0A 1PJ5A 2GVZC 3GRVA 4POAA 2ZZGA 3OX3A 2OWDA 1UT8A 3G8AA 4I50F 2ETXA 2JFBA 4MS1A 3MTAA 1VXOA 4QAJA 3G2HA 1ZK3A 2YQ5A 3W5IA 2BFBA 2Z6QA 1CZLA 2JARA 3WI7A 1XU4A 2HRQA 1HDIA 2DC1A 4DCUA 4QO7A 1E0KA 5BQFA 3MRXA 3ANNA 4BQSA 3AVVA 3PNKA 3A8IA 3QKRB 1XTVA 4TWAA 1M75A 5KAMA 3S8EA 3GUZA 1UK8A 3L1VA 3OIFA 3TTTA 4KKSA 3WL6A 1HK7A 1LPAB 2AFRA 4I66A 4HY3A 2QP4A 2V6MA 4R7ZA 3N0TA 4ZIRB 1VJ5A 3PXCX 1KZLA 4RD4A 1AJEA 1KYQA 4JQSA 1XVLA 4X1IA 4RHEA 2ACVA 2WU3A 3FZQA 1VMEA 3BWBA 4CTNA 3DCJA 1F4LA 4BVJA 4H7FA 5IUJC 1RM3A 1SUBA 3KR9A 4J2HA 1LSJA 5K8UA 2PHZA 3NOQA 4IICA 2IW1A 1EM8B 2Q99A 3P4YA 4FKBA 4JEIA 3C7TA 1EPUA 4OFZA 1QRUA 1VGRA 2B78A 3DLPX 4MMYB 5JSYA 3RTDA 4C88A 4UPEA 4HS4A 1ECPA 3TSYA 2ODTX 4L9RA 5EFOA 1RE1A 3AERA 2WIBA 2NLOA 2XYHA 1WSWA 3DEJA 1Q50A 4JR0A 1WPQA 2HGZA 3L49A 2W4MA 1QNFA 3BWMA 1GTZA 1V35A 2VXCA 3VR2D 3S81A 2W48A 3QUBA 5JJKA 3WADA 1Q0TA 1JZTA 1SUFA 5TMDA 1R5JA 2TMDA 1E2IA 4FLFA 3FW1A 3RSHA 1Q1ZA 5F52A 4FTWA 1TF5A 2G1UA 4XQEA 4CIXA 2CUKA 4B3TB 1FMCA 4YRNA 1R37A 4DEXA 3OKXA 3PYXA 5B1YA 2RD2A 3ASVA 4MIEA 1M8JA 1KAEA 1CETA 3EXHB 1LC3A 1U0LA 2I2XB 4JGIA 3S68A 2Q49A 1R6DA 1JWAB 1G0NA 3KZVA 1A2OA 1NMYA 1JDPA 3F9IA 1DEKA 1S5PA 3PUIA 4OXQA 4ZOLF 2PL1A 2QTMA 5E7JA 3QELA 5FB3A 1U8TA 3L5KA 4NHEA 1I3KA 1V5GA 2HO5A 2NZUG 1VB5A 1CJCA 3MMPA 5H7XA 3RREA 2GDZA 1K6XA 4ZVSA 3N0XA 5B3KA 3N0WA 1XA3A 3WFJA 4OKIA 2AH5A 3LL7A 4TXHA 4ZOLB 4ZTUB 3FCXA 3K3PA 1P2BA 1BPLA 3BRCA 2E1BA 3HP1A 1VCOA 2GD0A 4BV9A 1E2QA 2CJYA 1W9MA 5I7UA 2J7PD 2Y0PA 4KODA 1T4MA 2VNAA 1J8DA 4PVDA 4Z6KA 5LDGA 1VMAA 2GPAA 1XA0A 2GETA 3FKSD 4BQNA 3J7AC 3U61B 2XRFA 3TNYA 3HO8A 5KOYA 1ZM2A 2O19A 1ACMA 3WC4A 3G9ZA 4EM6A 4LZJA 3GGSA 3DD1A 3NTQA 5EVJA 2LCIA 2VHTA 1TD9A 4JVSB 1PNVA 3QMVA 5TC4A 2QTGA 4BGEA 1P5HA 4CM1A 1DARA 1NMZA 2JB9A 3BE6A 4HDNA 2CV2A 1P3Y1 1I5OA 1N2IA 4QPZA 4L8JA 2CE2X 3ICVA 1PWXA 2FPWA 1CT9A 5KX5A 2JVKA 1FTGA 2XX3A 1Q9SA 3KKEA 4CIAA 4C6HA 1BCSB 5EWLA 1Z6YA 1CLUA 4D4IA 1O5TA 2BI7A 3C3AA 4HNAA 4TMZA 1LLDA 2KX7A 4G0ZA 3BZWA 3OTIA 1LLUA 4PPQA 4DCNA 4EPXA 4MMXB 4MZDA 4BDSA 1PG0A 2DTEA 1BQ4A 1YS7A 3AUKA 3GRYA 2GCEA 3IVMA 2NVBA 1Z26A 4L4RA 2H29A 1I18A 3AF6A 3MTDA 4B2PA 4BQEA 4EUKA 3A6PC 3ABIA 5AM2A 3IJEB 3ROTA 1RJ9B 2RHBA 4IINA 3HUEA 4Q9HA 3BAFA 4BB9A 4CM5A 3TG2A 4M9ZA 3I6QA 4FFLA 4CFSA 4F93B 3IBCA 3ETHA 2PIAA 1PX0A 3LK7A 2UZ1B 5B1SA 4ZVTA 1XE1A 5CLFA 3G0CA 4DWVA 2YDYA 3A3NA 4ETIA 2IY8A 1FP4A 4HCJA 4X91A 2XUDA 1N6OA 3JQ8B 3R3WA 4MV8A 5CPBA 1IN7A 1EX7A 4BCCA 2C7RA 3BB3A 2ST1A 5D1NA 4WZTA 3IQGX 1GZHB 3EGXB 1A76A 2I29A 3ZCRA 1KFKB 2CHFA 2QXUA 3QEKA 1SXGA 2J3LA 1QJCA 4C4PA 4C03A 1RLUA 5LA6F 2FH5B 3M7IA 3S99A 1ZVVA 1JLHA 1FVXA 3DG9A 5GGXA 4GVXA 4X7BA 1Q83A 5CURA 3UB4A 5FI3A 3VBEA 1CDZA 5ELXA 1BAPA 1GHTA 3DOFA 3UG7A 3F2VA 3FBGA 5CTAA 2WG1A 3DT8A 1B74A 4NKRA 3U37A 5CMLA 1RAAA 3V1KA 3WLSA 3CW2A 3AL0C 3O4GA 4MVJA 2PGXA 3BPSA 3CF4A 1WE2A 1JLRA 3WYEA 1LBHA 1PSDA 1REQB 2VJJA 4G36A 4BIIA 5LLTA 3EZ9A 5SICE 4LC1A 3M1YA 3PKIA 4MR7A 5HW0A 2H9YA 5IT5A 4MPTA 2D7DA 3AWIA 2AX4A 2E4ZA 1TA4A 1CUBA 2AYXA 3OEEA 1NF3A 4O4HF 1ETUA 3H11A 2P5SA 4YCDA 3CIOA 2QM0A 2L17A 2EGUA 3C74A 1SXHA 3NRJA 4R83A 4P25A 5FULA 5GOTA 1KTVA 4RZXA 2EQAA 5DI9A 1HY3A 2P9QA 5CEFA 4YLEA 3E35A 5E8JA 2P5YA 6LDHA 1WSBA 4MRAA 1UM9B 3CJTA 4LMPA 1G8AA 2IELA 1LGYA 2RHJA 5CBPB 2XCRB 1F2DA 1ZNYA 2G4VA 1N3IA 1X7XA 1I7LA 2VS1A 4QOSA 4CKBA 3KPJA 3H5LA 4A9AA 3W4IA 5E9WA 1DX4A 1SH7A 2X1VA 4CCSA 4KQCA 2PU5A 4OPOA 2Z2XA 1OCEA 2RHHA 5U1PA 1OUMA 5DGIA 5M04A 2V3CC 1UKAA 1W76A 3EDQA 3OT5A 3KSAC 2C8VA 2IYAA 1OZGA 3MBKA 1BQEA 2VF4X 4Z9XA 1XV5A 3QUAA 2VDWB 2W4QA 1VQ1A 4ZT2A 3MJCA 5DM60 4DIFA 1C0EA 2ODWA 5KCZA 4LC9A 2GYWA 2E4XA 4UCXA 1VG9B 1TEVA 4W5JA 5D86A 4QULA 3V4SA 2W22A 1X1DA 5KYVA 1T9BA 3U40A 4X05A 1EFVB 4GBMA 4TN1A 4OTZA 2ZT6A 5FWXA 1GGEA 3SHTA 1XNHA 4CQMB 2K87A 3RQSA 2EVWX 2UVQA 3Q1LA 1YQ9A 5ANRB 3RSSA 1MW9X 3S0JA 1GQSA 2CEKA 3UJCA 5AVYA 2EF1A 3HV0A 5JV5A 4F3YA 4UNIA 3SC6A 4FONA 3FSEA 1L9KA 2QRLA 4LS3A 5LIRA 2QQEA 4EHNA 3PEYA 4EA6A 1WSAA 2XYRA 3OHSX 1AZWA 1PJQA 1DV2A 2PRZA 3M33A 1LTQA 5F35A 1ILEA 4GDFA 2NU8A 1O0BA 2R44A 3GXBA 1G18A 4FYMA 3WFIA 1U7PA 4XLZA 1A8QA 2WPNA 3HZHA 5DW3A 4Z4IA 1QG6A 1IHYA 2X86A 5LKAA 1Q17A 1TLLA 1L4KA 5J3OA 4CODB 1G3MA 2QVCA 1XELA 2CLFB 1T2EA 3AH8A 4TWZA 2IXGA 4I1YA 3OETA 4DY6A 3PC6A 4IDFA 3A4VA 1TQ6A 2WUDA 1BU8A 3BJIC 2ZRKA 3DP9A 2R62A 3FDIA 4MV7A 4QO8A 1FLAA 2D1RA 1WCIB 2HU2A 2ORVA 4GKVA 3WGYA 5DX1A 1DKOA 3VXKA 2C2ZA 2Q1WA 1YK1A 5AVJA 5FO0A 3O4VA 1YQEA 2A7XA 3W2IA 2OFPA 3VMMA 3VJKA 1E96A 3HR8A 4NC9A 2AN5A 2EGGA 2RK6A 1QHGA 2X8JA 4O1MA 4RVCA 2SECE 5E1OA 4MV3A 1SFRA 3S2FA 2C59A 3O74A 3V8RA 3VR0A 2WJ3A 2QD4A 3UQZA 1VF7A 3CYFA 1TQ2A 4DJEC 4V0NA 4NQRA 2BEKA 4L95C 1XDZA 2P8SA 3QIVA 5HXBA 3IJPA 4TKZA 2DUWA 2QIPA 4ZGQB 1CZRA 1MT3A 3R5HA 2I2CA 4EHHA 2VBIA 1SXJD 2WT8A 3Q10A 3PKZA 4KPUB 2FWAA 4QU5A 3HDQA 1G2PA 3ICPA 3RSGA 4GQIA 3V6MA 3HUTA 4P5EA 4DV4B 2ZB7A 1Z4KA 3PPIA 5F2KA 2LNDA 3KTAA 4PM4A 2VJDA 3UAGA 3SCZA 4DIBA 5I4KA 1XRMA 5ALOA 5JJIA 1P7PA 2HNAA 3DZ8A 5AW9A 3UKJA 2IUEA 3U16A 2PN1A 3O8NA 4CV2A 1RRVA 2D00A 1YRWA 1LK7A 2W2PA 3OEHA 2VSXA 3PQDA 2F1MA 1M2KA 3CC8A 4WKNA 3O7WA 4R98A 3PIIA 1ZYUA 1V0EA 2CYBA 1K4YA 1NW7A 5JNWA 1XNRB 1YL7A 3A1FA 3KVVA 1NW6A 3F4BA 1TM3E 1YHQB 1I4OA 3IHTA 4JEUA 4J0EA 5B3LA 2BJHA 2ZRGA 4HDKB 1NBHA 4H15A 4UNPA 5DRTA 4AECA 1T5HX 5EE9A 2PKQO 5IM4F 4DY4A 3QHAA 4BOYA 3QFCA 3IA7A 2LV8A 3ZTTA 1SWWA 1U80A 2OZEA 4BNIA 2OXEA 1Y5LA 1D09A 4XKVA 3IOMA 3ORQA 4FXOA 1GTVA 1UJBA 2XA9A 4NF2A 1K8RA 3RYIA 4EJSA 5C37A 4DIOA 4Q1AA 4X6XA 3EXAA 4RTKA 3TRHA 4D26A 1VLOA 2G7MC 4YQYA 3VR3A 3ZE8A 4NBNA 4YA6A 4AP9A 3B60A 3B6JA 1R12A 1G6OA 1WLSA 2F9MA 1TVEA 4EPVA 3G13A 4FBGA 4MB6A 1P8AA 1BHJA 5C1DA 3L82B 2D2FA 3QSYA 4S1VA 5L6LB 2LBPA 1F51E 1PJRA 2Q4DA 1DIRA 3BBLA 3IJRA 3DV9A 1UXHA 4RJKA 1QHHA 2VHYA 4H7KA 4WI1A 4WZAB 3AU8A 1U1DA 3D6HA 2VBVA 5DBHX 1S4QA 2NTNA 4NZYA 4DSNA 1S0UA 1FPQA 4F45A 1YJWB 3IUPA 5LDHA 4PC2A 4EH1A 2REBA 1YITB 2CNBA 2Z3ZA 3N58A 3OBBA 2QLTA 2FHSA 3QLVA 4LJYA 5HOEA 4KQ2A 1U31A 1WXFA 2WLTA 4JJ7A 5AK6A 2H07A 5FHQA 4DJJA 3OCYA 3KOXA 5JAUA 3S2EA 4D3ZA 1T6NA 2OQRA 2Q5CA 2X77A 4F7DA 3JY6A 5IK2D 1Q0HA 2GEDA 3DOIA 3G8BA 3I64A 2W93A 3H5RA 2ARKA 3JALB 3NTRA 3OWHA 1FUEA 1YMUA 4J1SA 2F48A 4KQ9A 2JJYA 2QL9A 1XAGA 4MPPA 4NDZA 3VVLA 3OBIA 2JCSA 1YA4A 3EUEA 3TMYA 5FH9A 3KPUA 4KX5A 4QT0A 4LY3A 5B3JA 5ALHA 1GKKA 3UJ3X 3VU3A 1H2ZA 1RS0A 5KNBD 4RW0A 2KMLA 3AONB 4K5QA 4OIFA 4A8JA 2R8ZA 4KQWA 4UUQA 3BXPA 3K30A 3QX3A 3ZU2A 1NWCA 3VR4A 2FMXA 3I9V6 1KFBB 3A9VA 1SJ9A 2MR6A 1SUDA 2B4KA 1OV4A 1YQDA 5AICA 5HKAA 3LXMA 4IXNA 3U5ZB 2X76A 1TO1E 4IHJF 3A70A 3ZU4A 5FLXA 2IOHA 2XNSA 3PCRB 3WGKA 3N6XA 3ENWA 4OI1A 4AMUA 2FUKA 5D7BA 1JIKA 4IOKA 3EWSA 5FI0B 3TXXA 1DE0A 4K9SA 2JEOA 2OZVA 2FZEA 3GN1A 1HMYA 1U8UA 2QV0A 3C3EA 3K72B 4DNXA 5IM5A 1MX5A 5AFSA 4BLSA 2NT3A 2XDWA 3D5QA 5TS2A 4BVBA 1BC5A 2C88A 2FMKA 1CUSA 1OA1A 3GJZA 3SDSA 4C1NA 2O05A 3NIWA 5CEJA 1D4AA 1UBTS 3BTVA 1T0IA 1VA4A 3DOCA 1R15A 1TTPB 1LCIA 3HB0A 2QLLA 1ATZA 1RACA 3HXPA 3MC1A 4MEAA 5HIJA 4PPNA 2ZJFA 3MS2A 1MW8X 3DHEA 4BVFA 2B4RO 1ISMA 3AIIA 2GPYA 1WOMA 1P73A 4Q9AA 1AZLA 4X6YA 5DM70 4RKFA 2BGWA 4PZZA 1L7QA 4X85A 3VZRA 1EXWA 3L8YA 4NE2A 3WR5A 3C8MA 4FR0A 4X65B 2FMHA 3W5UA 3BMQB 3B8HA 5EJAA 3Q41A 5K0GA 5HE9A 2C2KA 3GT4A 4ICIA 3ODGA 3RTEA 1VYVA 3F46A 2X0IA 2ZZFA 1C7JA 2PX6A 2QS9A 3DR3A 1S2LA 3FSRA 4GMFA 4J6EA 1B43A 4NDNE 3TTUA 4UM9B 3WTBA 4QPNA 5ERXA 4C4RA 1U0JA 4G2TA 1YR2A 3MW8A 5CB0A 1GNTA 2OBYA 2Y93A 3EDOA 4R1UA 3F90A 4DYVA 2V0GA 2ZJ3A 4Y2PA 3V48A 4FGWA 5F7JA 1N07A 3SJZA 1KERA 3H5OA 3OX4A 3VR5D 3LUKA 1RWQA 5FLEX 2V59A 2DJIA 5GMOA 3EXIB 2P6MA 4P82A 4E5MA 4QU9A 2WR8A 3KJZA 3M4JA 1VL2A 3IKLA 3NEPX 3UJPA 1U65A 5G1NA 3UVEA 3ESAA 1Q3KA 2JDID 4JYPA 4E7OA 2JAUA 2JHGA 1ZUNA 4D9KA 1U11A 4WNAA 1W2HA 4MVJE 2V54A 4N82A 3VH1A 4E4RA 2ZXEA 1R8SA 2D2IA 1ZD8A 1P0CA 1E6UA 4N49A 3MLBA 4OQDA 1LZKA 4KWHA 3MILA 2I1LA 3THOA 1JDZA 5BVGA 4W5QA 3I2IA 3FSJX 4FCVA 4TKOB 2CXNA 2CKDA 5BQOA 3JPYA 5AI8A 2QRVB 1N0VC 3ND9A 3D7KA 3HYSA 3OE1A 1Z0JA 4RA6B 4JJAA 3IP1A 4BWYA 5A6VA 2GZ3A 2AUNA 1KMQA 1EGVB 1XAJA 2BFCA 5JD5A 4B3JA 3F97A 3H9UA 3NWJA 4L9AA 1VSUA 4YRCA 3RG2A 1BXZA 1HO3A 4CFZA 4CCYA 2VDNB 5IULC 1WL8A 1EFUA 2BGIA 1R6UA 1R5NA 4M0KA 3PJGA 4L8WB 1MFPA 1UPBA 1A7JA 4OX9Y 3IAS6 5BNTA 5L7TA 3TUIC 3OJFA 4O1HA 1UQTA 4HEHA 3COPA 1O9GA 2WEKA 2JLAA 1J07A 1L3IA 1NVWQ 3O82A 4PWYA 1Z0UA 2NSDA 1UZMA 3EGVA 3L7NA 3BGWA 2D74A 1GCIA 1RYHA 3OKCA 4BGVA 2OV3A 2RGXA 1T10A 3OFJA 4JI6B 4CLRB 3GMIA 4J0CA 3FPKA 3F3SA 2E5LB 2JAPA 5AUNB 4HE5A 1FL9A 5FIUA 1AHHA 2QSUA 4B3CA 2O2CA 3QF7A 1KZ1A 4C7JA 2V6JA 1MABA 5TY0A 4ZAGA 1MAUA 3ZY4A 4D9FA 1XJQA 2JI8A 1SQ5A 4IJVA 4DSZA 2C54A 4YCSA 1OI2A 1FW8A 5LJIA 4MA0A 1K8XB 3GGJA 4EITA 2EFJA 2EG5A 2JFFA 2HJVA 4LYEA 4MI3A 1B26A 1GTL1 1JDJA 3E3MA 2IXTA 3TLYA 2FWIA 2Q6KA 4LXIA 3V8QA 1E7YA 4JT2A 3H86A 1YR7A 1KR2A 4L8GA 4FJ0A 4QE3A 1QVFB 1D0VA 3FPFA 4WJLA 5EJFA 3DFMA 2XZLA 1ZMOA 1OX5A 3R3UA 4DK0A 4ZKEA 2R6HA 2BELA 1G5PA 4TMTA 1ZL0A 4TTPA 1UBLS 2QZZA 4NDAA 4EUSA 1U9ZA 1EIWA 1MBZA 4MX8A 3KT6A 1KU6A 2ZXUA 2ZUBA 4OMCA 1DJNA 2FMIA 5FBWB 5B7QA 3PQCA 4U7DA 2QD5A 1KO8A 1XCOA 2Z43A 3E4CA 4GGMX 4IR7A 3R41A 2ZRBA 1D6SA 3KQNA 2O8DA 2X42A 1Z2EA 2POQX 5EYPA 5KTPA 4BQOA 5KTYA 1QU2A 2F2TA 3HJBA 1EQUA 4TSKA 3AR5A 4TSRA 1QX3A 3T9DA 3URMA 4EGSA 3F6EX 1Z5WA 4DYDA 4AJ1A 4E1AA 3L8FA 1TC1A 1QP0A 5A3QA 3F6RA 1E92A 1H0HA 4P9SA 2GXUA 2J9FA 3IUYA 5JDIC 3ZGLA 2DULA 3O94A 2AEMA 5DNWA 4N39A 1YV9A 3DBLA 4P9NA 2NMVA 1U02A 2Z1DA 2CUTA 1A4IA 5KNDD 3UXYA 1SZCA 2DU8A 3IMKA 1CB7A 1DJPA 3RS9A 4AG5A 4FYVA 4RUKA 3ZR4B 1A97A 1EBBA 1EGHA 3C5EA 4U5QA 2P6RA 1D2AA 2LGJA 4I6EA 3X1WA 1UEXC 1FSPA 2F00A 2A5DA 2UUBB 1AO3A 5I01A 4BBJA 3SVTA 2WILA 4KUHA 2ZUEA 1P2UA 2NO9A 4J2OA 3JQ7B 3VH4A 3VSCA 4EG6A 3PC3A 4NABA 1BX1A 3JZMA 3U1VA 2JASA 4F6RA 2I1QA 3AFHA 4UCFA 3I2GA 4OHZA 3CH7A 5HFJA 5TGDA 1X7YA 2YXBA 1GAXA 2XTZA 2PKYX 4PSVA 5DU2A 3AKEA 1NE7A 1I6LA 2VP3A 3TAXA 2FPIB 2GYYA 2BM1A 1JTVA 1H23A 1WXQA 2Y92A 3AL2A 3EZ6A 2QX7A 4WA8A 2R8EA 2Q6LA 2DUJA 2PL3A 2XB8A 2XUFA 1NKSA 4CEHA 3LZ6A 1E3SA 1HQKA 1LPOA 2GZMA 3CX6A 1M7BA 2YTZA 1SB9A 1S2GA 3WIVA 2G6TA 2ZJAA 3ZLVA 1GR0A 3R3YA 4MQEB 4CM6A 4IDEA 2KM1A 3W8DA 5DXAA 1IUPA 5KHLB 1PGQA 2ATEA 2ANBA 4ZQBA 3X0DA 5C51B 4R5MA 1NR5A 1OFIA 1KMHB 1X3SA 3JZAA 3ZHZA 2WD7A 3HM2A 5KC9A 3V33A 1M0WA 3W0LB 1FVOA 3B3JA 4D4LA 4ZO8A 2WYUA 4DQ0A 4AULA 5JI3E 1LDEA 4RTSA 2ZJ7A 1Y1QA 1IBRA 2PGAA 2AOTA 3ZCTA 3L18A 2WKRA 2FQ1A 3TOZA 2GO7A 3TXYA 3BQJA 1ND6A 2VT7A 3VV2A 2VDUE 4YCCA 2BAGA 1XO1A 1F4PA 3ILHA 2Y6VA 2IYSA 3F6YA 1GL6A 2FRDA 2QYTA 3I42A 1K08A 1XUOA 4UEJA 4CF4A 4OGFA 3C6KA 4PYOA 4U8GA 4LFAB 3CCCA 1G3QA 1L5YA 3C8UA 4B3IA 2VDLB 4Q12A 3WKAA 3H2BA 1RRCA 3SNHA 4DRZA 3DE6X 3C41J 1DKNA 5DXFA 3STXA 5LYJF 3DDCA 2XEXA 4OHKA 1VP3A 2V8OA 1PJ7A 3OQJA 1JEQA 3JWGA 3Q1KA 4L4XA 1AH2A 2FWMX 1P7YA 1E1QD 1AQ6A 2OV2A 1HZEA 4V38A 1IM8A 4GM4A 1QDEA 2E49A 3SLRA 1VE9A 1ZFNA 3V8PA 2OK8A 4DIKA 3K16A 4MCJA 5CYGA 3KVOA 3QLVC 1CEYA 1V11A 2V7TA 4ZOAA 2GTIA 1YVRA 2FX5A 1XTIA 1NSYA 4PEVA 8ADHA 5JZSA 2JEYA 4QHTA 1C7IA 3L40A 4RZSA 3BXGA 4Y18A 2EW8A 5AUQA 1V3UA 4WE3A 2I1WA 5DHTA 3B5IA 3IIJA 1D04A 1N2OA 2FRVA 3OW7A 2ZE8A 4Q7LA 3PDWA 5CA1A 5JQGB 1FYEA 1M34E 4CTJA 1UBUS 4B80A 1KEVA 1HWYA 4IVQA 1Q91A 1RCUA 4MYDA 4V0QA 2V97A 3EUWA 3Q85A 3NPMA 2AS0A 4L4YA 4V0OA 5B3JC 5LOVF 2ZRIA 1U6IA 1MJHA 1WXWA 1IQ0A 1QGAA 1AUQA 1S72B 5DX0A 3HEAA 4YGXB 2RG1A 2GT1A 5IJWA 3Q72A 4A8JC 2OBSA 1WTHD 1THMA 2HIHA 2ZJ8A 4Q05A 2Q8QA 1T2UA 1K7EB 3GZNB 4OJYA 4UATA 1PUIA 1F6WA 3I04M 3O8RA 1UMKA 2ISCA 1AG9A 3KKKA 4BJ5A 1ESZA 4MWBA 4OEHA 5DCLA 4OAOA 5EN4A 4ZGBA 2FTKE 4DUZB 3TVTA 5HIKA 2V7PA 1JU4A 4PCLA 2IPNA 1N5MA 3K9QO 5SY4A 5B7PA 4ME6A 4TV8F 1OH7A 2HRCA 4UTNA 1DRUA 3KV3O 3MMZA 1A1VA 2QT0A 3UC9A 1X87A 3QPCA 2WJYA 3V55A 1C8VB 2ZAIA 1X15A 4BP3A 1KBOA 4UAUA 1J49A 3RRYA 2HIMA 3C5HA 3E9ZA 1YCHA 3LHIA 4FZJA 4LHYA 4TV8B 3U4CA 2NP7A 4DJDC 1CRZA 8LDHA 4UU8A 2QLMA 4EKYA 1C7EA 1XMXA 1E2LA 3RVNA 3DW1X 3P19A 1V45E 4IIJA 4OXRA 1BN7A 3FMGA 3PL1A 1FUYB 2F8TA 1HZZA 3AVQA 1JAIA 1XI2A 1YDMA 2YFHA 1YI2B 4L08A 2BFOA 5T8KA 4TWJA 1YB2A 2CXPA 1U2SA 4Z4ZA 5TLSA 3N5CA 4HEA6 5FUXA 2B9VA 4AG3A 3GRRA 1SKBA 3OUZA 1C0PA 2XUJA 3VPDA 2ERYA 1NURA 4RV5A 5E6SB 5BQPA 2Z9CA 1P1JA 5BSMA 4UEWA 3QVLA 4YRRA 4N3BA 2CMFA 1RCTE 2PA0A 4PAQA 5HBRA 2A58A 4XR6A 2H2WA 2UV8A 3STWA 5HF8A 4A7PA 4ZHSA 2IOFA 1DKUA 3B1VA 4XOPA 1E79A 3MD9A 4NCHA 3UK1A 3WLTA 2A0WA 1U0HC 2KLBA 4KBFA 3GP8A 2H4YA 1VJGA 2JH3A 3D7LA 2CW5A 1ZOPA 3LPNA 5T6MA 4BLOA 2ZYTX 3HE3A 2HT1A 4NYIQ 1WV0A 2BFNA 2C9CA 4X1KB 5JS8A 1DDOA 4JZYA 2V4UA 1FS4A 3A14A 3IDAA 3OD1A 1XN1A 2G08A 3H9CA 3KBOA 4AS3A 1KDRA 3BCDA 1II9A 1T0BA 2ZFUA 4RWZA 9MHTA 2IGBA 5CX4A 2RCNA 4QDUA 5H82A 1H9AA 3U7JA 4AJEA 2SKDA 2ZE5A 4HRYA 2O7QA 4YJ3A 1IZ7A 1OTYA 5H3LA 1YBFA 3OHMA 3T4PA 4JJFA 1VE5A 2PK3A 2PGDA 4R3UC 1YDGA 3CCMB 1W52X 3L0ZA 3Q5GA 4XDHA 1Q81D 5IW8A 2C04A 3UMMA 2X23A 4M1TA 8ATCA 1C1XA 4DB2A 3TD6A 3LC2O 1Y9JA 2VH1A 2X7XA 2ZJ1A 4I9HA 4PZDA 2DSNA 1UBFA 3SF8A 4HNUA 4P0QB 4PLYA 5F3DA 5KMGB 1U9CA 3K4QA 1D2RA 4HC4A 1G2QA 4WX2B 1SK8A 2PJDA 4UBJA 5D85A 3WIEA 3IUNA 3WQQA 3ETEA 1H1LA 4C0SA 2JRCA 2O0JA 5FAKA 5LP6C 4F04A 1E18A 2G72A 4CF5A 2XF8A 2C4NA 1GUZA 3CEPB 4CMCA 1R0SA 2ZI3A 1W4CA 2JGMA 3FTNA 3OUTA 4JUFA 2QJFA 2W6MA 1EMDA 3F9CA 4YEJA 3UJ9A 3VJLA 621PA 2COEA 4BNUA 3DULA 4W5TA 1Y4DE 2AVNA 3SSMA 3L7OA 3VISA 2HK6A 4RH1A 3KQPA 5LSAA 2ZW9A 3EXEB 2ZBDA 1G16A 4KCGA 1QSGA 5CXUA 2EP7A 5JC8A 1CZOA 2OY0A 3WLHA 2I91A 3GFVA 5EIFA 1KVUA 1Q0PA 3ROEA 3TQIA 3OP4A 3E5HA 4DLRA 5IYQA 1ZVMA 2Q6OA 2FG7C 2A5JA 3K15A 2OBRA 3AUTA 4QDTA 4ZI5A 4A0QA 1RLOA 1GPBA 1NR1A 1NZDA 2ETVA 1AN0A 1IXRC 3OCJA 3KZOA 5G0WA 5A7FA 4K6MA 2XUHA 5G1PA 3O93A 1X9GA 1V9CA 4NNJA 4KQKA 4ZGNB 2IP4A 4RPJA 4F4UA 1RFGE 3DUFA 1G21E 2NO7A 3ND5A 1NU8A 1SVMA 2XR1A 1QGED 3OJCA 1NG9A 2YVLA 3G7SA 5I3CA 3G9UA 4X61A 3WMRA 4S1NA 3P2YA 3CTAA 1DTEA 1W9HA 2VF5X 4HAXA 4FFVA 3R75A 3FAKA 5AM1A 1ZH6A 4ESHA 2W42A 1GU7A 4B1FA 5JHGB 2OQVA 4QNNA 4QKQA 2ZPUA 2O1WA 3DLAA 4YR9A 1PD0A 1RI1A 3HJNA 6REQB 1J09A 4AY6A 3LG2A 3OA0A 4FGKA 3OOEA 3BQMB 4ROXA 3LQ6A 3HUFA 3OWOA 5FTKA 2XAUA 1FU8A 3KQVA 5JY6A 2CDRA 4LPSA 5K0FA 3CLSC 3A0UA 3LHSA 4KKVA 2ZUSA 2GQ0A 4IDPA 1Q86D 4LZOA 1M9NA 3CRNA 4NYJR 5E0KB 5EEHA 2HQSA 3GJ6A 1TAUA 2QD1A 3O2QB 2PRYA 5AW3A 1C8BA 1JVSA 2ZXFA 1ZX1A 4Y9RA 3G9XA 4OAPA 2ORIA 5AIBA 3OZTA 1GCUA 4QARA 1BXGB 4GBJA 3HU1A 4MITA 4QDXA 4CV0A 4PSKA 1AGNA 5JALA 3ZDDA 1GPKA 1W29A 3DJFA 3CO5A 3SJBA 2HIAA 2QMHA 2XNJA 1KFEB 3AI3A 4TYMA 4U0JA 5EHGA 5TT1A 3RAGA 4YELA 1PZMA 3MUFA 4M1WA 5HSGA 4IRXA 3C3MA 4I4TB 5BYBA 3UB3A 4DMFA 1RHKA 1M0SA 2B34A 3S1AA 5JBIA 4XGQA 4IIGA 4M1SA 5CHEA 3CCVB 2BD0A 4P08A 1TEZA 4O0MA 5FQOA 1IK4A 3PHGA 4HEJA 4ACAA 4LTMA 4TKMA 4GL2A 1UWCA 3A7EA 4P34A 2QVGA 1W5TA 4QICA 1WUIS 2ZROA 2R8PA 1EM6A 1JE1A 1WBDA 2QUHA 3L0CA 1K88A 3H8VA 4D7AA 4JLDA 4WUVA 2ZTLA 5DYTA 2Z83A 4EBFA 3EPJA 4TXNA 1L1RA 1QYWA 4G37A 4QUHA 5K4AA 1IXZA 2P4EA 3H16A 3QKTA 4G1VA 2AFIA 3TEFA 4EEKA 3U39A 3RW9A 3CP2A 1DG3A 2B2CA 2DBQA 4CEJA 1Y1RA 1MOZA 2W6ID 4HXYA 3ZWWA 3VHRA 4ER6A 4F2PA 4QEKA 5HX7A 4OB8A 4CTKA 4AXXA 1RHUA 1EA7A 1LK0A 3VC7A 4JMLA 2YWFA 1UQRA 4KLZA 2BHNA 2QL7A 5BUCA 1A9PA 4BAZA 2CFOA 4KQXA 3T3PB 2BW0A 2D5CA 3ET4A 1I9CA 3QM1A 4IDCA 2WM2A 1RYFA 4GC9A 1CF9A 1BE6A 4LZAA 4TMFA 3RU3A 2GA8A 2YZKA 5LFAA 4BQFA 3TGPA 3CSUA 4WIAA 1MB3A 5DWQA 2X9QA 1JPVA 3H2IA 2AQIA 3RO7A 3IIEA 4JNKA 1II0A 2ZAYA 4KNVA 4KW7A 3ZWOA 2X0KA 3A10A 4N40A 3ZW8A 4EPTA 3PNQA 1KI8A 2DTXA 3EGIA 3ZJ5A 1YJXA 3B3QA 3D64A 4L57A 3QKWA 3MM4A 4HWTA 4IIYA 1RWVA 2VK2A 5LQJA 1JHUA 3ZNQA 4BLVA 3ANXA 5KHAA 3MT9A 4EZIA 1J5EB 2BVNA 1NFQA 1XOIA 2QM7A 3QPVA 4XUGB 5J2UA 3EF1A 4MDHA 4B6JA 1XC7A 2EW2A 1EHYA 3LI2A 3ZZNA 1CSEE 1HE8B 3I2KA 4BO7A 4NYMQ 5JYCA 4KDRA 1D2GA 3OZBA 1SPXA 1OYYA 2FRDC 3OZVA 2FN8A 5SYAA 4E5YA 3ICWA 3L05A 3FPHA 5M2QA 3UCXA 1DO8A 1H94A 1T3HA 4D3XA 4GICA 3EWNA 4U2BA 4RHCA 2PX4A 1UPAA 2V3WA 3FKQA 4AO8A 1EFPB 1U7TA 1XZPA 4DLYA 1IPFA 1VLYA 1TXGA 1XPOA 1U1GA 3I72A 5I45A 1I4LD 1CXZA 1I1NA 2QMQA 3H3FA 3PFFA 4DNTB 4BN0A 4DGQA 1E3WA 3T9CA 1KWGA 3DQZA 1VGVA 4MVXA 3ONYA 4CDNA 3OMXA 3V7YA 3GQBA 1RM5A 2RAPA 2ZJ2A 4V3BA 2CXSA 1CZHA 1QGUA 3EEYA 1NXOA 3M9XA 4G5OA 4Z0PA 3FF4A 4AG6A 3R7FA 3UY4A 2PZLA 1KFJB 5A2QA 3VKFA 5L6MB 3LQYA 1XP8A 3BOSA 4ID3A 1S4MA 1TVMA 2AZTA 1K2WA 1QHXA 1WJGA 3BL6A 4AQDA 1W2GA 4DRXB 4IXTA 4R8LA 4OHOA 4A0RA 1WXDA 1BQ3A 2VYVD 2APJA 3KYDB 2HC9A 1Y4ZA 3EGWA 5E7MA 2RGEA 3EW7A 1HYBA 4MP3A 4RDKA 1JJAA 1RHRA 2WVHA 4Q5IA 4WKOA 4ALMA 5LQCA 1W36D 2GRUA 1N2EA 3S27A 3VU9B 2WKQA 1E1LA 2RHLA 3DBRB 3O2NA 1TQHA 1NRWA 3DNPA 3U13A 1YMQA 3FOFC 4ZJPA 4OOXA 4N0DA 3BEDA 2ZZNA 2Q2QA 4CKCB 3QVUA 1SELA 2IZ7A 4FNMA 1WSDA 3D8HA 1GZ3A 3KK0A 4MIYA 5LIPA 3ER9A 1PG2A 4ZREA 4H3KB 3ICQB 2P4HX 1GPAA 5COBA 4ADSG 3ZWMA 1DC3A 1FXWF 1T9ZA 3C85A 2D5BA 4GUAA 1N5OX 5CCBA 2HRRA 2YV4A 1PV4A 2ZXIA 4LHEA 1I80A 1Y7TA 2ECPA 4QUGA 2FFHA 2GAFA 2GF2A 4LBWA 5BVHA 2BKVA 3AHEA 4F0JA 1ZI8A 3HFSA 2GI4A 1JQAA 2WVAA 3RVLA 1DAPA 1WVIA 2ACKA 4X94A 3D6FA 1Y6FA 4QRHA 5EMJA 3KZNA 2XF2A 1OXUA 1E7MA 4G0PA 2QX9A 2VNJA 4R9VA 2B94A 3NCTA 3T94A 5G0VA 3TGWA 3TL6A 1L5HB 5ABPA 1XDGA 4XR4A 2QLBA 4TV9A 5LQKA 3CKKA 1US8B 3IOEA 1WX1A 3PUNA 4FEAA 2I3DA 5BWOA 2GS9A 3IPRA 3QEOA 4H0CA 1KYWA 3H65A 2ZGVA 3KWJA 4K88A 5BV1A 5CFOA 4X90A 1Q2UA 1VQ9B 3TAHA 4DDHA 1ZBDA 1U8YA 4WJZA 1KDVA 1HR0B 2ID9A 3TI9A 1OBOA 2D3LA 1N8RD 1HZZC 4IOJA 2GPSA 4C7OA 1BIFA 1J00A 1ENPA 2EAUA 2FUG1 4ENRA 3K8ZA 4QXPA 5T8KC 1YI1A 4LECA 4WOCA 2AN1A 2C0CA 3EPRA 4BJ1A 2Q3MA 4JP2A 2EHJA 4BNLA 3RB8A 4C7BA 3BKWA 4UMFA 6ADHA 1CR0A 1HG1A 2JFNA 4Z4SA 4M7PA 4O25A 1MIOA 2CZQA 3OLCX 2HSWA 4GW3A 1T5DX 5FLYA 2P9HA 3WGHA 4IIXA 3D43A 1HDXA 4BNJA 2R6FA 2WOJA 3PYMA 5JNUA 4MR9A 3NU1A 2QUZA 4LXQA 1R4MA 3UTCA 2IIBA 4OQPA 3BSSA 4KH0A 4OLJA 1JAYA 3GUUA 2OP0A 4WBXC 1JR2A 2VUUA 3M4XA 3SQNA 5IT9A 3AUFA 3STVA 4KKUA 1QOQB 3AHFA 4G9EA 3OM9A 4DXDA 3KOZA 4O2BA 3JD2A 3QG5A 4YV1A 2JHPA 4YCBA 2OG1A 2JCXA 4MINA 4MTCA 4ZQCB 5ALNA 4JB2A 4TYPA 1OZFA 3T7IA 1BH6A 4DXHA 3A9WA 4J03A 1XQBA 2VJYA 2W90A 2YX1A 1SKUA 2IH4A 3KV1A 2GREA 1R6BX 3DWEX 2OLJA 4JENA 1NSTA 1Y9ZA 1Y1SA 3TI7A 2BI8A 4AQYB 3BSWA 3W2TA 3DEIA 4PW0A 2JZCA 1M0TA 1F4VA 3R6LA 1UAAA 5DP1A 4K9PA 1PZNA 2P79A 2YBDA 2NU9A 2PKEA 3BWDD 4KUEA 1WW3A 3B1YA 5P21A 1DZ3A 4BJHB 1UD4A 2E4AA 5AESA 2FF7A 2GDJA 4FHDA 1K3TA 1NLFA 1TUBA 4GXQA 2G8NA 2RIRA 1NQOA 3O84A 3OVMA 4LXHA 3R6GA 2ONKA 4LXYA 5DGXA 3C3DA 2GZ2A 2YHIA 3QBJA 1U63A 5JSQA 1QQTA 4RVGA 5J5AA 1LQUA 2QUIA 3P9CA 4TZTA 1Z3CA 1USWA 3EEBA 3DYVA 1BVUA 2J09A 1EKXA 2JD0A 2WJZB 1Z08A 4E1VA 1PJ6A 3JWJA 3BJRA 3CHYA 1D1TA 1VCMA 1K0FA 1L5MA 2ATIA 3AFIA 2R6JA 5CLGA 2DHCA 5T3YA 3S4YA 1O97C 1V95A 4F9EA 1L7EA 1PW5A 1USVA 3EVBA 4OUKX 4DAOA 4BO0A 3T6KA 1GPNA 3GJ3A 4D9NA 5F2NA 2V0NA 1G8KA 3A4TA 4ZV7A 1ELOA 1PGNA 3IP3A 3UA4A 4YTEA 2QRGA 1XCLA 1XJ5A 2BFBB 3T5PA 2EWVA 2HPAA 3Q9UA 4FLEA 2OQ2A 4ML3A 4WY2A 5I7WA 3GFPA 5ALWA 1DAOA 4EARA 3HN7A 1ORRA 4ZQHA 4BCBA 2ZE6A 5HZAA 1WPRA 3LD9A 4RYLA 2A7QA 1T9GS 2R68A 2HAEA 2WIGA 3OD5A 4MH0R 1J25A 3IQFA 1IN5A 4BMZA 3IL2A 2AZ4A 3LKZA 5ALFA 1KEWA 4YXWA 3PD1A 4IZIA 4P98A 2CL0X 4G1CA 4UDNA 5GWXA 2IA5A 4R6XA 5JATA 2JG3A 4Q1EA 1OASA 3GEDA 4L85A 5ESDA 4PS0A 3KYJB 4TL6A 3RYTC 3PCTA 4J6FA 4Q9KA 4OSOA 3TD2A 4RVOA 5CB8A 3L8MA 5L51A 2AOUB 2A88A 4BC0A 3K6JA 3SC3A 5JD6A 5TQJA 1DRJA 1JR3D 4PNEA 5JMPA 4CIYA 2FP4A 1L8LA 3U4IA 4PSUA 3PVZA 3W3AH 3WIUA 1MQAA 2ZRQA 4JWTA 2Q3JA 5EXPA 4WADA 1EDBA 3SZ3A 3QUTA 3P9QA 4IMPA 3BK1A 4RVSA 2AOWA 3CUUA 1UZNA 2H1SA 4IF4A 3Q6QA 4IIHA 4CMHA 1XJ0A 1DEOA 3WWZA 1N2CA 3VAAA 2H52A 5TGTA 1HDRA 1HT2E 5F33A 5FPHA 1YDFA 2DWPA 5HMLA 5HRAA 1WU8A 2BMAA 3VHLB 4LRYA 3FNEA 2BZGA 3O03A 5JFOA 4M0DA 3Q39A 4FI3C 4K26A 3IUSA 2NO4A 3L6OO 4TVBA 4BO1A 4FYHA 3VVBA 1MC4A 3QEAZ 2REXB 4B6PA 1OLSA 4A0GA 4HQOA 4U7PB 5CCEA 1KWKA 2JJ1D 3WGQA 3K0CA 2RI1A 3I8SA 1AUOA 2HK8A 2GO1A 2XDQA 2I4LA 3CINA 1M3SA 3R4VA 4UDYX 3GLFB 1V8BA 5C32A 2IPLA 3OICA 3QOWA 1GXSA 2V03A 3GA5A 1BWPA 1DAEA 4FFMA 1U8FO 3LT5A 3SEFA 1YU9A 4J1NA 3FUVA 1ADYA 4D80A 4DBLE 3A6HA 2WKWA 4KBGA 3A2MA 4I4IA 4P80A 2D06A 4DBLC 4XJXA 4REQA 2AC4A 1FSGA 5DT2A 4TUYB 5TE9A 4UQPA 2XQGA 2IUFA 4DMUB 2BGGA 2ABWA 4PLPA 2RHMA 2OPHA 4YXFA 3KOOA 4N48A 1ZM9A 1HE4A 1NBWB 3AF2A 2M1XA 2R8OA 2AFIE 4PBRA 4BLPA 1NONA 2XTAA 5BR1A 1KXJA 5WRFA 2BTQB 5J2TB 4G65A 4ZAWA 4D4JA 1W88B 1DEHA 4G1MB 3GPLA 2EKZA 4F84A 2CJWA 5I8PA 2VP0A 3GGPA 4OQZA 2Q8PA 3KLBA 4PLWA 4XR9A 4C7VA 3CTMA 3EOAI 5EHIA 1YQUA 4TLBA 1JTEA 3UTDA 2IVFA 1VLVA 4UTXA 3BA1A 2QBYB 4UQLA 2HJRA 2QPOA 1YZQA 1VI6A 2D5LA 2ZJYA 3B2QA 4HDNB 1QBGA 1IXSB 2NVWA 4UTOA 3QMPA 3ZHUA 2HQBA 3QPDA 4D6YA 4V03A 1QHSA 1A7AA 4PAOA 3FRIA 5JSFA 1NQXA 4DSAA 2FG6C 5JVDA 4YJHA 4C3UA 3EGCA 1R4NA 1N75A 3KJHA 2ZBVA 2I7DA 3DBOB 4QUKA 1EFRD 1VLHA 1XFOA 1E1CA 5DTIA 3L8GA 4NFYA 5CBKA 4AWAA 3A31A 4N8SA 1KQFA 1R9JA 4RV4A 3GBSA 3OFKA 3TZQA 4JA0A 3II6X 1JMKC 4X7CA 2QTVA 4IIBA 4YAWA 1NUSA 1GKUB 1YAHA 2HDOA 2YFKA 4B75A 5CDGA 3DPSA 1ISHA 3X1XA 1U3FA 3K1YA 1N1DA 4L07A 5K3EA 1M83A 1QVAA 4H7PA 1J39A 3GEEA 4K28A 5IYRA 4Q7KA 3A1VA 1QPBA 2BN4A 4M54A 4EI7A 4XQCA 1XVTA 1EVJA 1T25A 5EMKA 3DONA 2ZWMA 2TRSB 4O63O 3EFOA 4LQCA 5CXXA 5REQA 3OIUA 3OWXA 1M33A 3O8CA 2XOXA 3CXCB 1L4UA 3OCCA 4L8LA 2N47A 4PANA 1GRNA 2Q3LA 5KBYA 1U3UA 5FNVA 3AR7A 3WMXA 2YN0A 3O90A 3M6FA 4URWR 1UBMS 3A04A 4JOQA 4B2YA 1WWKA 5KNCD 1OI4A 3E3NA 4MVJF 1WULS 2CWDA 4FT4A 1EFHA 2GJ8A 4O8ZA 3ETLA 4Y6LA 4AK9A 3OOHA 1DDGA 5HA5A 1QP4A 2OL4A 4Q0MA 1WMDA 3HXQA 2VRBA 2J67A 5DGDA 3ZJYA 2C42A 4R1OA 1U7UA 2JAWA 4F2GA 3GRFA 5IHPA 1R4ZA 3OJXA 5AVTA 2OGSA 4WDRA 1UD6A 1M8PA 3NTUA 1W1UA 1GRRA 4NEGA 3I6ZA 4QGBA 1OJLA 1WZUA 1OB0A 1M5TA 1A2QA 1NU6A 3EDRA 4FR5A 4MR7B 1DQRA 4K05A 4YT4A 4QFDA 3W5DA 4KHPB 1VQNB 2H9AA 3W79A 2X4IA 5AKYA 1Z2AA 4XD7D 4YP6A 2Q46A 3T9EA 3VRHA 2VSQA 3U0BA 1ZRHA 3H11B 3I3OA 2HWUA 4MV0A 1QRDA 4LJ9A 4WLFA 5TARA 2C3OA 4KR2A 1T2AA 2LDBA 2JCBA 3A9UA 1SA0A 5KYYA 4FYKA 2WINI 4OBBA 4ZU3A 3FMIA 4YRJA 3HCBA 4PPFA 1JMVA 4DR7B 2WTEA 1Q0SA 1MEOA 1Z37A 2GFIA 3GLKA 1JIJA 2WFMA 1NZFA 1SBYA 2PPVA 1CD5A 1W85A 1GA1A 1MB0A 2J9XB 4HQNA 3TBKA 2W2QA 2WSSA 3H9GA 2ZRCA 3F7TA 3K2BA 1JXAA 4OM7A 1SCJA 1X7XB 3JTEA 4CKBB 1Q6YA 1SOUA 4FN5A 3PUHA 3HBAA 1JG3A 2G07A 4YP0A 1EWVA 2DQYA 3IQEA 1ZISA 4GGOA 5JXGA 2WQ6A 4TKUB 1HG0A 3TTXA 2VDMB 2OGWA 3REFA 3ZWXA 4ZTZB 2ZJOA 3PWTA 1FXUA 4YT2A 4C5BA 2Q3DA 5KYGA 2YNMC 4ARZB 5FWDA 4C3OB 1H1TA 3OSUA 2WAAA 1DEAA 3M1IA 1J0DA 4TMVA 1Q11A 1Q7TA 2EJVA 2I62A 3EISA 3MWDA 1ZPDA 5FWXB 5E2AA 3WGOA 4ZKDA 3ODPA 4LYAA 4NEQA 1SUIA 2UXDB 2W6NA 8OHMA 1QV9A 3EQ6A 4GKJB 2HZ7A 4M3NA 4DA7A 1ZDMA 5CGZA 3KVNA 1E2GA 3EGEA 3R0IA 1JLMA 3WWYA 2ECKA 1W4LA 1TMOA 3MJDA 1U6JA 5B2ZA 4A1FA 2CY0A 3PNMA 3F4KA 4WACA 5CJ2A 1NNEA 4HFJA 4C7XA 3A3GA 3GVXA 1JX6A 4ZAFA 4CLOB 2OHOA 4YLYA 1GY8A 4GXRA 1WOOA 3Q98A 4FCCA 5I9LA 1FP6A 1KS9A 1R0BA 1FC0A 1PL8A 2I3BA 2NU8B 1R6VA 1