1E64A

Ferredoxin:nadp+ reductase mutant with lys 75 replaced by gln (k75q)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEQLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Interactions for Complex Formation between Ferredoxin-Nadp+ Reductase and its Protein Partners.
pubmed doi rcsb
source organism Nostoc sp. pcc 7119
molecule tags Oxidoreductase
molecule keywords FERREDOXIN-NADP+ REDUCTASE
total genus 86
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2000-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1e64A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1e64A02
5TV2A 3CCQB 2HDNB 3W2FA 2EIXA 4B47A 3CMAB 1YJ9B 1S72B 3VNUA 3QFTA 4RD1A 1W2BB 1W87A 5H59A 1Q7YD 4G1VA 4PGOA 4RD4A 2RC6A 1FRNA 1E62A 3I1FA 4YALA 1QH0A 4M1KA 4B3XA 3W5UA 3CCUB 1KD1D 1AIPA 3W5HA 4ACBA 4HE5A 2XEXA 1CQXA 4TMZA 1FNCA 2BGJA 1EP2B 3LRXA 1DARA 1M1KD 2HCJB 3B8HA 3FPKA 4QFMA 1QGAA 2B5OA 3ZZTA 4K1XA 5GV8A 4LBYA 3W5VA 4PC6A 2VNHA 3CCEB 4PC3A 1G7CA 5JBQA 1YITB 3A1FA 3WY9A 1KK2A 3E20A 1VQ4B 3ES9A 1DDIA 3CXCB 4YAUA 4R71A 1VQ9B 1QGZA 3U2QA 1H85A 2EFGA 4B4DA 1ZM3A 4FK8A 3AGQA 2E1RA 3OJWA 2R6HA 1GVHA 4M4SA 4TMTA 5GV7A 1FNDA 1JNYA 3QSYA 2QTZA 3OJXA 5TR9A 2BSAA 1ZUNB 2FX3A 1ZM4A 4FWTA 1N0VC 2XNCA 1S0UA 3WBJA 2QMUA 3AVUA 1E63A 4YAOA 3FJOA 4ZV4A 3CMEB 3CCRB 3WYAA 2B7BA 2PLFA 2D74A 1OB2A 3ZZ0A 3CC4B 1VQ6B 4PC1A 4YAWA 4TMVA 1D1NA 3U6BA 2QEXB 1K8AD 4LBVA 2BN4A 2YWEA 3ZBUA 3AVVA 1B23P 3CD6B 1SKQA 2QDXA 1B2RA 1TLLA 3W2IA 4RD0A 1KC8D 1QFYA 2C78A 4MYUA 1GAQA 4IW3B 2BV3A 1EP1B 1Q81D 1QFZA 1JJ2B 2DCUA 1JB9A 1FNBA 1ZM2A 4Y7CA 4ZCLA 3W2EA 3J81k 1K9MD 1QUFA 4G5GA 4Y9RA 1VQOB 3I55B 1BX1A 1AMOA 3CB4A 1KRHA 2DY1A 2QA4B 3OZUA 1GJRA 1BJKA 4AC9A 1KK1A 1D8TA 2AHOA 4AF7A 1VQ7B 3MMPA 4PC7A 2YWFA 1GR1A 1D2EA 3U6KA 2J7KA 1VQMB 1FRQA 4N3GA 1HA3A 2RC5A 4ZCIA 4NBSA 1F20A 5EMNA 1G7RA 2OTJB 3CCLB 4Q7JB 2PIAA 3CCJB 1N8RD 3AVYA 4ZCMA 1KK0A 3W2HA 1IJEA 2BPOA 1M90D 2OK7A 4ZGNB 1CNEA 1Q86D 2C77A 4LC0A 1Q82D 1KTVA 3G71B 4F7DA 5FA6A 4C0SA 3SJZA 2HMAA 4B44A 3CCMB 2VNIA 2VYQA 3WBKA 1XE1A 2VNKA 4P3YA 4RJLA 1FDRA 4RCYA 3WNCA 4U9UA 2BVNA 1E64A 4C43A 4G1BA 1JA1A 1SM4A 1EXMA 1DG1G 3QFCA 4FN5A 1NJID 3CCSB 3ZZUA 3VMFA 4DQKA 1W35A 2OTLB 3JQQA 5H5JA 2YWHA 2GPJA 1WDTA 2BMWA 3WNBA 5AN9A 4ZGQB 1R5BA 4B43A 2BF4A 1QFJA 2DEUA 4UAJA 3VO1A 1ELOA 4BPRA 4AF6A 3VNVA 4NCNA 1QX4A 3I56B 1FNMA 3ZBTA 2XNJA 3CCVB 1QVFB 4B48A 3CW2A 2GQFA 3CC2B 1QG0A 5HXBA 1G7SA 1VQKB 3LO8A 1YJWB 2DERA 2CNDA 1VQPB 3MHPA 1VQNB 4QHYA 3CPWB 1OGIA 2CRVA 1GO2A 3E1YE 1VQ5B 1KK3A 1J9ZA 1QVGB 3VO2A 1K73D 4ACAA 1H42A 1OB5A 1W34A 3OZVA 1TUIA 1OGJA 5DSZA 1TVCA 1U2RA 1YHQB 2BM1A 4EH1A 1VQLB 4N3NA 2QTLA 1R5OA 3AVWA 2VNJA 3B82A 1JA0A 4RD6A 1CNFA 2B7CA 3OZWA 3CRZA 2NPFA 3V76A 1R5NA 1UMKA 1QUEA 1KQSB 3LVBA 5THXA 1F60A 4J0QA 1QGYA 1I7PA 3P26A 3OW2B 3MCAA 2VZLA 1DDGA 1G7TA 3JQRA 4HE6A 4TN1A 5TY0A 1YIJB 2X3UA 1YI2B 4LBZA 3G6EB 3PENA 1VQ8B 3JQPA 4WQMA 1EFTA 4TMWA 2DETA 1A8PA 2BM0A 2OK8A 3B78A 3AGPA 4YAFA 1GAWA 1EFCA 4H9GA 5KSWB 4DQLA 1EFUA 1IJFA 3QE2A 4P6VF 3WNDA 3AVTA 2PMDA 2QN6A 3WXMA 4LBWA 3AVXA 1YJNB 1XB2A 3QFSA 4YHBA 4RD2A 3P27A 4RD3A 1BQEA 4RCZA 1IB0A 3QFRA 3ZC3A 3CC7B 1KJZA 3W2GA 1EP3B 1EWYA 4Y9UA 4MYTA 2BGIA 4M53A 2YWGA 1BX0A 1ZM9A 4M2LA 3G4SB 1N0UA 4PC2A 2ZITA 1TTTA 4TMXA 3LYUA 1NDHA 4M0LA
chains in the Genus database with same CATH superfamily
3SQXA 3ZWAA 2V9ZA 3P20A 2A7XA 4IO1A 3D6AA 4IIHA 2C96A 4I9NA 4XPZA 4NESA 1D2RA 2JI8A 1QZUA 4GPIB 1BKSB 4DA4A 1NF8A 3WWOA 2FWPA 4NQZA 3NBAA 4N8DA 4X63A 5JNTA 1R0XA 2UDPA 3G5AA 5LMUB 2B25A 3HN6A 2PT9A 1F48A 1XRRA 3AEUA 2GAJA 2XYPA 3P4XA 5D00A 1M2OA 4ER3A 3AERB 4GXQA 4WK4B 1YQGA 2MHCA 3FLAA 3W5IA 4G85A 3ZQKA 1OXTA 3NANA 4URFA 4PZUA 4QRIA 1ZMRA 4KQKA 4IICA 4M1WA 4JYPA 4PO3X 4R0VA 2HR1A 2BY4A 4J3NA 2IXFA 1H8EA 1P1BA 4EA9A 4CF5A 1K06A 1PT7A 4YDRA 3ER9A 3BHMA 1H23A 2VAMA 4B9EA 2OCLA 1NQVA 4O4HB 4JLKA 3DMTA 1U2DA 4OB7A 1Z5PA 3CZQA 1XTJA 3M9XA 3K6KA 4QHSA 3TLCA 2SKDA 3EY9A 3R6WA 2YJ3A 3FWKA 1K63A 2XEXA 4EI9A 1G4AE 4LOHA 1OH7A 4AZ0B 3E5RA 4G09A 1IHMA 2VHTA 4RKYA 3SQMA 4W7SA 5EVCA 1HDEA 3ABOB 4TLCA 1AUQA 1OHHD 4FYPA 3ABZA 5A71A 1KSFX 1P9RA 2P30A 3L8HA 1L5YA 4OFWA 5IC5A 1T13A 3ZQ4A 4WBNF 4BP9A 5KWJA 3QLJA 1FJ2A 1Y0BA 4HQOA 3WGTA 2IELA 1NUUA 2RDMA 3E15A 1V96A 4FFOA 1GPLA 2FXVA 2WAXA 5GM1A 5KVQA 3IP7A 3MMSA 3N2EA 4HH3C 1NLFA 2OV8A 4MUAA 1UJ4A 1JT2A 1A7JA 1VHQA 3NBXX 3ONNA 2XDWA 4IS2A 4RZ2A 4GYWA 3RC9A 5B58C 3UICA 1H2ZA 3I2JA 5CFQA 3OJLA 1G21B 3EAFA 2IBMA 2RE8A 1HNWB 1T10A 1VIDA 1VI6A 2UZAA 2ZCUA 8ABPA 3V1YA 2YFHA 3DNFA 1GZUA 3A1DA 4CKYA 1W73A 1S8AA 2CLSA 3UGQA 2WB4A 1JHVA 1JHUA 3OCVA 1BRMA 3LUAA 3QV1A 4XM0A 2N42A 3P5BA 4MINA 4EHFA 4DV0B 1GZHB 3LLUA 4YECA 5KU1A 4ZYZA 2L2QA 4NMMA 4RORA 4R2IA 5HG0A 1GAEO 4ETWA 5J23A 1NLZA 4JUAA 1EESA 3EVAA 1O97C 3S4YA 3IP3A 1KYXA 2UYGA 1QYDA 4NG5A 3UQZA 2C7GA 5BVHA 2A92A 4CXMA 5LQUA 1E0SA 1QOQB 3U4GA 2FJUA 3GFGA 2JGKA 2ZJYA 1VZ3A 3Q3GE 4FPXA 2CBXA 1EA7A 1EDBA 1JVBA 1UT5A 3PR2B 1WIWA 1E9CA 1CY0A 2CLEB 3RVDA 2YWDA 3IPRA 4NCBA 4II2A 4LI0A 1TL7C 3R5SA 2OCGA 3CCRB 1IN8A 5DNCA 3AFGA 2A0KA 1Y33E 1P0FA 2IU4A 3CISA 1KDOA 2D06A 1L5MA 3IIIA 3O1LA 2C9MA 2IEAA 3TLJA 4DSUA 2JLYA 2ATEA 3HABA 5JANA 2NQ2C 3BD7A 5FO1A 4WASA 3HUDA 5J4VA 3NHRA 2LNDA 4HAXA 4F6RA 1YT5A 2XQFA 1ZOSA 3L8CA 1W5SA 2CZGA 2QRNA 3AEKB 3B53X 2V4ZA 2GDJA 3CVOA 3HVKA 3MJTA 4HEHA 4R2LA 5LMCA 2X6TA 3KQLA 1PGPA 4OOVA 4QDJA 1ADBA 3PFKA 4KG7A 4AVYA 1W5TA 4ND2A 5IJ0A 4DQUA 1J0XO 1X7HA 1SKUA 3C3BA 4YFVA 4KXLA 2C61A 4PQGA 2Q28A 1EBFA 4LDAA 2A0FA 4P08A 3UG7A 5BVGA 5K0SA 1G8PA 1MJ5A 4NWIA 2UZ4A 2GR9A 4YMUA 2IE8A 1U3TA 3DWGA 1P4MA 1WVGA 4E5KA 2XLBA 1KOLA 3U39A 3BJEA 4CRWB 1H0SA 4EEKA 4IW3B 1H0KA 1ZI6A 3LSTA 5K3FA 1VIMA 5E3HA 3IOBA 1RHMA 2JIZD 1IK4A 5EIAA 1UDWA 1H2YA 4KVFA 1NV9A 1VPVA 1E7MA 2JB9A 2DUJA 4IHJB 2YR0A 4YJHB 4YMTA 2PZAA 5ALGA 1JXQA 2G67A 3DWFA 1NBEA 3QHPA 3QU5A 2E1BA 4KE9A 2HHHB 1P2GA 4UD2A 3TS1A 4IDCA 5FWYA 5DHAA 4FSDA 2JBAA 1DC8A 4CM8A 2HV8A 3UV3A 1AKMA 2J3KA 3DLBA 4AYWA 4LDQA 1XOIA 1Y80A 2IYPA 2WTAA 2ZUVA 4QPDA 4ZYWA 1P2TA 3FYUC 3JY6A 4P2NA 1TFUA 3G8BA 5KJ1A 2ONJA 1WG8A 2PX5A 1GJRA 4AWAA 4MICA 1MC1A 2AFHB 2WU0A 3NW9A 1F2VA 1T3GA 3JQAB 1NMEA 3QBVA 5BUSA 3HMQA 2FUNB 4HNGA 1DAEA 3L8MA 1WB4A 4R8KA 5FH9A 1E1LA 3D5EA 3DOFA 4WKCA 9ABPA 4X92A 4HGZA 2BRUA 1DKUA 1M1XB 3BB3A 3KLNA 3DR3A 4Y2QA 4D0SA 3GUVA 3Q8LA 2AHRA 1P7ZA 3AV0B 2VQSA 2GREA 2HREA 5JXGA 2QQEA 1A50B 1Q95A 2REOA 4DVGA 1EVZA 3GWGA 2PWBA 5D01A 4ARVA 2PANA 2XE4A 2GEBA 3EDYA 2XGSA 4GSYA 3COPA 4EB3A 5KNCD 1L4UA 4J4BA 4XQCA 7ADHA 5CR9A 2HHCA 1WOPA 1JFTA 4W1QA 4IIBA 3F5DA 1WCXA 4HWOA 4QASA 2JJQA 1P91A 3TK1A 3F71A 5HKOA 1V8BA 4TSKA 4RF4A 4G3XA 4HPWA 3ITEA 4GH5A 4D4IA 3OKXA 2M9MA 5L45A 1KU0A 4A1OA 4E5PA 5ELMA 4DV3B 1ZL2A 1PJ2A 4DREA 2VDNB 4Z9XA 1Y6FA 1J07A 1V1MB 5K6AC 3G71B 4PWZA 2X8BA 3F47A 4NZYA 1T15A 5K03A 9LDBA 1EUCA 1E1QA 1LPSA 2ZI7A 4C2AA 3FB1A 1HETA 3OVMA 5LJLA 5E0OA 4JROA 5LA6B 5JLJA 5JZMA 4B44A 2W6NA 4WBSA 4X90A 3L77A 1VG8A 3EWNA 4JHXA 4DSTA 3N8KA 1DRKA 1SBIA 3CRVA 3IGFA 3M5PA 4BVEA 3A11A 2V96A 3CKLA 5BQ3A 1S3SA 5BT8A 5FEUA 3KCNA 3IELA 2HF2A 2QJOA 3LF2A 3WNCA 4KE7A 4OFZA 4WUTA 1VCNA 3SJ7A 4EABA 3V80A 4ZOQI 1SUCA 4PLFA 5LDHA 2F1JA 1XTSA 1DQNA 2VDJA 4I81A 1GQFA 2XYVA 1QCCA 2HSGA 5LYJA 3E8XA 3JQ7A 4R3UC 1IBSA 3HG7A 3HN2A 1L4EA 3INRA 3OO1A 3TSCA 5K0FA 1SZCA 3IKMB 5TJHA 2C3OA 1JA9A 1L8XA 3KLOA 4FN5A 3EZ7A 4I6EA 1RXUA 1ZOIA 3EVZA 3RPEA 4Z5XA 3K31A 1S8NA 2QTRA 3MWFA 3D8BA 4WZBE 3IMGA 5IYNA 5JNRA 3IE1A 3OZDA 3O7WA 3INTA 3WRYA 1JXAA 1YKGA 4HLNA 2YWHA 2J85A 4P3OA 1M2JA 3P0IA 4WKNA 3MEQA 4GKKB 1PL0A 4KQ2A 3PXAA 1WDTA 2X8JA 4Z3OA 4QDTA 1II8B 4JBHA 4DA9A 1A7KA 2P77A 3C3KA 1ICIA 3PVCA 1I13A 4XPIA 2X76A 4A6EA 3HJBA 3TSYA 3OESA 2CD7A 4ER7A 2UUBB 1KEWA 4BEVA 1MA3A 4LXHA 1IHXA 2PGXA 3IEMA 3AB8A 5KOHB 1GL7A 4UNRA 1Z4IA 3MUOA 1RVV1 3TIIA 2IYOA 4OYRA 3HCEA 5DYTA 2BZ1A 1BDJA 1INLA 1ULTA 4OREX 5DN9A 5GIOE 3E9YA 1UINA 3A3NA 4ER5A 2HNBA 5J47A 4WBNB 1C2TA 4QX6A 5GJWC 3H2SA 2WR8A 2KYRA 2V74B 3AIOA 3DPSA 4HGNA 5JSZA 4Z53A 3WV5A 4ROTA 5BMOA 2A94A 3P9QA 5TT1A 2X5KO 3ZE0B 3CZ4A 2W83A 4IZ6A 1XMVA 4J91A 5H02A 1NN0A 1YSCA 1E89A 1GT91 1G3MA 2G17A 1WUJS 1LY1A 2BE7A 2CYBA 1HKUA 3FA2A 4OSEA 5AI4A 5LBTA 4C14A 4WZTA 4N39A 1MO4A 3AYXB 3L7OA 3PD1A 1H9CA 4TS3A 2RI1A 2BBSA 4P33A 4NFSA 3SP1A 1EXDA 1Z39A 5EQFA 3T9BA 4DEVA 4JX9A 4ARSA 3OQHA 4JVNA 4MHSA 1Q0TA 4F1WA 3H1BA 1PE0A 2ZJFA 3M0EA 5A3VA 2EG9A 3IAS6 3QI7A 4B6OA 1XHLA 1KI2A 1E2BA 1K6EA 1STOA 3M83A 2PRIA 1EFLA 2BHRA 4O4LB 4DUGA 2WD7A 3ZD8A 2F1IA 4R1TA 2F8MA 4H7FA 2OECA 3PE3A 4GZMA 3FUCA 2NU9A 5K4AA 4Q3DA 1RPNA 4CKEA 1WRBA 3EZLA 1GPBA 2RHOA 1LQTA 3KV3O 1XZKA 4D74A 1PR9A 3VSAA 2EQ5A 2NO5A 3PPXA 1DWOA 5AK0A 1OT3A 1R66A 3QV2A 4MRMA 1CZNA 3FRIA 1M34A 4WOJA 4PABA 4IDDA 5AK6A 3RWOA 4OI2A 3RVKA 1XCJA 2N9UA 3DEZA 4FYYA 3SE7A 3VNRA 3OQ1A 2O6LA 3FNGA 2YVAA 3B6EA 2O1XA 2QPLA 3TEJA 1GGMA 1NQAO 4WACA 2LWIA 1OGJA 4MW2A 2G9QA 3UFBA 3FD8A 2VP6A 1RAAA 5BSKA 3U5TA 1WX1A 2QSJA 2MR5A 2XIQA 3ZHOA 3SX0A 3KYDB 3T38A 4I4LA 4RD6A 1G4UR 1SEPA 1YS1X 5EPEA 2IH5A 4MB0A 4PGFA 1ND5A 4Y6GB 4ES6A 4TRRA 4EOGA 2I3GA 2IHVA 2WF5A 4R7GA 1NUTA 1R5NA 5G40A 3R0IA 3CE9A 3L05A 4L8GA 2JH3A 2CUKA 2FRVA 2GD0A 3C1TA 3TF5A 2J9ZB 4GRIA 2YL2A 3CNOA 3I52A 1HO3A 2PGAA 3LPNA 4O8CA 1YI8A 4PGGA 4Q1CA 1HDOA 1H5UA 5DB4A 3FPEA 3PZBA 4DLTA 1P4AA 1ADCA 5ESWA 5IJZA 2B8EA 1CQPA 2GCGA 2W22A 1U9IC 1WPGA 1Y5IA 2ZIZA 2VTVA 4ON9A 5H3CA 3RSGA 1DXYA 3BGIA 4DABA 1DBIA 4R7TA 5GADl 3H97A 1ZC3A 1DX6A 2HLHA 4XRGA 2MSWA 2OUIA 4QWWA 4UHDA 5AXCA 4TKMA 5EJ7A 5DXAA 4QAJA 3M2TA 3TE6A 4D26A 4NC9A 1JPUA 1R6TA 2ZW9A 4ERXA 1A8PA 2WP0A 4EL5A 1GDTA 3KWJA 3ZXIA 4CTOA 4ZGGA 4Y0AA 4DYDA 4MUXA 1F2TB 2O9JA 2HN9A 1TPYA 4LC1A 2QM7A 1GAWA 2VF4X 4K1LA 3LIPA 4FLMA 1ML4A 1VBNA 2VBIA 1XN4A 2PMFA 4V0OA 1UMCB 2AIRA 2C5EA 2NUAB 3CKYA 3SC3A 1MB4A 4Q3NA 3PNKA 5EUQB 2VAXA 2GA9A 4ANFA 1P3Y1 4GAEA 1O03A 4I3GA 4MWBA 4OQQA 5CVCA 3TX2A 4DR4B 1U28C 1XJQA 5FA8A 1FYDA 3GFFA 2EFHB 2PVPA 2ZRHA 3EGCA 5DGHA 1RYEA 1ZJ6A 4JV5B 4AN4A 3TD9A 5C37A 1MABB 1UKVY 3ACBA 4LDZA 3PQFA 2QN9A 1V0EA 2AMFA 3IUJA 2E7ZA 2C2KA 4RD3A 1JS1X 3DBHA 3PR1A 4OMUA 1N77A 3THYB 2H08A 2BGKA 2VRCA 4V0NA 3RB8A 2DTEA 5L7WA 2OQ2A 1KI4A 3L43A 4UFOA 2HPZA 3ZHRA 3JAWA 2VSYA 1RJWA 4US1R 4XW2A 3TUIC 4QTYA 4OAOA 1KAOA 2X6WA 3LH5A 2QLNA 4EQ6B 5D3QA 1PUIA 3FOWA 3VC2A 5IBRA 1NW3A 1KEPA 1E0JA 2ZRDA 2W70A 1V26A 2IYLD 3DFMA 4O2BB 3VVBA 3O84A 2V58A 1SIWA 3QQPA 5EPOA 2NACA 4JOSA 5CIWA 2ZE8A 2FPMA 2HA4A 3GNTA 4I1UA 4CTJA 4FD2A 2CEAA 4C1BA 1IAVA 2ZIAA 4KNVA 4U2FA 1LX6A 1J70A 4FINA 3WWZA 4K9PA 1Z5UA 4JC5A 1U9JA 1GITA 5EY5B 1WBJB 4WXEA 3JVIA 1N6OA 2BGTA 4CKCB 1LSJA 3KKKA 4S24A 3WA7A 3PUNA 3R41A 4DNQA 1C30B 1EK2A 2GJ9A 1I5RA 2GNAA 2P0EA 2ZTLA 4M0DA 5E7JA 1YR2A 3N2KB 3TO5A 5HJ5A 2WIFA 4LE1A 3EFBA 2CL6X 3OZTA 4HRAA 5THKA 3VOBA 4UBIA 5CPFA 1N78A 4J3FA 1AD2A 4WUVA 3TW8A 4C29A 2EIXA 1B93A 1D04A 1YS7A 2F64A 2HCTA 4HAUA 4NMHA 1LC0A 2H17A 2HQSA 2IHNA 1KHHA 3E9DA 1ZGBA 4R3NA 3ZGXA 2QTAA 2EGGA 3EMBA 3N2KA 4UTRA 4UCXA 4FNAA 5I7VA 3BCRA 3IO3A 5IANA 2BTQB 3W06A 3HXQA 1CDEA 1ZM7A 2BMFA 1E3TA 2CHGA 3CX7A 1FFSA 3GFTA 1T2AA 4YV0A 2BM9A 5IYRA 2OC4A 5FUQA 1L5HB 2PA0A 1H0RA 4PSDA 4L15A 1FTQA 3IVRA 2VSFA 3B7GA 1PJ7A 1C4OA 1ZG3A 1W8IA 2EW2A 2FSVC 1RCUA 3HEAA 3QPCA 3BEDA 3R1IA 3HBLA 4R41A 3TIVA 5C32A 3FZNA 4KSYA 4C08A 3S29A 2L69A 3H13A 4BBPA 2ICAA 1C0LA 1RRPA 1P2BA 3VR4A 4FYKA 1NRXA 1JAZA 4LVCA 2X2FA 3KL9A 1DO8A 1VSUA 1Y5LA 2O8DB 4O29A 2OQVA 2WJYA 3DAGA 4CM3A 5EIEA 3OZAA 4XYLA 1ZP6A 3TQQA 3K53A 1C3JA 4LCBA 1NYTA 4EZEA 2R62A 3D81A 2ZG6A 2DUWA 4NXMB 1PK9A 2CNOA 3I6BA 1QO9A 1NE7A 3ICPA 2Q4TA 4LVUA 1Z6TA 3LRXA 1GQYA 4XUEA 4BNGA 3KSZO 2WQZA 1DARA 1ZSNA 2ALJA 4I9GA 4MQ5A 1NVVR 2X5XA 3WQHA 4NMLA 1RIIA 2FSVA 4DCGA 3NI2A 3NWBA 2H0AA 4CQMA 4D7AA 3DBHB 2YFQA 2XZTA 2B5OA 3ZWYA 5IJXA 3FPGA 2WTNA 1P1FA 2IH2A 2YZGA 2A1TS 2ESRA 1KR2A 4H6VA 1OCEA 4BX2A 1G7CA 2VCYA 4WFIA 1EUDA 3W5SA 4FJ1A 1I3NA 1LQUA 2P41A 4X06A 3K8OE 3RVPA 3T3GA 1Z6YA 4G9EA 1TOAA 4R71A 2NUAA 1KYIA 1UBGA 3DUFB 3HS3A 3RJ5A 3ZGVA 1P0MA 2AFRA 5E95A 5B58T 1GPMA 4WGFA 4UUPA 3GZNA 4WOCA 2F3SA 4I36A 2OO7A 4M0KA 5C18A 3Q9NA 1KBZA 5CNMA 4X62B 1ZJZA 4Q3KA 3LU1A 5KX5A 2CFIA 4X7CA 2ZRMA 4CN9A 1DI0A 1R74A 3QBJA 4I1IA 1N8KA 3UUGA 1HE2A 5HF9A 4XJTA 4HUTA 3EPKA 2GN8A 1ZMXA 1VPDA 3IJPA 1WBDA 1XDSA 1HLDA 2XUDA 1BVHA 2WMDA 2EDAA 2IQ5A 3NC4A 4EK9A 2WWGA 2HHLA 5F12A 3KOZA 4ZT4A 4C7XA 5JAOA 4MQFA 1ZITA 5H3LA 1H6AA 3JVEA 1X1BA 1DAMA 2DSTA 1Z0DA 5FBZA 3RS3A 3TMYA 1UKBA 2DPYA 1IZ7A 3RRFA 3GLKA 4IBOA 4JLDA 4P53A 3P0HA 3AF6A 1WVMA 4E07A 2GN2A 3NBZC 2RJ3A 2D74A 2XB2A 3TKLA 1UD6A 4L0DA 4GM4A 5AM1A 3PQEA 1UPXA 3URKA 4ZK6A 2I4LA 2HQ1A 1IOVA 3N2GB 3V1MA 5BNWA 4PC1A 2HX1A 3UV7A 1QK5A 1SCQA 3GLRA 5T6BA 3O75A 1Z15A 5CJPA 3I04A 3RUHA 2HA3A 3JQFC 3ASTA 1JB1A 1UPFA 3ASVA 1V0JA 1I1NA 3OICA 3N75A 3G6WA 4P36A 3OZRA 4GYKA 5J3JA 3EBLA 2ZYAA 4FB5A 4JA0A 4BVHA 5FF9A 1DFGA 3NAMA 4ZVKA 1SKQA 3Q15C 3TDMA 3S68A 1KGDA 2QT0A 4LNUB 4DMKA 5E4YA 1NG1A 5AM5A 3KHUA 4A8JB 3B5IA 2R6R1 4DUPA 1QYXA 3CESA 5EJGA 4ZVOA 3THXA 4B85A 2ERCA 2GHRA 2CV2A 5JJKA 1WF6A 5E9JA 3WLMA 2AXPA 1JSCA 2ADFA 3PCRB 2HK6A 2CV0A 2FSUA 1Q83A 2JIQA 3DO5A 3WGGA 1JLHA 2WA1A 3RFCA 4ENRA 1GZDA 4MYHA 4AG6A 4QUKA 4BTEA 4EG1A 3FCEA 2JAHA 1YZGA 2QRHA 4FYHA 1N5KA 3DBLA 3L6RA 3WHLA 3D43A 2NIPA 1U5BA 3WKEA 1KSJA 2RKWA 1FU8A 2J0UB 3HLKA 3ADDA 1ADJA 2B4QA 3M49A 3EXEA 4EO9A 2BEVA 3LC2O 4D96A 2Z9BA 5ECWA 4IKOA 1SU4A 2MT9A 4W7HA 1MF7A 2PQ0A 1CR4A 1KAQA 1LW7A 3QKRA 3JATB 2FKAA 5EHXA 4UEQA 1DS6A 2G5TA 4G24A 4A8JC 2JPDA 1L7EA 1BFKA 1HURA 4BGVA 3H9UA 2WD8A 4GICA 4N7BA 3I8SA 3MAGA 1FSGA 2Q1WA 3PRKE 2PFGA 3QYAA 2Y1OA 3WSVA 5CAEA 5CD9A 3W1VA 1H22A 2VPIA 2OLEA 5HM6A 4C89A 4QVIA 3I76A 4KR2A 2XGGA 2CKMA 1UKAA 1CTQA 1YGYA 1WOOA 1IATA 2ZETA 3FMOB 1NXQA 1U8TA 3ONYA 1G5HA 2P67A 4YRPA 1G9SA 3KT0A 5DIZA 3STHA 4K5QA 3MTGA 3ASRA 3A3BA 2OFXA 3A6KA 3RYHA 3U13A 2IYRA 1U0NA 1UBUS 2C04A 3LA8A 3RVRA 1OBOA 1C7JA 3ZGOA 3NVDA 1O54A 2GKOA 1BHO1 2J48A 2IXTA 4JR1A 4K28A 2HRZA 4AO8A 3CNEA 2Y9PB 1XQ6A 4ZAFA 4OTZA 5I7WA 2D0OB 1KK1A 1MOPA 1EDDA 3O82A 1NXXA 2F00A 1LX7A 4KGDA 4RGYA 3EY4A 3I39X 2IHYA 1C1DA 1P4RA 3T8YA 3WWEA 3ZQJA 1YIOA 4C6TA 1V71A 5D5QA 1WUHS 4DMGA 2A0YA 2OMEA 3DE1X 3OTOB 1E2QA 1Z5VA 2HBRA 2F1RA 2G71A 2I76A 3DM9B 3K15A 4ZVVA 2BDEA 4LF6B 3RVNA 4DV1B 3MYYA 1OLOA 4FHZA 1DJQA 1V3TA 4HI0E 4AO7A 1Z2DA 3LLVA 1OUMA 3CZ5A 1G7RA 2P9TA 3M6FA 3QVOA 3COSA 3U3OA 1TDJA 3VPGA 1M2GA 4IDOA 2JEYA 2Q8NA 1BXRA 2V59A 3QVWA 5GY7A 2C7VA 3PDWA 3EIHA 3UAWA 3RRYA 5KNDH 2PX4A 1KK0A 2QS9A 1IJEA 1Z6QA 3LE8A 3VSEA 5JYDA 5JZ9A 3EVNA 2DPHA 2W6JA 1W48A 2VYND 3JR7A 1PI3A 1KMQA 1JMVA 1OZAA 2Q6LA 1AZWA 2LXNA 4HDNA 2DTDA 4K9QA 5DWDA 2XJ4A 4IH1A 2ONCA 1ICEA 3AJEA 1C8LA 4ADSG 1NVXQ 4MCIA 3A6GA 2B8TA 3OTQA 4YMSA 4INJA 3GBSA 3OJEA 1Q82D 4Y1GA 2NV2B 2QGNA 4X45A 2QVYX 1YRAA 1MB3A 3JQ7B 3LVFO 2HA0A 1N2ZA 5DCWA 2CNWD 3GCGA 2GN9A 4K8OA 1QV6A 3DT9A 5K09A 2QX7A 2F43B 3R4VA 1JECA 2OCDA 2YIDA 5EAIA 1WQ4A 3H11B 1IRXA 1PSWA 2ACEA 4S0XA 2O8FA 1MJFA 2A30A 2HSJA 3FPHA 3GMDA 4RJLA 1PNQA 4I55F 1UQRA 4MR9B 4OU5A 1JHRA 4FBMA 4D5EA 7ABPA 3K9FC 3FOZA 2VUIB 3K5PA 4PR0A 4OQEA 4C3VA 2JFFA 4WHMA 1PGOA 1ND6A 1KP3A 1VYVA 2DFDA 2VDWB 1HRKA 3CR7A 4X6YA 3VU8A 4HT3B 5C8ZA 1B8OA 2ATCA 4BKUA 3PC3A 4F97A 1PFWA 2A9FA 2J0EA 2TS1A 1TM5E 4EMBA 3IV6A 2UUPA 3DMNA 4WECA 1ZUHA 4W99A 3BZUA 1B4DA 4MLZA 3HUTA 3NBYC 3O8QB 4QBFA 3LVRE 4YWJA 5JMWA 1U8EA 1E2PA 1CRLA 3OZSA 1LRJA 3R09A 5CW2A 5JSKA 2XBUA 3KZ1E 3DTTA 3PC4A 4DJEC 1F8GA 2JD2A 4RADA 2PV0A 5D3KA 4Q9LA 3CRMA 5AKIA 2H92A 4XX1A 3TFOA 5LP6B 5HK8A 3P9SA 1PWXA 2A8YA 4KIFA 1Z5NA 2X0KA 1C0IA 1J33A 2WU8A 3AF3A 3HKBB 3EOBI 2M2IA 5HVNA 4CKBA 3K9WA 1P4JA 4N40A 5CBPA 3GJTA 1X70A 2C4NA 1YOBA 2RBEA 4IFEA 5KTOA 3SZLA 5HUQA 4LFAB 3JSXA 4WNIA 5EZSA 5FQNA 4C76A 3LY8A 1QGUB 1MQAA 3HFSA 1A8UA 3QKTA 1JGTA 1ZD5A 2QENA 3NIWA 2WT4A 3PTZA 5B7PA 1YOVB 1VLYA 4FQ5A 3V7AA 3O8OA 2ODNA 3D2BA 3HCOA 2ZRGA 3QWFA 5BXYA 4MW6A 4RTKA 3BSWA 1QJCA 2W7TA 1C8BA 2G08A 4YELA 3GMSA 3L5OA 3V1LA 1NYQA 4EEXA 3WX0A 4AROA 1HQDA 2GTHA 3KLBA 4G0UA 1Z2OX 3LNNA 1UBFA 3MXTA 3NM5A 4D8YA 4EY7A 5JW6A 2XAAA 4BUZA 3I01M 1EGMB 3SS9X 5BR1A 1V3QE 5KMGA 2XRFA 2YICA 4LY0A 2PRZA 3HEBA 1BPLA 1WDKA 2EJBA 4WK6A 2ZBUA 3IL2A 2PAFA 5IBPA 1QK4A 2FP4A 3HY3A 1KMHA 4DLVA 4MZXA 1RXCA 2W2TA 2CJXA 1VE5A 3UA4A 4AP5A 4JJZA 5AI0A 2NTVA 1EX6A 2ZIWB 1NONA 2WI8A 3IULA 4KTVE 3H6KA 3RNLA 2GJPA 2AG5A 4KDCA 5JH7A 4D25A 3TXXA 2AKAB 2C4VA 4KJZA 4X8OA 4G63A 2JFYA 2L82A 3FUVA 1Q6ZA 5HRUA 1OXKB 3LNCA 3S44A 3OW7A 1J1UA 1B1AA 1T8TA 1TKBA 4HQNA 3B38A 3UJ7A 2IYFA 1PNOA 3GEHA 4IQ4A 4PHGA 2WABA 3OU6A 1XCBA 4K6MA 4PG5A 4C4YA 4KOEC 1CDDA 3ZQUA 1IPEA 1KAHA 5CYGA 1J9ZA 2QP4A 3VO2A 2CCJA 3KO8A 2QRVB 4GP9A 4UBKA 4ZKEA 2BELA 1PJSA 3BXPA 2ZM6B 3P9XA 3IXMA 5K5EA 5ICEA 4JXXA 3RVLA 3U31A 3OCXA 4K3VA 4N3BA 1AHNA 4MTLA 2Q5HA 4UCFA 3FTCA 2QX9A 4E09A 2FWMX 2FR8A 3SEAA 4Q02A 4R83A 2HUPA 1TVCA 4P4SB 1NVFA 4Z49A 1OB0A 3SXJA 2F1LA 2P4HX 2BUAA 2QQFA 4EZIA 4MRNA 2H5IA 5KTMA 3EPLA 1AT1A 2ASVA 2O2DA 4YASA 1Z25A 1VGVA 1O95D 3DOHA 2ZR9A 1A4XA 3TRDA 3MC1A 3V2IA 4BLWA 2WIAA 1EZZA 1IXZA 5FBWB 4OXIA 4DARA 5H4GA 1TJYA 4HYQA 4J6EA 2I80A 2QZJA 2WG1A 2NPFA 3OETA 4QD3A 1RBZA 4QJ5A 4UBOA 3FKSA 3HH8A 3RAEC 3I9OA 4XUDA 1P81A 2HXYA 1RQRA 3KKPA 4G4SO 4YRCA 4J4HA 4B74A 1HTBA 4GMGA 2EF0A 1KEEB 4MGZR 2JASA 3GNQA 3T7AA 2JLBA 3QUCA 1DRJA 4JEMA 1OU4A 3LGSA 3PNSA 3T9FA 3U37A 5M34A 1ZH6A 3E84A 2VYNA 2EXXA 4HB3A 1PYDA 5TVKA 4AJ2A 3RUDA 5C81A 4V02A 1E9SA 1UADA 3MJ4A 4IV5A 3EW7A 3I04M 3KKLA 4QV2A 1LCIA 4RK4A 5CNKA 3H3FA 1F0KA 1BVYF 2FR1A 2D3TA 3BH7A 4MWDA 3ZDBA 1OV4A 3B51X 4OEHA 5F5NA 5A06A 2FFBA 2IOHA 3Q7RA 1G5IA 2BKLA 3OE4A 3DXZA 4P1ZA 4XQ0A 5KOJA 2QQGA 1FSZA 1E1RD 2XRYA 1VQ8B 4V0LA 1EUQA 1EFTA 2GYVA 1UKZA 1MVNA 2C31A 4ZXFA 4TKZA 4C4ZA 4JYAB 4G5YA 2VYVD 4LNAA 5A9SA 1O6GA 5IAEA 2BM0A 7AT1A 2WAYA 5JSFA 1FBTA 1L5RA 4YAFA 1WXEA 2CFOA 2BMAA 2DULA 1NN5A 3BSYA 3EYWA 4GGPA 4OPOA 4BFTA 2CY0A 2HF9A 3L4EA 3ANLA 3W7AA 4BEWA 1Q7EA 1PUJA 1JIJA 3L2OB 1N7IA 2A14A 2LPMA 2JNWA 3AF1A 3EZ6A 2C5GA 4PSKA 3UT5B 3DE4X 5HQTA 1JN0A 5B1HA 1WSWA 3KLMX 4GPEA 4X60A 4HNUA 4RHXA 4IR7A 4QXAA 1PJAA 1XHEA 3Q0IA 3SLKA 4CTKA 3NT2A 1L0BA 4FSXA 1UOEA 2UZ1B 4Q6BA 5CNIA 3VGPA 4JB2A 4KNYA 4LNHA 4N7RA 5JQGF 1WVIA 5JSZB 4X85A 4KAFA 4KIWA 3SSNA 3ASYA 4KLZA 5CPBA 4YV7A 2Z0MA 1XLUA 3S2FA 5TDHA 1KZ4A 1O9BA 3NRCA 3INNA 3RD5A 4F2PA 1YCDA 3U4QA 1YJBA 3GVXA 1U7UA 3CG4A 2QPAA 3T7IA 3ED1A 1U3DA 2NXJA 1WPXA 3AIMA 3NETA 2H4JA 4UAGA 3ZBPA 1WXXA 3LK6A 3ZS9A 3TCKA 4BFVA 1LK0A 4UTZA 2VDPB 3HZOA 1CG6A 3V1KA 4NICA 3P5SA 3B7PA 5D5HA 3HKBA 5H81A 4KFCA 3F4KA 2YXPX 2QTBA 3QEMA 5ALZA 4BUCA 2I9PA 3GLGB 1TMGE 3KQKA 5FUWA 1ISGA 1YRWA 3S5UA 5CD1A 3UJ9A 5F98A 1QGOA 4JYCA 3VZDA 4YBZA 3K1AA 4WNCA 4MRAA 2VUUA 1GLGA 2DBQA 2PKYX 4HIZA 4GZ5A 2Q5LA 4DA0A 2I62A 3DVRX 5LP6C 2XA2A 2B82A 1G20E 3F5MA 3O8QA 3HRHA 4DMHA 1BCRA 1N0UA 4JSTA 4LQLA 2J3DA 3RIMA 4K3UA 4B5LA 4QYTA 3GCZA 4AULA 3T53B 2ZITA 3DAFA 4EY3A 4BV8A 2EZUA 2O52A 4F92B 5C9ZA 3UHJA 3JRNA 1EJBA 3D3NA 3N1UA 3UVEA 4D9KA 3AJDA 4ER0A 3O94A 4PW0A 3BJRA 5K0LA 3TZKA 3SZGA 3K0FB 1Q84A 5MDHA 2DHCA 2XODA 3GW8A 4YT5A 5KYYA 2AXNA 2GZ3A 1E3EA 5FL7D 3DOCA 4M98A 4NOLA 5ELXA 4WWVA 2H1RA 2CL7X 1JQLB 4YHHB 4MKGA 3JALB 2G82A 3CCFA 3AP1A 1A27A 3AR5A 1FYWA 3Q87B 3W5JA 1UJBA 4BNXA 4EA6A 2FWRA 2XECA 3QVKA 4LHEA 1DXHA 5KWSA 4B31A 2OBXA 3DB2A 3FOCA 3SBOA 1BDIA 1Z0UA 2RH5A 3M1IA 3F0TA 5B1EA 2OZPA 3QXHA 1LI5A 4JVLA 4L5BA 2PS0A 1HFWA 3QBTA 4EVRA 2QMZA 3AINA 2BE9A 3DLAA 1C50A 3HV0A 2WP8J 4IXWA 4OJKA 5FBKA 3VUFA 1XMOB 2RC6A 1R3DA 3OIYA 1Y1QA 5E6RA 3UV6A 5JISA 3G68A 1XAHA 3P94A 3W8NA 2Q50A 4E0BA 5HTOA 2OVFA 3FTDA 3MT0A 3KXIA 2ZB7A 3L46A 3K8ZA 2WILA 5ITSA 2C9DA 2DE0X 2V7GA 1K4KA 4QLAA 4XWGA 1W94A 1XI2A 5DBGA 5FWXB 4FILA 2FPIB 4EJSC 3ZBQA 2DH6A 2VIIA 1DEKA 4FU0A 1OLXA 1RM0A 2C57A 3EG9B 3DKPA 2EJTA 1AO0A 2DOGA 1Y3FE 1FNCA 1BXGA 1TJ4A 2O05A 3DT6A 1UPBA 3EDOA 3OD1A 3CUWA 1U28A 2HC9A 4C1NA 4CIAA 1UD8A 3DO8A 3TCXB 3VDMA 3LA6A 2OESA 2J5KA 4QFMA 1AKNA 1T0PA 4F06A 1OH6A 1MFPA 3C0KA 1HXHA 1V47A 2NTJA 3TVYA 4KYVA 3ZZTA 2IEGA 5REQB 2CL0X 2ZRAA 1Z06A 1Z3CA 2HA5A 3J80A 4GL2A 5CCEA 3IT0A 4GKAA 3ZXYA 4LXQA 5A9RA 3QY0A 5FBQB 1L8QA 2HTFA 1CJBA 3UXYA 2XYRA 4C5AA 1YR3A 1W581 2J3MA 2BEJA 2Q62A 3C87A 3EWSA 3RYHB 2X1VA 4CG0A 4YJ3F 2LCFA 3A4YA 2O7QA 4N65A 1E3QA 1SUAA 2E5FA 3ESXA 2E1RA 1G6OA 3H2JA 4B75A 5D7NA 1VSBA 2H2AA 1S4MA 5CXQA 3F2IA 2XCSB 5KYVA 3RS9A 13PKA 5GV7A 1HDRA 1SQFA 2BRUC 1JIVA 2VSNA 4Z4WA 3ME5A 1ZRSA 1BGXT 1RPJA 2FQ1A 2H2HA 2VDUE 1YV9A 4YVFA 5ER9A 3W05A 1VIAA 3WGHA 5MF6A 3HJNA 2OM6A 1QIHA 3O4GA 3LECA 4JJ6A 2C7PA 3NMUF 3LUGA 5BURA 2C9CA 2LD4A 3KKMA 2Y9MB 3AJRA 1Q0ZA 2HQRA 2NNWB 3BMQB 3CW8X 1A82A 4MJ3A 5KYUB 3I83A 4EG4A 1P7CA 1UWKA 4IX1A 3T56B 4H7DA 5KINB 3V7YA 3AVUA 1FS6A 1D2AA 1SXJD 4RQUA 7MHTA 2QRGA 4ZV4A 1VKZA 2C00A 2J5XA 4P4NA 4P8RA 5FYQA 2JAXA 4HNRA 4HUJA 2PLFA 4EO4A 5JJ5A 3WO0A 4CDMA 4J1TC 5FPPA 1Q7BA 4JODA 1CHNA 2D62A 5TQVA 3LHDA 3LT4A 3R2JA 2RONA 1HT2E 1R6XA 4XLCA 3QENA 4RZ3A 5AVWA 2C59A 3R5JA 1TUBA 5EPUA 3WK4A 1L1QA 3HO8A 2QAGC 5FP0A 4E33A 4PGAA 2ZJ3A 4ZYLA 1Q2XA 2Z09A 2A1TR 3X44A 1J2YA 1X8JA 2GUWA 1HWYA 4QDXA 1ECFA 1PBNA 3OF3A 2YHSA 1B23P 3P7MA 3F8SA 4TMKA 2FCRA 4ZN6A 4MH0R 2ZYRA 3S55A 2OBRA 1NBHA 4F2GA 1U6KA 3C6YA 5LFAA 5JPIA 3I9LA 3NX4A 4P58A 2NN3C 2OCBA 5LQMA 1B2RA 4QNNA 3PGXA 1XEFA 2JGAA 5HBGA 4RKEA 5BWLA 1E2JA 2VKQA 3VYWA 4HVTA 3KBOA 2DFKB 4OHZA 4B9AA 4ZPXA 2DWCA 2OE2A 4O5OA 2UKDA 3IP1A 4RPLA 5LBIA 3TJMA 1QVAA 2E3JA 4MYUA 5BOSA 2O4CA 2IPMA 2ZYHA 4TYWA 4MR8A 1HI9A 2FP3A 2Y05A 5FV4A 1WPQA 2WJVA 1L7BA 3GUZA 4LJ8A 3GL9A 4OK5A 1JQKA 3ENZA 1LBIA 3OZIA 5IJAA 1NW6A 4WZBB 3RC3A 1R6AA 3B9QA 4IDHA 1FYXA 4YMHA 2F3RA 2FZLA 3FFWA 5KTTA 2YMLA 4TN5A 2R6GA 4IQGA 4K9RA 4RFVA 4XTRA 4B0PA 3D8NA 4LDRA 3FIJA 5GJVC 3TRKA 3IMEA 3RRXA 3TTVA 4V1CB 1LVUA 4YRLA 2DBYA 4P2BA 1I2ZA 5AKZA 5FKJA 4AURA 2Y4NA 1HNNA 1WZ2A 1MV5A 4L51A 3AOGA 1KI7A 1U7WA 1W8DA 4JBYA 4L3OA 2PSFA 4G5GA 3C1UA 1YONA 4MTCA 4NZOA 2H07A 4FLFA 5AKKA 4Y9RA 4D41A 2IS6A 2H1CA 2P6OA 1SPBS 2PH7A 4MI3A 3GZNB 4AMUA 5J59A 4M1EA 5ECGC 4WXHA 4D9IA 4YQEA 2DFVA 1EFKA 1YC2A 4HWRA 2A0UA 3PCTA 5EFOA 5IDYA 3TJZA 3TZEA 2R5NA 4DWJA 1EWVA 1EUDB 4F3RA 2B78A 1G1AA 3COVA 1IZ0A 1RD4A 1DFIA 1S2OA 1XRSB 3ETDA 4FFMA 1HFJA 4FJ2A 4N8EA 2CMHA 3IPLA 4IUYA 4TLEA 2WHPB 3BH6A 1LGYA 1VOTA 5JJCA 2NO9A 4P7FA 3FUUA 1D0SA 4BFUA 1S2DA 5F3DA 5H3HA 3CZMA 2ODPA 1TM1E 1FP1D 2COKA 2V9PA 1VIYA 4KH1A 4EGJA 1FU4A 3NCHA 5KTNA 4KR0A 4US0R 3BWVA 2AD5A 2X2PA 4A4DA 1XQYA 3M7IA 4XIYA 3T41A 4AIIA 1O1YA 4URVR 4ZK2A 5L9AA 4KQJA 1EU1A 4H35A 4L8FA 2UYYA 2ZJOA 3QLEA 5I01A 1GPNA 2CV1A 2PYDA 4E5SA 3NR2A 2PIAA 3CCJB 3NHFA 3TE7A 3TZ6A 3VKUA 4JSYA 5BY2A 2H4WA 1T3ZA 1WP6A 2QU8A 3ACDA 1YHNA 2H4ZA 4ZREA 4CG2A 4TLBA 4E03A 1FFWA 5AP9A 2FSPA 2HJSA 1HLGA 5LBUA 3SK0A 4BIMA 5K8UA 2H2WA 1ZEJA 2WWXA 2B36A 3KK0A 3ILYA 4HNQA 4MKZA 4R2JA 3FTEA 1S89A 3DTVB 2VAVA 1WD5A 3RYIB 5L7TA 4DG5A 3HA5A 1ZLYA 2GRAA 2O8VA 4XGKA 5DO9A 4X41A 3ZJ5A 4BQPA 3JQAD 1FJGB 1T0UA 1MPTA 4ND1A 1CUCA 1GL9B 1XZQA 2EKLA 5GONB 5G4KA 2O0KA 2O8EA 3EGWA 3DL0A 2XMSA 3CZPA 3A3OA 4EQ6A 2GESA 1FZTA 3IIJA 1RS0A 3I6MA 4UEJA 4A2CA 4HWGA 1YE3A 1ID1A 3NAQA 4JBXA 4BP3A 1W88B 1ECLA 2MSLA 4G56A 3LD9A 4UM7A 3X0DA 2HQOA 1L6RA 4N12A 1V8PA 1Y9ZA 3M4ZA 4HAZA 4IOLA 3VI3B 4UXJA 3T1NA 3HBNA 2YN2A 3MSCA 5JJBA 2HFJA 4MI9A 1C30A 2DQZA 2OB2A 2XNSA 1F2UA 3CLTC 5LUBA 3PLRA 4N41A 3L9XA 4CKCA 4IILA 4IKPA 3M4YA 4IIUA 2XD9A 1OWNA 1YRBA 2VTDA 3ETCA 3QK7A 1QHXA 1XXHA 3AONB 2VHEA 5LIRA 4JQYA 3VSBA 4DQKA 1A95A 3KOOA 4H1UA 3AJ9A 3JRXA 1FDWA 1Q1AA 3SYLA 3ZV6A 4C7KA 5HKLA 1JBKA 3PNMA 3B3FA 1B6RA 5H5JA 4JSRA 4NPHA 5G41A 5FNZA 3V2HA 2Y1DA 2G77B 5I7SA 3N2YA 1OXXK 2AVDA 3N2LA 5AJWA 4RH0A 1Z34A 4KKXB 1QS0B 3GEMA 2GZRA 1Y1SA 4C0XA 1UBOS 3QE0A 4D92A 1ZCAA 2AX3A 4L1KA 4UOZA 2BJWA 1VXOA 3G0HA 1SVOA 5DGIA 1FZQA 4TYMA 3UT6A 4LHWA 4UZEA 5KHOC 2QJWA 4JEIA 1HDGO 4M1OA 3F6SA 4R9UC 4BNYA 4JS0A 1U1FA 5K3DA 2IWRA 2IOFK 3FJ1A 3Q5EA 1GGHA 5HE8A 4B43A 1KS9A 3H1PA 4Z4HA 3IHLA 4OQMA 5AW8A 2DLDA 3H1GA 2BIFA 1QFJA 1OSNA 1JU9A 1MC4A 3QELA 4L9AA 1EFVA 2DJ5A 2GAOA 5JU6A 4K7JA 4KHZA 5LNK6 1R0LA 1DKQA 3CUYA 2XYHA 4YCBA 4DY6A 1VJ5A 1L5VA 1U94A 1K7EB 4I4TB 3ZVMA 5DHQA 1GD1O 3IOEA 5KJCA 1W59A 2YOFA 4ZOAA 1XEWX 1D4AA 1V16B 3QM1A 3FNRA 4RK6A 1TECE 4G36A 5IF3A 4M9XA 1KVTA 3R0JA 1XZMA 1IRIA 5IM4F 1R8SA 1PFQA 3L82B 3SR4A 2D2EA 3VR6A 4XVHA 1NJ1A 1O94A 1P1KA 2AOTA 1EHYA 2VFAA 1EXVA 3CM0A 3CC2B 3R6JA 3RDPA 1Z62A 3A0RB 1NJGA 4DTIA 3MD0A 3HU1A 2B8JA 1HUQA 4JVMA 4L08A 3I73A 1K7FB 4KWIA 3O93A 5MFPA 3HXMA 4Q9JA 2PPVA 2P6PA 2QTTA 2HIAA 3PD7A 3RJZA 2Y93A 3W77A 1I4LD 3OEHA 2O2HA 2C4MA 1YZFA 2PBRA 1M6WA 3K05A 2OXFA 4KPUA 5FUXA 3RHTA 3ZKAA 4JI7B 3NT5A 1E1QD 1TEZA 1N2CA 1JE0A 4JI2B 5KQRA 3K5IA 1C4XA 4Q21A 2KSQA 2PFSA 2A9OA 1IJBA 1GADO 4KX5A 2G09A 3ZCPA 4OPVA 1U04A 2O57A 4DIKA 1KQPA 3NHKA 1WSAA 3DL7A 4L07A 4V0SA 1W9HA 2ZOSA 1FMFA 3LCUA 3WK7A 4XQ9A 3FYUB 1MRZA 1M6VA 2FZ5A 2P2YA 4ZEWA 4CT4B 3STUA 5DSZA 1U2RA 2ISSD 3OAAD 4OFXA 2D0PB 1YHQB 4YP9A 4BNLA 1PNRA 4IFIA 2JI9A 4H6WA 5CEEA 2H1FA 3NJ8A 4L22A 3W34A 3LFUA 3NATA 3ODPA 1PZGA 3QPUA 2VN8A 1JUDA 3QU4A 3KYJB 4DRYA 3OZWA 5AW0A 1SC6A 2HL6A 2QRQA 3HM2A 3V76A 3D7RA 4WV3A 5A05A 1LF5A 2WOJA 4O2BF 4UHBA 4U7PB 4NJEA 2YASA 3UJ3X 3ROMA 3Q5DA 2HT6A 1IN1A 3WLKX 2DKNA 1R12A 1UBJS 2QPOA 1RBYA 2WK1A 1UXIA 3OF5A 2BEUB 3RVQA 3WL7A 1RYYA 3N8HA 4OVKA 4D9EA 1VKJA 4TL7A 3LWBA 5EI5A 5IFKA 1U4NA 1WQ3A 4UE6A 2QL7A 1TMKA 4PCUA 3LCVB 2A6PA 4HTFB 3U60B 4CKZA 3KWFA 4GQIA 5SZKB 1RZRD 5EIBD 1QAMA 1XRLA 3M5DA 4XIGS 1PNTA 4AY4A 2E6KA 3J7TA 3KQPA 4HNAB 3KT6A 2OQRA 3HRIA 4G0QA 4NBUA 4P4LA 5C8YA 1EWQA 4NNOA 5ALJA 3RFXA 3C6XA 1IIBA 3FZQA 3T9EA 3PWTA 4LDNA 3OLXA 4CIYA 3EOZA 5D1NA 3SYTA 1XVIA 2QAGA 3DKKA 3DZJA 5ALQA 3U1TA 5K0EA 3QOFA 3RRMA 3GU3A 1YXMA 3ICCA 3AGPA 1U4SA 1V39A 1LUAA 4KTTE 1G0OA 3HDJA 3KPWA 3BHNA 3RQSA 2HBYA 4WKOA 4UDYX 4UZFA 1EK0A 2X58A 3G9UA 1F9EA 4CMIA 3D8TA 2W8ZA 3KJXA 4M54A 4BLSA 4HVCA 4US2R 3SWWA 1JVNA 4FDLA 1GPYA 4PNPA 3V4VB 1Q1GA 2GCEA 2HOQA 5LNK1 4J07A 1Z13A 1FA9A 2H5JA 3N8IA 3B5EA 1GUBA 2HPHA 2BLLA 2WUGA 5EJ2A 5TMPA 1I0LA 4IVRA 2LGJA 4L5CA 3VO8A 1S9HA 2ZZFA 3TEFA 1SKAA 5HS4A 5I7RA 1O97D 5G0UA 5K0TA 3RAFC 3GP3A 3KOWA 1RXIA 2QGGA 4Z86A 1RXWA 4H2DA 1PJ6A 5HA5A 3PUWA 3BHJA 2EP7A 1N8TA 4DIUA 2AI2A 5BSHA 1Z35A 2OXEA 5A88A 2QF7A 4GOXA 2GWRA 3EC7A 4NECA 2I6QA 1XJ0A 1ZXXA 4MWTA 3SFVA 5TIIA 4I1SA 1LDGA 4RDKA 4RULA 5EIBC 3OM1A 4B8WA 4W6QA 5J40A 1CB0A 2EBHX 5EL0A 3OFSA 1BE8A 3AESB 2HRBA 1E8NA 5C1DA 4ML3A 2ZSDA 1J56A 2A5YB 3RBAA 5BV1A 1G291 3QWBA 2REQA 3GFSA 3RC2A 4E15A 1W0KD 4FHGA 2X4LA 3K4PA 3VR3D 4D4KA 4EY4A 4YI3A 1GEGA 1TLFA 3VPFA 2X0EA 3WYCA 1CEYA 3O5AA 3WDMA 4K0KB 1AU9A 1JX6A 2ZRCA 5FA5A 5KU7A 2HDHA 3HCRA 5G53C 5BN5B 2VOJA 5EEGA 5DTQA 1CQIA 4CUKA 2PZJA 1P31A 5HBRA 3GLQA 1QYRA 3I28A 4Z0HO 1DEXA 5EINA 2IODA 4N7JA 4TTVA 2PMCA 3Q7TA 2B4YA 1UXJA 4EYGA 5JSUA 1ZN8A 2GEDA 5JNUA 2BTEA 4D9HA 3FDJA 1R8YA 5HPYB 2P2GA 1EDEA 1LZKA 2RJOA 1OLSA 3A3KA 3HBFA 3ILSA 4QVGA 4F9EA 1TTQB 1Y7PA 1P33A 3RYTC 3F8WA 4UNIA 1FVFA 3JZAA 4BO6A 1I24A 1ESEA 4LHYA 3X1ZA 2PUEA 4E2XA 5IK2D 1RLTA 2ROQA 4YR9A 3NVAA 4G0NA 1T1JA 4M8IA 3NKFA 3BXOA 3CNLA 3QLTA 2W2OA 4REQA 2DY0A 3U7RA 4F4DA 4UMDA 4KR3A 2D8AA 3K72B 2AN4A 5DNEA 5T8KC 1JLSA 4Z0PA 4PGOA 5KZMB 4DV5B 4L02A 5F3RA 3UATA 1FRNA 2V45A 4Q4HB 1N2EA 2CDAA 4ZWNA 4QREA 4YPFA 3ZGZA 5JCZA 5ILGA 2P91A 4Z4IA 4RM3A 2KX7A 3LTNC 3FMFA 3S70A 3ZPNA 3E81A 3ZV3A 4B3XA 3OLWA 5EMKA 4E4RA 4JT8A 2Q5EA 1WUKS 4RPHA 5HXAA 2HU2A 3C1AA 4R1PA 4HFRA 4BFYA 3OE7D 1N0IA 4EO7A 5EJ4A 1FS5A 1WU8A 5EJAA 4BCBA 3V00A 1DBWA 5KQPA 3O2NA 4ZI5A 4OGGA 1AIPA 2F9LA 4WBXC 3UKDA 5KKNB 5H8WA 1E0KA 1CQXA 1VMAA 5CU7A 5JWHA 2BGJA 2UUOA 3FZYA 3C3PA 4NCJA 4LW8A 5ECDA 5T4HA 4LRQA 3NM4A 5KDDA 1AMUA 1AQJA 2HHJA 4DZZA 3DMDA 2PUTA 3VSCA 4FHFA 5DFAA 2X2EA 2AEFA 3QVVA 1JG4A 1G38A 4ZYYA 1AA6A 2PNFA 3BRWD 3EBPA 3AG6A 1PVVA 4RH3A 5GOTA 1E1YA 3GVLA 3CLUD 2QPTA 1ZCBA 3M8KA 3U7QB 4DTCA 4H3SA 4CCYB 1JIIA 5B3LA 1NSTA 4Y9TA 4BO9A 2CDNA 2JLVA 2WZQA 2OAQ1 3M3PA 4PX2A 3G8CA 1HG0A 4XQFA 3TLKA 3GLIA 2WAAA 3O8CA 1CVRA 2A9RA 3QFHA 4LRYA 1I36A 4ZQFA 3WO1A 4BLPA 5JAQA 1YAHA 2Q2WA 3EEQA 2SCUA 4LRXA 1UPTA 4ZQIA 3EFOA 1C7FA 2XQVA 4FGKA 3TQFA 2GXQA 1JFVA 3OMXA 4PSCA 4CLHA 1AKVA 3IB6A 3UOAB 3OJWA 2CFCA 4DLUA 4N0MA 1WXGA 1DX4A 2GRJA 3THOA 1DELA 3TG8A 1MQ8B 4RVNA 4JXKA 2ZJ5A 3PHLA 4JEUA 5DVZA 4Z2YA 1XFAA 3H17A 3UKJA 3HV2A 3A10A 2I2DA 4RF5A 4JGIA 3IALA 2PS1A 3DLPX 3HSSA 4GI7A 3H18A 5ALPA 3LXRA 4J0EA 4X8HA 3I61A 4FWTA 1T35A 4J0GA 5E9WA 3Q5GA 4JLJA 1E3IA 1JPNA 1MEEA 1UIMA 2J41A 2Q5OA 2VRBA 3KYCB 4FTWA 4W5JA 2DR2A 2QMUA 3SFTA 3HDHA 2AS0A 3GFVA 3SF8A 3ZY3A 4UTNA 3L0ZA 4U5XA 3RV3A 2NTEA 1HOTA 1MDBA 1OI4A 2OGZA 4I50F 4M36A 4NCAA 2BDUA 1RFLA 1ISJA 4TSRA 3E8SA 1NI3A 2GF2A 3LX5A 3AW9A 3REQB 2FN4A 4YRDA 4GEGA 2JIMA 4EW2A 1T0HB 5TQ0B 5JQGA 4J76A 3TKAA 2PS9A 2UYCA 4BGIA 3AR3A 2J5RA 4QO7A 5L4NA 1E5TA 3QW4B 3I5YA 5IEBA 3V2UA 1JWAB 3U7IA 4D9CA 4QJ3A 3EPJA 2Y27A 2Z83A 4BP1A 1E1CB 5JV5A 3D3EA 2WWVD 1YFZA 5K2OA 2JI6A 1IEXA 1FS4A 1D0VA 1KQOA 2ZWPA 1DHRA 5K3SA 1N6NA 2NOAA 2C5HA 2C9BA 2XMQA 4QOFA 5KTSA 3ISXA 3ICOA 3KEWA 4IWXA 2NUPB 1ZRMA 5AVKA 3CZAA 4L76A 4D6XA 3GD5A 1MHTA 1Z0IA 3AQ4A 2AL7A 3C15C 3ND6A 2VNSA 3IPXA 3MWEA 4FUQA 4JBLA 5I9SA 2WQ6A 4M1ZA 1UMBA 4CF7A 4N7MA 1DKOA 1F5NA 1NVTA 1T5DX 1KC8D 5DV9A 1TT5A 1R9JA 2C03A 2ZS9A 3AHIA 1Q0UA 3E7DA 3IFSA 1YKSA 1L7RA 2V65A 3RSHA 4I55B 1Q1ZA 2PXCA 4MAFA 1VLJA 4DQDA 5B1SA 3RYCB 4CT5A 4RHUA 1YO6A 3GEEA 2GJAA 4EKDA 2ZSFA 2RHHA 3OY7A 2QD2A 1W1UA 4OF4A 5J5VA 4E32A 1UK7A 1LBTA 2VBGA 3OQVA 5FULA 5IU6A 4G01B 4BMSA 2X5OA 4Z4EA 2CDBA 1G0NA 2P9EA 4C20A 1F7VA 1WXHA 2C3UA 4JYMA 1K86A 2ZBEA 5JD4A 4MV3A 5BW8A 3OG9A 4BNHA 3E2PA 3L6BA 3RAGA 3S1SA 1X7DA 1K9MD 4IVQA 4DRXA 2IPNA 5C7YA 5LQRA 5EG5A 1W49A 1M10A 3HVJA 4ENQA 1UM9A 1ZH2A 3I55B 1C80A 1A9PA 2AQ8A 3ML1A 2VSXA 3PQCA 1R8JA 1TGYA 4UNQA 5KS2A 1WSRA 2ZR8A 1DBSA 1GGNA 2HHAA 2GKSA 4POOA 3ZZ1A 1PAUA 1O94D 1I7DA 2WJPA 3QPWA 5B53A 3Q9UA 5DU2A 3GLFE 3PEYA 3C6ZA 1LDEA 4XM3A 1P74A 1S3FA 4Z9FA 3C8HA 5JYBA 2VO1A 5LJIA 3PE6A 4UTXA 3VC3A 4AU1A 2GTIA 1JEJA 2V7QD 1JDBB 3IP8A 4CMEA 1LC3A 2Y8EA 2OOSA 1SOWA 3PB3A 1HTWA 2ZJ1A 3R3JA 3VH4A 4DCNA 4C21A 2W93A 3KHSA 4GPTA 3UANA 1JR2A 2QRUA 1QFSA 1S2NA 3QG1A 1LDMA 1QPBA 5CCBA 1OKKA 2J4DA 1WHTB 3BJMA 5FT9A 2OHJA 2WJJA 4HLUC 1X0XA 2PE5A 2GPTA 2GILA 5K0ZA 4OQ4A 3LL7A 3GRCA 1P77A 4WJZA 1VJ1A 4AS3A 4BMNA 1DIAA 2HJRA 5AH0A 1XR3A 2GCPA 4MUFA 5TXGA 4J2TA 1IB6A 4H17A 1HTTA 1N25A 5DM60 4KWCA 2O2CA 2VDOB 5KNCH 4NPCA 3AETB 1GCGA 1A76A 4U2EA 2ZAGA 2GYWA 1OPXA 4EHBA 1Z0KA 3UYKA 3VU1A 4F46A 4MW4A 4Z3DA 4X1KB 1Z63A 3ROPA 3EW9A 3ZE9A 1BHSA 4ZC8A 5KSOA 1CF2O 1BNCA 3Q7IA 5C5EA 3P96A 1P8AA 2WWIA 4M0FA 5JDCC 5KC8A 1IFXA 3GLGA 1XPUA 5AWFC 1ISHA 1P75A 2HDWA 3ORYA 4NYMQ 2GYUA 3V5NA 4B6GA 5LOVB 1MBZA 4MR7A 3PITA 1XE1A 1RJGA 2HK7A 2I4IA 4HB0A 4EX7A 1R9NA 4RGVA 5H70A 4MEBA 3UAXA 6GPBA 2R5FA 4F56A 5BR8B 4DUZB 3ETGA 4MV5A 2VDKB 4HAYA 4YO8A 4WERA 3ZCUA 1PZFA 5BSVA 1G17A 1SB8A 2JAPA 3NEYA 5CVVA 2RHWA 3PGVA 3N5KA 1Y0RA 4MGYR 2XZDA 4G1BA 2G0NA 3BGVA 4C4RA 4YGXB 3O90A 2GOYA 3U81A 1NT4A 2GCOA 4BU1A 4I08A 3ASPA 4N8SA 3ZWBA 1B15A 2CCKA 2WTUA 4KCGA 4ZQEA 3L8DA 3FCSB 5FBVB 4P80A 2I1VB 2PXXA 3FPBA 4I3FA 1N33B 3PIRA 4YDHB 2I4TA 5KNDA 1K6MA 2J33A 2VJJA 1SR8A 4PYJA 2VNAA 1LU9A 4OQYA 4OUDB 5KVCA 2AJTA 1ECGA 4RC9A 3T61A 1NHGA 4M89A 1ODIA 3BJZA 1GCUA 1SC4A 1VA5A 2PKQO 4IRMA 5AVTA 3A6PC 3L92A 3DE0X 4AFNA 4RSGA 2PEZA 1D2NA 2IOQA 2BMWA 1MX1A 2FMXA 2HWYA 1L3IA 3G1WA 3WL3A 4DMRA 4ZMRA 1NM5A 2AG6A 1ATZA 3TI7A 4AZ3A 2VPQA 3LUHA 1J5XA 2I8CA 5BOVA 4FIZA 3ZS8A 3OOJA 4K9DA 4AQDA 2D0DA 4ZIRB 2FEWB 4IQFA 2OY0A 3MFYA 2XEDA 3ZXUB 1SBCA 3ECAA 4IVNA 1I5OA 1TJ5A 5K3CA 2DXIA 1N6PA 2ACVA 4X44A 4UAJA 1HDCA 3DBRA 1L9KA 1BLIA 1RYDA 4RZIA 1K3TA 2O0JA 4F86A 3FUWA 4YLEA 1X7XA 3HP1A 2VJAA 1OFUX 2BZGA 2V6JA 4MQBA 2OB1A 4ENTA 1CUFA 1MPXA 3TQOA 1UC4B 4EB6A 5JY1A 3N28A 3OPYA 1MOZA 2VYFA 2Z2ZA 3DJYA 1PDWA 3ENWA 3OQNA 3J7AC 3ETHA 5EYPB 3RIEA 5B1IA 2VZ8A 2F8SA 3ZDZB 2B69A 5TGDA 2HWKA 2FXIA 3F3MA 1ENPA 3FZGA 2DIEA 4C4SA 1AG9A 2VI5A 2GQFA 3RHZA 1RMYA 2D6FA 4MWZA 2WJAA 1Z0FA 4IHQA 4NU5A 2NXCA 1ZK0A 3KHKA 4JJ7A 4PRYA 3L07A 1ACJA 1ORWA 2Y1GA 5L7YA 3T7JA 4QYMA 3UWOA 4AN1A 3O4HA 1OWPA 5E2IA 1WB5A 4F8EA 3JPWA 4BPBA 4K6CA 2LKCA 4LRTB 4DCTA 3PNOA 1C7QA 4W9RA 5A2QA 4YP6A 2F3QA 5TC4A 3MCVA 4MWCA 2FPXA 1X1QA 2HM7A 4X61A 1JTFA 3RU3A 3T7DA 3H0KA 1JHZA 3RCBA 4YYEA 2W00A 3L1IA 4PNHA 3NFYA 3UAOA 3URMA 5C4IA 1H4QA 2IIVA 3WICA 2Y0BA 1OX4B 5BN3B 1J39A 5KB3A 3TZCA 3LKVA 4Q7QA 5AI5A 1P62B 5KYXB 3OCUA 1QH1B 1WOYA 1ISMA 2CZCA 2AJ8A 3QWIA 3HM9A 3OSUA 1JYFA 4UAUA 1XL1A 3MWJA 3OZVA 2ZIVB 3GIWA 4Q48A 1X87A 1H6BA 2YRXA 1D4OA 1LSOA 3UZUA 4RY8A 1NKVA 5AK5A 3T35A 3AHFA 5AMXA 4JJGA 2X0NA 1V4BA 3EEFA 2P1RA 5T64A 3ZN2A 4KMMA 1SOVA 1BEZA 1MKYA 1U8UA 3B1WA 4AZVA 3UC9A 5IT4A 2JI7A 1LI7A 1XTQA 2FKNA 2VF8A 5AUQA 4DT1B 1K89A 2PGJA 4XCXA 2B1JA 2CJFA 1E4OA 2JLCA 5A0FA 2CZQA 4DOMA 3BWMA 4DWOA 5A3QA 2RGEA 1H2XA 3IILA 2X5NA 3FVRA 3EZFA 4U8HA 3IR5A 2JFGA 3SQNA 2PD6A 2PZGA 3M6WA 3Q12A 4JJFA 4LJ9A 4DBVO 4YQFA 3G13A 2PX0A 2ZYDA 3GLSA 4R8SA 1UXKA 2YDXA 4V0RA 4AJIA 5EZQA 1Q12A 2IV2X 3TVTA 1XD2B 1G20A 1OROA 2FDRA 2I3DA 3NUGA 1KPGA 1L4HA 3FYTA 4A6DA 4JJEA 2H59A 2K2QB 1DU4A 2D2IA 2V6FA 4XOUA 5JVDF 1I6LA 1YACA 1HE5A 2J7PD 1R5JA 1F4PA 4PBRA 1JDPA 1ZBDA 3WLSA 2ID9A 5EERA 2QROA 4BB0A 2Z8XA 5CFRA 5JEDA 4PCLA 5B6IA 2PJUA 2GZHA 5KQLA 5KCMA 1QB7A 3S3TA 2BFNA 1OFVA 3HYRA 4CN8A 4PAQA 1K5GA 2I55A 4UKDA 3WIOA 1P4SA 1MR3F 4M0EA 3GGOA 2B94A 1R0YA 2VK1A 3MGCA 3W3ZB 1Z4PX 4CGYA 3B78A 4LXUA 1ZYUA 2VJYA 2Y77A 1F17A 3N0VA 3L4SO 4M7RA 4CE6A 4YDSA 1UFVA 3HXTA 2NVBA 3QLVC 1Y98A 3FPCA 3ZY6A 5BNIA 1T4CB 4Q4AA 1SB9A 3CNQS 2V6GA 4AQ7A 1O94C 1FPQA 4LZLA 2VCHA 1XLTA 3AVTA 1YS6A 2CBZA 2UVPA 4L78A 1E79D 1Y6ZA 3TXYA 3ORHA 4LZOA 2ILVA 1WMAA 3THWB 4ZDKA 1JIQA 3BBLA 4KUEA 2PGDA 4V0MA 3AVXA 2YY5A 3WB0A 3WGVA 1RZ3A 4LGMA 3O8LA 4WL0A 2FDXA 3AEZA 3EVFA 1T5SA 2NV0A 3M9LA 5FTMA 3P27A 5EE0A 3EMVA 4YROA 1EP9A 5JZVA 3OLVA 1HDXA 2YN0A 3EIOA 2QVXX 3FJYA 3QLVA 4E22A 5J2TB 5B1YA 1HF3A 5AJVB 2ZQYA 3KZOA 4J94A 3SZRA 3U17A 4BYMA 4ZVTA 5YASA 1R6BX 4D6YA 5JNSA 2J6CA 4YJ2A 5A5DA 4NEGA 1NC1A 1O5IA 1PEDA 5KIAA 8ADHA 1CLUA 1NXPA 2EP8A 3HKDB 5LUAA 1JEAA 1NBIA 2CE7A 2OBYA 3KTDA 4Y3UA 4P32A 5EWLB 4M53A 2RCNA 3HU5A 3ONVA 4N5HX 1BMFD 3OZ7A 4PTYA 1MW9X 2DQ4A 1FUKA 4HDCA 4C87A 4DLBA 3LZDA 1YX2A 2XXJA 1H4VB 1MRNA 3KJFA 5KYTA 3NYWA 1OE0A 2V7BA 3RJMA 2Z2KA 3NJ4A 1H3NA 4Y2XA 4EPRA 2R1TB 3GJXC 3WV4A 1LWNA 4Z2AA 4MLCA 2ENUA 4M1MA 3MQ2A 3VNAA 3BWXA 4LQ4A 1YQ9A 4PG4A 3TMAA 5BWMA 4QWMA 1F06A 2ZT8A 3HYCA 3IX7A 3UKOA 1W76A 1HLPA 1QTIA 1IXSB 1GAJA 1AQIA 1S8FA 2GXUA 2G9VA 3PR3A 4FYMA 1LLUA 4RAQA 5ERYA 4ZVMA 5A7GA 1N3YA 4GSLA 2GFHA 3E9CA 3IIMA 5IW8A 1NW9B 2EF1A 5KJEA 1DPFA 1JDVA 1R6UA 3CXRA 4RDJA 4KN8A 1ZU4A 5EA2A 1P2SA 3T7SA 5BPHA 2PXAA 4L9WA 4YJFB 2DT5A 3GJ8A 5AD1A 2DRIA 1VPLA 1K3FA 3K2IA 4R9VA 4YRKA 2FMIA 1RWWA 3ZI7A 1NBME 3QVSA 1VYHA 2QR5A 1P8JA 2XTMA 1OFGA 1JAHA 1ORVA 1M6NA 1Q15A 5HQ3B 4WK2B 2XCTB 1UJ6A 4A91A 4IYJA 2DKOA 2V1UA 1VJSA 1PQ4A 1TVMA 1VL6A 4UU7A 3W1EA 5JAZA 4M87A 2V98A 2JVIA 2H5LA 3EWAA 1BCSB 3O6VA 4IV0A 4RAOA 1QH0A 2CHQA 2E9SA 2FPPB 2IZ7A 3KT3A 3NRJA 5FI1B 3Q8XB 4TS4A 4AS2A 2OP1A 2V4MA 2ZIEA 1D9ZA 4GOMD 4DFDA 5F77A 5TSDA 2Q9CA 3CCUB 3P0RA 1NYLA 5AKXA 1M2VA 4EPVA 2D7JA 3REOA 4FYXA 4RSRA 1ZHHA 3AI1A 2NU8B 5ES4B 3U9SA 4JH0A 3A6JA 4GQNA 5CA1F 1DJLA 4ZARA 5BSXA 4FCCA 3E18A 4URYR 3BWBA 4Q1DA 1CFJA 1LRLA 3N05A 3RTBA 3RI3A 4WFQA 5GP1A 3CSDA 3KQTA 4IXDA 4JL5A 3NNSA 3C24A 4YYZA 3R8FA 4BQSA 1UT8A 1LDNA 3P9ZA 4GIBA 4FHDA 4DHWA 3VJRA 3KUUA 1LPBB 2JKVA 2VP3A 3DE2X 3MWLA 3MTEA 4YEJA 4IMJB 4P25A 3UO8B 4XNFA 3GOQA 5ICCA 4D8TA 4YMIA 1K8QA 4GKJB 2YBEA 4UHEA 1YITB 2XZPA 1HSZA 2ZZKA 2YVLA 4A8PA 4KZPA 2HRCA 4BMZA 5KDOA 4HDOB 1IXKA 1J4AA 1W4LA 2E89A 4R1QA 2M6LA 4MUEA 5CTJA 4E11A 5KQSA 4HPJB 4TWIA 1KVRA 4DWVA 3HSKA 1YULA 1I6MA 3QLUA 3CO0S 1F8XA 5DMHA 1Q5PA 1IUKA 3N3AC 1YR8A 3W7BA 5U1PA 3MTIA 5KVVA 4IZIA 1ODTC 5DTMA 1CU1A 4XZ3A 2G5PA 2WJIA 3RANA 3W9UA 3O8BA 3ESRA 4IIJB 1IOZA 1JNYA 2OBTA 4QM7A 5KJ6A 2QTZA 3OJXA 3NDPA 3WS7A 2BSAA 3WMGA 1OOEA 1J5PA 5DHSA 4E13A 3LCMA 1OD6A 2WKPA 1H1LB 3MWKA 1U0GA 1ZUNB 3ORSA 4IXMA 1QFMA 1VMEA 1G9XA 1T8PA 2B37A 3LOQA 2BWJA 1X38A 3KALA 4CQMD 3HXLA 2GFQA 1NM5C 1N0VC 3ZH9B 1O4WA 1KIFA 2ZYGA 1XQVA 1VCOA 1L5ZA 2NM0A 4JB3A 5FHQA 4CI9A 1DCTA 1BOOA 1Y34E 1E9VA 3HC7A 3DW3X 4OCZA 3V32A 2RHLA 3QLUC 2ZM5A 3IQXA 1A7UA 1V48A 5I7FA 2GAIA 1AKYA 1XYVA 1WCWA 3R6TA 3DFIA 5F7OA 4I50A 3NXSA 1YDEA 4IV8A 5DCLA 1E79A 2ZWAA 4RS4A 4UASA 1I32A 4JFAA 5J43A 2FQWA 1D1NA 5LQJA 3A9SA 2JBWA 1FLAA 5JO0A 4XONA 1OI3A 3EXHB 2I66A 4ZMSA 2MINA 3L02A 4QO8A 2YWEA 5JTTA 4UAVA 3H04A 1KMCA 4U7GA 2WV7A 2EWMA 3FF4A 5FUVA 1NP3A 4I1RA 4JR0A 5EZYA 4W9NC 5CYOA 4Q3CA 4GOND 3TNLA 2XQJA 1KETA 4M0CA 1FUEA 4HATA 3U4HA 4UQLA 4RW0A 2QU7A 4QIHA 1J8MF 4UEKA 4PSVA 4NJMA 1A69A 1JR3E 1QBKC 4CEIB 4TSFA 3RVSA 4RZQA 1UFKA 2QRLA 5ALIA 3I3OA 4OQPA 4N9WA 3UG6A 3EGDB 3A1PA 5F9MA 5JHGB 2GD2A 2BJHA 2G07A 2K7FA 3RU7A 1UQUA 2AJBA 4OXKA 2OR3A 1GLNA 2R11A 3C3EA 2RHJA 5JEEA 1BE6A 3BDVA 3DC2A 1L7AA 1V1RB 2IHBA 1ESDA 1YHZA 2J0QA 2AMYA 2QTVA 4PQYA 1DQZA 2IZ6A 2SHKA 3NXKA 1N6HA 2G72A 3S2GA 4LHXA 3UW3A 1ZR2A 1CW2B 3ZIUA 4OQFA 5J3OA 4KN9S 3TLGB 1S6YA 4R05A 5COAA 5TQ2A 1OFIA 4RF3A 5FUMA 1Y5MA 4J3JA 5C3UA 1XEAA 3IIKA 1Y6JA 4NCKA 2WPDD 2GEKA 3GJ7A 3MBIA 3DHYA 4EFKA 2Q46A 1PJQA 3FROA 2QYTA 4KWHA 1ONPA 1UAGA 3MGKA 3PC8A 1VP9A 3U9TA 1ESZA 2FFJA 5AFSA 1WMEA 4XR6A 2AH5A 3ZTTA 1ZNWA 3AUJB 2JCVA 4X9XA 1MGOA 4W5HA 3DTNA 3L1UA 1N5JA 2CXOA 3P2IA 4MUGA 4RESA 1U99A 4MO9A 4YEDA 1KOFA 3VC7A 4ZI2A 3KQOA 4YY3B 1N7JA 1SZDA 2DG2A 2JKYA 2XIJA 4Y1FA 3E9EA 3NEJA 1NU6A 5BWNA 4JGBA 4B2YA 4RA6A 4RV5A 4A3SA 3K20A 4R6WA 4M7OA 4UXIA 5JSHA 2IH4A 4IG9A 2O8BA 1KQ3A 1W96A 1GR1A 3RU2A 4WLUA 4CIBA 4RWZA 3W0LB 1OIVA 1SO8A 2WT9A 5FL3A 4JQSA 3LXMA 4XIIA 5JSQA 3OC0A 1DXOA 2VHUA 2ZTVA 4KU4A 2GN0A 5TPZA 4HCJA 2A5GA 3OSZA 4CEJA 5E0KB 1VB5A 3FNFA 4BX0A 5ER6A 4Q47A 2JLXA 2NTYC 3C3AA 2Y68A 5HCIA 2B21A 1TO2E 1N8RD 3VR6D 5JMTA 3AVYA 3IBCA 1U1DA 4ZCMA 4FJ0A 4XEHA 5B2EA 1QMGA 1YLOA 4BNZA 1O8CA 2DFLA 3AF2A 3SXUA 1XKXA 2NZVG 2YRFA 4F3KA 5GZ3A 4FOPA 1RPZA 2IT1A 4YRGA 4FCTA 4AX8A 2EP5A 3C8DA 3R9WA 2BP7B 4I4TF 4MSUA 3RY8A 1ZK1A 5K2MA 1BDHA 1BSVA 3R9IA 3ZU6A 2C77A 2XB8A 4E08A 2OGTA 1PFYA 3L0BA 3UTCA 1SNYA 3FOEC 5LXTA 2PRSA 4NNJA 3MS7A 4ZRNA 1MC8A 1JRLA 2V5UA 3OLQA 1Y8QA 3PHCA 5AW5A 1GTVA 4Z8YA 5IAOA 3S81A 4NFHA 4C4XA 5LP1A 3Q98A 4HEA1 1YI1A 1GRNA 4KAXA 3A1CA 3A04A 1BWQA 2QBYA 2P79A 1Y7LA 3WOHA 4EJ0A 3CLVA 4UM8B 5KSYA 3V2GA 3PNBA 2QV0A 3V6MA 1JJIA 4RZXA 3UCFA 3FGZA 2XH8A 1C3XA 1PYGA 1UP7A 1BROA 3FYHA 3VYSB 4NFLA 4QL3A 5HZGA 3E5NA 3MWGA 4TWJA 1YZTA 3V46A 3UHOA 4C0AC 4U39A 1L7MA 3U62A 4C78A 1TKRA 1GKYA 3EN0A 2ECOA 5BSGA 2J7PA 1E1DA 1U7ZA 2OGUA 2CWWA 1T5HX 2A9KA 3N86A 4KKTA 3OPMA 4MQ4A 4N82A 5ARDA 4B84A 3ZTYA 1XDUA 3I2KA 1NVKA 3SLNA 2C5SA 3WLRA 1TM3E 1XCGB 1T1SA 3PFCA 3MIIA 4LSGA 2Q07A 4UPDA 4YQYA 1RWNA 3VMFA 2NSLA 4MV1A 2Q1TA 3LSYA 3GUUA 1T0JB 5J35A 1D2MA 3DW1X 2D1FA 3K2EA 2NZ2A 1TJPB 2P9FA 4TT3D 5H82A 1U5AA 3EIWA 1HORA 1F6BA 1I9GA 1BHJA 1YCGA 2H65A 2QJTA 4L3WA 5BW5A 3PEWA 2UXDB 1XD8A 5EUBA 3BIJA 2WSIA 1JI3A 3GLHA 4AKTA 4KK4A 4Y9DA 2YV5A 3T9AA 1EZ4A 4LSWA 1BGVA 1Y82A 4KODA 1YRHA 1SXHA 1H9BA 3E6AA 4QATA 3TNDA 1JKFA 3O0TA 4RVGA 1W5BA 3S8MA 4FBGA 2ZU6A 4RUKA 4ZOCA 3RLFA 3VSDA 1QIKA 1NNSA 1JU3A 2PKWA 4A92A 1M54A 2OAP1 4E5NA 1QF9A 4DIFA 1T26A 2ZQZA 1Z4JA 3V1NA 4RU1A 1XYGA 2HRRA 4R54A 1PEKE 3PEUA 2PBLA 1QO7A 2W2MA 5AM0A 3I56B 1VGRA 2WZNA 4RM0A 4G5FA 5B7NA 5EXPA 1SPXA 4CNBA 3IH5A 2AZMA 2Q27A 2V7EA 3O1HB 4GMFA 4YP0A 3ZLTA 1PHRA 3ED5A 3R8CA 4B4UA 4E2WA 2UYHA 3WL8A 3JVVA 1WZIA 3P9IA 5E6UA 3VVMA 1W1WA 3K32A 5HZKA 5GTDA 1QG0A 1GKLA 1TIKA 1AV7A 3EMDA 2BHLA 4G81A 4AY3A 3W9BA 1WY5A 4TL8A 5JXWA 1N4AA 2CFSA 1XF9A 2J5BA 4WY2A 3HVUA 1L4BA 4RPIA 4XARA 3NTLA 4M22A 1L7PA 1T9BA 3B2EA 5SYNA 2I99A 4NZNA 8MHTA 4RK5A 2NGRA 3TLMA 3NC1C 1GCAA 3BMCB 4J1NA 3A9RA 3HB5X 3TLXA 5JJIA 4OHMA 4PANA 1D6SA 1F0PA 1IHDA 1NX9A 2IEZA 3F5SA 1VQ5B 1H5NA 3IHTA 3WLPA 5LQAA 5SICE 2ZUTA 1FDOA 4ITVA 3ZTWA 3EGEA 2ODAA 3KFVA 2JFWA 4HDRA 5EP1A 4HZUA 3FLBA 3GPDG 3P9CA 4J03A 2EU8A 1Z8FA 2QGZA 5AKEA 3VHLB 2JATA 4QQKA 2WM8A 1CUJA 1T6BY 1E1RA 1LTKA 1ZZGA 2FWJA 2JGRA 3TJRA 3U49A 4LDPA 4AK9A 4JWKA 2CF5A 4B3IA 2AXEA 5IT0A 1GKUB 2QQ0A 2IYAA 2WAMA 3RUCA 1FP6A 4Z99A 1R5OA 5H83A 2UXBB 3UGKA 1O2DA 4DPMA 4HH4A 2YJ5A 1R4MB 4OMFG 3WIVA 4Y2YA 4BMXA 3RSFA 1CPYA 1KQFA 1UEJA 3A26A 3GPBA 4JITA 4AG3A 1F60A 5L3QA 1QGYA 2LV8A 2NZWA 2C20A 2JFNA 2BFFB 2X9GA 3JD4A 3JXEA 4TUYF 5E8JA 4C0BA 2VDQB 4IDNA 4RKRA 5EHGA 4XVCA 4FGZA 4UZUA 1MGPA 1FMLA 4D4GA 2H5EA 1OIWA 1K8ZB 3HUFA 4R5HA 3N0XA 3P2EA 3QEJA 2IFTA 2XHZA 5J4KA 3IUPA 2CMGA 1DDGA 4L5YA 4O4JB 4F6LA 4IRXA 3KM0A 3WQRA 4RY0A 2JJ2A 2NU7A 1L3BA