1E6IA

Bromodomain from gcn5 complexed with acetylated h4 peptide
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
110
structure length
110
Chain Sequence
RGPHDAAIQNILTELQNHAAAWPFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVFNNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSCRIPTIONAL ACTIVATOR GCN5
publication title The Structural Basis for the Recognition of Acetylated Histone H4 by the Bromodomain of Histone Acetyltransferase Gcn5P
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Gene regulation
total genus 39
structure length 110
sequence length 110
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2000-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 1e6iA00
5DYAA 5FE5A 3Q2FA 4O7BA 4A9OA 2RI7A 3UVWA 5KTXA 4FLPA 2L85A 4MR5A 4TU4A 4A9EA 3MB3A 4TT2A 5DW2A 2LSPB 5CQ7A 3U5KA 5A5SA 5E74A 3D7CA 4OGIA 5I40A 4O7CA 5E7DA 3LJWA 4NR5A 4QR3A 4QSXA 4HBVA 4CFLA 5I88A 4IR4A 3P1EA 5TB6A 5LKUA 3O34A 4IR6A 5ENHA 4LRGA 5EI4A 5CUGA 5H85A 4ZW1A 4NR7A 5F62A 4UIZA 5I83A 4IR5A 5C85A 4YYJA 4TTEA 3ONIA 5LUUA 3AQAA 5DY7A 4YADA 4QYDA 4QEUA 5CQ3A 3HMFA 4LR6A 5IGNA 5EICA 5KTWA 4ALGA 5A85A 5DKHA 5L98A 5HENA 3ZYUA 5DYUA 2L84A 4NRBA 3QZSA 4CUTA 5LKTA 4PS5A 5CUCA 4HXNA 4Z1SA 5L8TA 5D3TA 5EV9A 5DYCA 5E9IA 5E9MA 4QNSA 4MR6A 5AD2A 3MB4A 5IGMA 4UIVA 5A5OA 5LVQA 5D3PA 5A83A 2OO1A 3NXBA 4YH3A 2RO1A 5EPBA 5DKCA 5F61A 5E9LA 4IR3A 5K29A 4YBMA 2DVVA 5I80A 5EWDA 4O7EA 5FB1A 4O7AA 4QYLA 4LZ2A 4RVRA 5IGKA 5FE7A 4NUCA 3SVGA 5ENGA 5LVRA 5A5QA 4KV1A 3LXJA 5I29A 5IIDA 2DVSA 3U5OA 5HQ6A 2F6JA 4IORA 2YQDA 4XYAA 5G4RA 4HXLA 4IOOA 3SVFA 5D3LA 5FH6A 4NUDA 5AD3A 2E3KA 2I7KA 4QEWA 4XUAA 4Z6IA 2OUOA 3U5NA 5FH8A 4YAXA 5EK9A 5ACYA 5EPRA 4BW1A 4DONA 4CUPA 5DLZA 5BT4A 5CUBA 4YY4A 5LJ2A 4QR5A 3I3JA 4TS8A 5HELA 4QBMA 5E9YA 5CQTA 4LYSA 4E96A 4XY9A 5LJ0A 4F3IA 5D24A 4YYGA 5C4QA 4LC2A 4KV4A 5HJCA 5CRMA 5H1TA 3U5JA 5C8GA 4QB3A 5CQ8A 4NYVA 3DWYA 5CQAA 3UVXA 3LQIA 4YC9A 4HXSA 4AKNA 4QSQA 5L99A 4A9KA 4QSVA 4ZC9A 5EWCA 3Q2EA 3S92A 5HCLA 5BT3A 4YY6A 4N4HA 5EWVA 3P1DA 5HRVA 4TT6A 5HQ7A 4O71A 4TZ2A 4LZRA 2DATA 2FSAA 3MUKA 3JVMA 4N4FA 5D7XA 4NUEA 5F2PA 3U5LA 5FE8A 5LKXA 5CGPA 5HRXA 5HEMA 2R0SA 4MEQA 5D3NA 3AADA 2YW5A 5F60A 3UW9A 4UYFA 4WHUA 3P1CA 5ETBA 4A9FA 4PY6A 4QC1A 4J0SA 2GRCA 4Q0OA 5G4SA 1WUGA 2DVRA 4NR4A 3G0LA 4O72A 5CS8A 5ENBA 5IG6A 4NR6A 3QZVA 4QR4A 5CY9A 2YEMA 4YATA 5EGUA 5FE4A 3UV5A 4CLBA 4CUQA 5I1QA 4HXRA 4PCEA 3LQHA 2YYNA 5F25A 4QY4A 2KTBB 5COIA 5FE9A 4XUBA 5L96A 2RNWA 2R10A 5JI8A 1WUMA 4TYLA 4LDFA 5DLXA 5A5NA 2D9EA 4YYHA 4YABA 5FG6A 2F6NA 5CUEA 3HMEA 4CURA 5CRZA 5DKDA 4MEOA 4KCXA 5KTUA 4PTBA 3P5OA 4UIYA 4UIUA 4NXJA 4BW2A 3DAIA 1F68A 5H1VA 4CUSA 5CQ4A 4MR3A 4NR9A 4C66A 4QSPA 4Z1QA 5KHMA 3U5MA 3UV4A 4Z6HA 4HXKA 4QUUA 4HXMA 5EM3A 4BJXA 2YELA 4UYHA 5CPEA 5A5RA 2DVQA 2D82A 5D3HA 5CU8A 3QZTA 4NQMA 3UVDA 5E3GA 4LYWA 4HBWA 3O35A 4UYFB 4Z93A 3JVLA 5EP7A 5EWHA 2WP2A 4HBYA 5HRWA 5FDZA 4UITA 4QC3A 1JM4B 1N72A 2RNXA 5E9KA 4A9JA 4NQNA 5CUDA 3LQJA 4CFKA 5FH7A 4OUFA 5E73A 4YYIA 4NS5A 5A5PA 4O74A 5HFQA 2RNYA 2YDWA 4UIXA 4OGJA 3P1FA 4A9MA 4TT4A 4YBTA 3UV2A 5DFBA 5A7CA 4MENA 5JWMA 2L5EA 2NXBA 2RFJA 2DWWA 2OSSA 4YYMA 5DBMA 5EA1A 5F3AA 5ETDA 3SVHA 5FBXA 4QZSA 4NR8A 4ZQLA 4Q0NA 1JSPB 5ENEA 4J0RA 3UVYA 4MR4A 5IBNA 5EVAA 4N4GA 3MULA 5FG4A 3O36A 5FG5A 4PKLA 5TCMA 3FKMX 5DW1A 2H60A 3MXFA 4J3IA 2I8NA 4A9NA 5L97A 4TU6A 5CTLA 3K2JA 4MEPA 3G0JA 3HMHA 4NYWA 5CUAA 4O78A 5LKZA 5II2A 2N9GA 4O76A 5DYXA 5E9VA 5FFYA 5II1A 4BW4A 4QSWA 5FFWA 4QSUA 1EQFA 4BW3A 4O70A 5DX4A 2DKWA 4QSSA 3JVJA 5F36A 5D25A 4BHWA 5AMFA 5D3SA 4CUUA 3MQMA 5DFCA 5A81A 4IOQA 4HXOA 4QUTA 4HBXA 5DFDA 2YEKA 2R0VA 5EISA 1X0JA 4O75A 4A9HA 4YBSA 5F5ZA 5EQ1A 4TQNA 4TZ8A 5H1UA 3O33A 4UIWA 4J1PA 4O7FA 5J0DA 5FE1A 4N3WA 5D0CA 3GG3A 5I89A 4NRCA 4YYDA 3RCWA 5CP5A 4C67A 5A82A 5FE2A 5HLSA 5CFWA 4XY8A 4PCIA 2E7OA 4ALHA 3U5PA 4NRAA 4QSRA 5KU3A 4Y03A 5CQ5A 5CZGA 5EU1A 3O37A 4N4IA 5LJ1A 4GPJA 4YYNA 5ENFA 5ENIA 5AMEA 4LYIA 5D26A 5L8UA 4HXPA 5BT5A 3TLPA 4WHWA 5CQ6A 3IU6A 5HFRA 5FB0A 4UYEA 4UYDA 3IU5A 5D3RA 5ENCA 5KO4A 2E7NA 5F1HA 2WP1A 4NYXA 5FE3A 5E3DA 4LZSA 2RS9B 5I7YA 3S91A 5FE0A 5ENJA 4QSTA 5HQ5A 4UYGA 5E0RA 5EWWA 5FE6A 5C7NA 4A9IA 5F1LA 4YH4A 2G4AA 3JVKA 5C89A 2MJVB 4WIVA 5I7XA 4QEVA 5EPSA 5HM0A 4CL9A 1E6IA 4A9LA 4O77A 5IGLA 5D3JA 1ZS5A 4X2IA 4YK0A 5FFVA 5C87A 4YYKA 2R0YA 5F63A 5I86A
chains in the Genus database with same CATH superfamily
5DYAA 5FE5A 3Q2FA 4O7BA 4A9OA 2RI7A 3UVWA 5KTXA 4FLPA 2L85A 4MR5A 4TU4A 4A9EA 3MB3A 4TT2A 5DW2A 2LSPB 5CQ7A 3U5KA 5A5SA 5E74A 3D7CA 4OGIA 5I40A 4O7CA 5E7DA 3LJWA 4NR5A 4QR3A 4QSXA 4HBVA 4CFLA 5I88A 4IR4A 3P1EA 5TB6A 5LKUA 3O34A 4IR6A 5ENHA 4LRGA 5EI4A 5CUGA 5H85A 4ZW1A 4NR7A 5F62A 4UIZA 5I83A 4IR5A 5C85A 4YYJA 4TTEA 3ONIA 5LUUA 3AQAA 5DY7A 4YADA 4QYDA 4QEUA 5CQ3A 3HMFA 4LR6A 5IGNA 5EICA 5KTWA 4ALGA 5A85A 5DKHA 5L98A 5HENA 3ZYUA 5DYUA 2L84A 4NRBA 3QZSA 4CUTA 5LKTA 4PS5A 5CUCA 4HXNA 4Z1SA 5L8TA 5D3TA 5EV9A 5DYCA 5E9IA 5E9MA 4QNSA 4MR6A 5AD2A 3MB4A 5IGMA 4UIVA 5A5OA 5LVQA 5D3PA 5A83A 2OO1A 3NXBA 4YH3A 2RO1A 5EPBA 5DKCA 5F61A 5E9LA 4IR3A 5K29A 4YBMA 2DVVA 3VKGA 5I80A 5EWDA 4O7EA 5FB1A 4O7AA 4QYLA 4LZ2A 4RVRA 5IGKA 5FE7A 3D1BA 4NUCA 3SVGA 5ENGA 5LVRA 5A5QA 4KV1A 3LXJA 5I29A 5IIDA 2DVSA 3U5OA 3D1DA 5HQ6A 2F6JA 4IORA 2YQDA 4XYAA 5G4RA 4HXLA 1PUOA 4IOOA 3SVFA 5D3LA 5FH6A 4NUDA 5AD3A 2E3KA 2I7KA 4QEWA 4XUAA 4Z6IA 2OUOA 3U5NA 5FH8A 4YAXA 5EK9A 5ACYA 5EPRA 4BW1A 4DONA 4CUPA 5DLZA 5BT4A 5CUBA 4YY4A 5LJ2A 4QR5A 3I3JA 4TS8A 5HELA 4QBMA 5E9YA 5CQTA 4LYSA 4E96A 4XY9A 5LJ0A 4F3IA 5D24A 4YYGA 5C4QA 4LC2A 4KV4A 5HJCA 5CRMA 5H1TA 3U5JA 5C8GA 4QB3A 5CQ8A 4NYVA 3DWYA 5CQAA 3UVXA 3LQIA 4YC9A 4HXSA 4AKNA 4QSQA 5L99A 4A9KA 4QSVA 4ZC9A 5EWCA 3Q2EA 3S92A 5HCLA 5BT3A 4YY6A 4N4HA 5EWVA 3P1DA 5HRVA 4TT6A 5HQ7A 4O71A 4TZ2A 4LZRA 2DATA 2FSAA 3MUKA 3JVMA 4N4FA 5D7XA 4NUEA 5F2PA 3U5LA 5FE8A 5LKXA 5CGPA 5HRXA 5HEMA 2R0SA 4MEQA 5D3NA 3AADA 2YW5A 5F60A 3UW9A 4UYFA 4WHUA 3P1CA 5ETBA 4A9FA 4PY6A 4QC1A 4J0SA 2GRCA 4Q0OA 5G4SA 1WUGA 2DVRA 4NR4A 3G0LA 4O72A 5CS8A 5ENBA 5IG6A 4NR6A 3QZVA 4QR4A 5CY9A 2YEMA 4YATA 5EGUA 5FE4A 3UV5A 4CLBA 4CUQA 5I1QA 4HXRA 4PCEA 3LQHA 2YYNA 5F25A 4QY4A 2KTBB 5COIA 5FE9A 4XUBA 5L96A 2RNWA 2R10A 5JI8A 1WUMA 4TYLA 4LDFA 5DLXA 5A5NA 2D9EA 4YYHA 4YABA 5FG6A 2F6NA 5CUEA 3HMEA 4CURA 5CRZA 5DKDA 4MEOA 4KCXA 5KTUA 4PTBA 3P5OA 4UIYA 4UIUA 4NXJA 4BW2A 3DAIA 1F68A 5H1VA 4CUSA 5CQ4A 4MR3A 4NR9A 4C66A 4QSPA 4Z1QA 5KHMA 3U5MA 4AI6A 3UV4A 4Z6HA 4HXKA 4QUUA 4HXMA 5EM3A 4BJXA 4AKIA 2YELA 4UYHA 5CPEA 5A5RA 2DVQA 2D82A 5D3HA 5CU8A 3QZTA 4NQMA 3UVDA 5E3GA 4LYWA 4HBWA 3O35A 4UYFB 4Z93A 3JVLA 5EP7A 5EWHA 2WP2A 4HBYA 5HRWA 5FDZA 4UITA 4QC3A 1JM4B 1N72A 2RNXA 5E9KA 4A9JA 4NQNA 5CUDA 3LQJA 4CFKA 5FH7A 4OUFA 5E73A 4YYIA 4NS5A 5A5PA 4O74A 5HFQA 2RNYA 2YDWA 4UIXA 4OGJA 3P1FA 4A9MA 4TT4A 4YBTA 3UV2A 5DFBA 5A7CA 4MENA 5JWMA 2L5EA 2NXBA 2RFJA 2DWWA 2OSSA 4YYMA 5DBMA 5EA1A 5F3AA 5ETDA 3SVHA 5FBXA 4QZSA 4NR8A 4ZQLA 4Q0NA 1JSPB 5ENEA 4J0RA 3UVYA 4MR4A 5IBNA 5EVAA 4N4GA 3MULA 5FG4A 3O36A 5FG5A 4PKLA 5TCMA 3FKMX 4AKGA 5DW1A 2H60A 3MXFA 4J3IA 2I8NA 4A9NA 5L97A 4TU6A 5CTLA 3K2JA 4MEPA 3ERRA 2EJNA 3G0JA 3HMHA 4NYWA 5CUAA 4O78A 5LKZA 5II2A 2N9GA 3VKHA 4O76A 5DYXA 5E9VA 5FFYA 5II1A 4BW4A 4QSWA 5FFWA 4QSUA 1EQFA 4BW3A 4O70A 5DX4A 2DKWA 4QSSA 3JVJA 5F36A 5D25A 4BHWA 5AMFA 5D3SA 4CUUA 3MQMA 5DFCA 5A81A 4IOQA 4HXOA 4QUTA 4AKHA 4HBXA 5DFDA 2YEKA 2R0VA 5EISA 1X0JA 4O75A 4A9HA 4YBSA 5F5ZA 5EQ1A 4TQNA 4TZ8A 5H1UA 3O33A 4UIWA 4J1PA 4O7FA 5J0DA 5FE1A 4N3WA 5D0CA 3GG3A 5I89A 4NRCA 4YYDA 3RCWA 5CP5A 4C67A 5A82A 5FE2A 5HLSA 5CFWA 4XY8A 4PCIA 2E7OA 4ALHA 3U5PA 4NRAA 4QSRA 5KU3A 4Y03A 5CQ5A 5CZGA 5EU1A 3O37A 4N4IA 5LJ1A 4GPJA 4YYNA 5ENFA 5ENIA 5AMEA 4LYIA 5D26A 5L8UA 4HXPA 5BT5A 3TLPA 4WHWA 5CQ6A 3IU6A 5HFRA 5FB0A 4UYEA 4UYDA 3IU5A 5D3RA 5ENCA 5KO4A 2E7NA 5F1HA 2WP1A 4NYXA 5FE3A 5E3DA 4LZSA 2RS9B 5I7YA 3S91A 5FE0A 5ENJA 4QSTA 5HQ5A 4UYGA 5E0RA 5EWWA 5FE6A 5C7NA 4A9IA 5F1LA 4YH4A 2G4AA 3JVKA 5C89A 2MJVB 4WIVA 5I7XA 4QEVA 5EPSA 5HM0A 4CL9A 1E6IA 4A9LA 4O77A 5IGLA 1ZKRA 5D3JA 1ZS5A 4X2IA 4YK0A 5FFVA 5C87A 4YYKA 2R0YA 5F63A 5I86A
chains in the Genus database with same CATH topology
5DYAA 5FE5A 3Q2FA 4O7BA 4A9OA 2RI7A 3UVWA 5KTXA 4FLPA 2L85A 4MR5A 4TU4A 4A9EA 3MB3A 4TT2A 5DW2A 2LSPB 5CQ7A 3U5KA 5A5SA 5E74A 3D7CA 4OGIA 5I40A 4O7CA 5E7DA 3LJWA 4NR5A 4QR3A 4QSXA 4HBVA 4CFLA 5I88A 4IR4A 3P1EA 5TB6A 5LKUA 3O34A 4IR6A 5ENHA 4LRGA 5EI4A 5CUGA 5H85A 4ZW1A 4NR7A 5F62A 4UIZA 5I83A 4IR5A 5C85A 4YYJA 4TTEA 3ONIA 5LUUA 3AQAA 5DY7A 4YADA 4QYDA 4QEUA 5CQ3A 3HMFA 4LR6A 5IGNA 5EICA 5KTWA 4ALGA 5A85A 5DKHA 5L98A 5HENA 3ZYUA 5DYUA 2L84A 4NRBA 3QZSA 4CUTA 5LKTA 4PS5A 5CUCA 4HXNA 4Z1SA 5L8TA 5D3TA 5EV9A 5DYCA 5E9IA 5E9MA 4QNSA 4MR6A 5AD2A 3MB4A 5IGMA 4UIVA 5A5OA 5LVQA 5D3PA 5A83A 2OO1A 3NXBA 4YH3A 2RO1A 5EPBA 5DKCA 5F61A 5E9LA 4IR3A 5K29A 4YBMA 2DVVA 5I80A 5EWDA 4O7EA 5FB1A 4O7AA 4QYLA 4LZ2A 4RVRA 5IGKA 5FE7A 4NUCA 3SVGA 5ENGA 5LVRA 5A5QA 4KV1A 3LXJA 5I29A 5IIDA 2DVSA 3U5OA 5HQ6A 2F6JA 4IORA 2YQDA 4XYAA 5G4RA 4HXLA 4IOOA 3SVFA 5D3LA 5FH6A 4NUDA 5AD3A 2E3KA 2I7KA 4QEWA 4XUAA 4Z6IA 2OUOA 3U5NA 5FH8A 4YAXA 5EK9A 5ACYA 5EPRA 4BW1A 4DONA 4CUPA 5DLZA 5BT4A 5CUBA 4YY4A 5LJ2A 4QR5A 3I3JA 4TS8A 5HELA 4QBMA 5E9YA 5CQTA 4LYSA 4E96A 4XY9A 5LJ0A 4F3IA 5D24A 4YYGA 5C4QA 4LC2A 4KV4A 5HJCA 5CRMA 5H1TA 3U5JA 5C8GA 4QB3A 5CQ8A 4NYVA 3DWYA 5CQAA 3UVXA 3LQIA 4YC9A 4HXSA 4AKNA 4QSQA 5L99A 4A9KA 4QSVA 4ZC9A 5EWCA 3Q2EA 3S92A 5HCLA 5BT3A 4YY6A 4N4HA 5EWVA 3P1DA 5HRVA 4TT6A 5HQ7A 4O71A 4TZ2A 4LZRA 2DATA 2FSAA 3MUKA 3JVMA 4N4FA 5D7XA 4NUEA 5F2PA 3U5LA 5FE8A 5LKXA 5CGPA 5HRXA 5HEMA 2R0SA 4MEQA 5D3NA 3AADA 2YW5A 5F60A 3UW9A 4UYFA 4WHUA 3P1CA 5ETBA 4A9FA 4PY6A 4QC1A 4J0SA 2GRCA 4Q0OA 5G4SA 1WUGA 2DVRA 4NR4A 3G0LA 4O72A 5CS8A 5ENBA 5IG6A 4NR6A 3QZVA 4QR4A 5CY9A 2YEMA 4YATA 5EGUA 5FE4A 3UV5A 4CLBA 4CUQA 5I1QA 4HXRA 4PCEA 3LQHA 2YYNA 5F25A 4QY4A 2KTBB 5COIA 5FE9A 4XUBA 5L96A 2RNWA 2R10A 5JI8A 1WUMA 4TYLA 4LDFA 5DLXA 5A5NA 2D9EA 4YYHA 4YABA 5FG6A 2F6NA 5CUEA 3HMEA 4CURA 5CRZA 5DKDA 4MEOA 4KCXA 5KTUA 4PTBA 3P5OA 4UIYA 4UIUA 4NXJA 4BW2A 3DAIA 1F68A 5H1VA 4CUSA 5CQ4A 4MR3A 4NR9A 4C66A 4QSPA 4Z1QA 5KHMA 3U5MA 3UV4A 4Z6HA 4HXKA 4QUUA 4HXMA 5EM3A 4BJXA 2YELA 4UYHA 5CPEA 5A5RA 2DVQA 2D82A 5D3HA 5CU8A 3QZTA 4NQMA 3UVDA 5E3GA 4LYWA 4HBWA 3O35A 4UYFB 4Z93A 3JVLA 5EP7A 5EWHA 2WP2A 4HBYA 5HRWA 5FDZA 4UITA 4QC3A 1JM4B 1N72A 2RNXA 5E9KA 4A9JA 4NQNA 5CUDA 3LQJA 4CFKA 5FH7A 4OUFA 5E73A 4YYIA 4NS5A 5A5PA 4O74A 5HFQA 2RNYA 2YDWA 4UIXA 4OGJA 3P1FA 4A9MA 4TT4A 4YBTA 3UV2A 5DFBA 5A7CA 4MENA 5JWMA 2L5EA 2NXBA 2RFJA 2DWWA 2OSSA 4YYMA 5DBMA 5EA1A 5F3AA 5ETDA 3SVHA 5FBXA 4QZSA 4NR8A 4ZQLA 4Q0NA 1JSPB 5ENEA 4J0RA 3UVYA 4MR4A 5IBNA 5EVAA 4N4GA 3MULA 5FG4A 3O36A 5FG5A 4PKLA 5TCMA 3FKMX 5DW1A 2H60A 3MXFA 4J3IA 2I8NA 4A9NA 5L97A 4TU6A 5CTLA 3K2JA 4MEPA 3G0JA 3HMHA 4NYWA 5CUAA 4O78A 5LKZA 5II2A 2N9GA 4O76A 5DYXA 5E9VA 5FFYA 5II1A 4BW4A 4QSWA 5FFWA 4QSUA 1EQFA 4BW3A 4O70A 5DX4A 2DKWA 4QSSA 3JVJA 5F36A 5D25A 4BHWA 5AMFA 5D3SA 4CUUA 3MQMA 5DFCA 5A81A 4IOQA 4HXOA 4QUTA 4HBXA 5DFDA 2YEKA 2R0VA 5EISA 1X0JA 4O75A 4A9HA 4YBSA 5F5ZA 5EQ1A 4TQNA 4TZ8A 5H1UA 3O33A 4UIWA 4J1PA 4O7FA 5J0DA 5FE1A 4N3WA 5D0CA 3GG3A 5I89A 4NRCA 4YYDA 3RCWA 5CP5A 4C67A 5A82A 5FE2A 5HLSA 5CFWA 4XY8A 4PCIA 2E7OA 4ALHA 3U5PA 4NRAA 4QSRA 5KU3A 4Y03A 5CQ5A 5CZGA 5EU1A 3O37A 4N4IA 5LJ1A 4GPJA 4YYNA 5ENFA 5ENIA 5AMEA 4LYIA 5D26A 5L8UA 4HXPA 5BT5A 3TLPA 4WHWA 5CQ6A 3IU6A 5HFRA 5FB0A 4UYEA 4UYDA 3IU5A 5D3RA 5ENCA 5KO4A 2E7NA 5F1HA 2WP1A 4NYXA 5FE3A 5E3DA 4LZSA 2RS9B 5I7YA 3S91A 5FE0A 5ENJA 4QSTA 5HQ5A 4UYGA 5E0RA 5EWWA 5FE6A 5C7NA 4A9IA 5F1LA 4YH4A 2G4AA 3JVKA 5C89A 2MJVB 4WIVA 5I7XA 4QEVA 5EPSA 5HM0A 4CL9A 1E6IA 4A9LA 4O77A 5IGLA 5D3JA 1ZS5A 4X2IA 4YK0A 5FFVA 5C87A 4YYKA 2R0YA 5F63A 5I86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DYA A;  5FE5 A;  3Q2F A;  4O7B A;  4A9O A;  2RI7 A;  3UVW A;  5KTX A;  4FLP A;  2L85 A;  4MR5 A;  4TU4 A;  4A9E A;  3MB3 A;  4TT2 A;  5DW2 A;  2LSP B;  5CQ7 A;  3U5K A;  5A5S A;  5E74 A;  3D7C A;  4OGI A;  5I40 A;  4O7C A;  5E7D A;  3LJW A;  4NR5 A;  4QR3 A;  4QSX A;  4HBV A;  4CFL A;  5I88 A;  4IR4 A;  3P1E A;  5TB6 A;  5LKU A;  3O34 A;  4IR6 A;  5ENH A;  4LRG A;  5EI4 A;  5CUG A;  5H85 A;  4ZW1 A;  4NR7 A;  5F62 A;  4UIZ A;  5I83 A;  4IR5 A;  5C85 A;  4YYJ A;  4TTE A;  3ONI A;  5LUU A;  3AQA A;  5DY7 A;  4YAD A;  4QYD A;  4QEU A;  5CQ3 A;  3HMF A;  4LR6 A;  5IGN A;  5EIC A;  5KTW A;  4ALG A;  5A85 A;  5DKH A;  5L98 A;  5HEN A;  3ZYU A;  5DYU A;  2L84 A;  4NRB A;  3QZS A;  4CUT A;  5LKT A;  4PS5 A;  5CUC A;  4HXN A;  4Z1S A;  5L8T A;  5D3T A;  5EV9 A;  5DYC A;  5E9I A;  5E9M A;  4QNS A;  4MR6 A;  5AD2 A;  3MB4 A;  5IGM A;  4UIV A;  5A5O A;  5LVQ A;  5D3P A;  5A83 A;  2OO1 A;  3NXB A;  4YH3 A;  2RO1 A;  5EPB A;  5DKC A;  5F61 A;  5E9L A;  4IR3 A;  5K29 A;  4YBM A;  2DVV A;  5I80 A;  5EWD A;  4O7E A;  5FB1 A;  4O7A A;  4QYL A;  4LZ2 A;  4RVR A;  5IGK A;  5FE7 A;  4NUC A;  3SVG A;  5ENG A;  5LVR A;  5A5Q A;  4KV1 A;  3LXJ A;  5I29 A;  5IID A;  2DVS A;  3U5O A;  5HQ6 A;  2F6J A;  4IOR A;  2YQD A;  4XYA A;  5G4R A;  4HXL A;  4IOO A;  3SVF A;  5D3L A;  5FH6 A;  4NUD A;  5AD3 A;  2E3K A;  2I7K A;  4QEW A;  4XUA A;  4Z6I A;  2OUO A;  3U5N A;  5FH8 A;  4YAX A;  5EK9 A;  5ACY A;  5EPR A;  4BW1 A;  4DON A;  4CUP A;  5DLZ A;  5BT4 A;  5CUB A;  4YY4 A;  5LJ2 A;  4QR5 A;  3I3J A;  4TS8 A;  5HEL A;  4QBM A;  5E9Y A;  5CQT A;  4LYS A;  4E96 A;  4XY9 A;  5LJ0 A;  4F3I A;  5D24 A;  4YYG A;  5C4Q A;  4LC2 A;  4KV4 A;  5HJC A;  5CRM A;  5H1T A;  3U5J A;  5C8G A;  4QB3 A;  5CQ8 A;  4NYV A;  3DWY A;  5CQA A;  3UVX A;  3LQI A;  4YC9 A;  4HXS A;  4AKN A;  4QSQ A;  5L99 A;  4A9K A;  4QSV A;  4ZC9 A;  5EWC A;  3Q2E A;  3S92 A;  5HCL A;  5BT3 A;  4YY6 A;  4N4H A;  5EWV A;  3P1D A;  5HRV A;  4TT6 A;  5HQ7 A;  4O71 A;  4TZ2 A;  4LZR A;  2DAT A;  2FSA A;  3MUK A;  3JVM A;  4N4F A;  5D7X A;  4NUE A;  5F2P A;  3U5L A;  5FE8 A;  5LKX A;  5CGP A;  5HRX A;  5HEM A;  2R0S A;  4MEQ A;  5D3N A;  3AAD A;  2YW5 A;  5F60 A;  3UW9 A;  4UYF A;  4WHU A;  3P1C A;  5ETB A;  4A9F A;  4PY6 A;  4QC1 A;  4J0S A;  2GRC A;  4Q0O A;  5G4S A;  1WUG A;  2DVR A;  4NR4 A;  3G0L A;  4O72 A;  5CS8 A;  5ENB A;  5IG6 A;  4NR6 A;  3QZV A;  4QR4 A;  5CY9 A;  2YEM A;  4YAT A;  5EGU A;  5FE4 A;  3UV5 A;  4CLB A;  4CUQ A;  5I1Q A;  4HXR A;  4PCE A;  3LQH A;  2YYN A;  5F25 A;  4QY4 A;  2KTB B;  5COI A;  5FE9 A;  4XUB A;  5L96 A;  2RNW A;  2R10 A;  5JI8 A;  1WUM A;  4TYL A;  4LDF A;  5DLX A;  5A5N A;  2D9E A;  4YYH A;  4YAB A;  5FG6 A;  2F6N A;  5CUE A;  3HME A;  4CUR A;  5CRZ A;  5DKD A;  4MEO A;  4KCX A;  5KTU A;  4PTB A;  3P5O A;  4UIY A;  4UIU A;  4NXJ A;  4BW2 A;  3DAI A;  1F68 A;  5H1V A;  4CUS A;  5CQ4 A;  4MR3 A;  4NR9 A;  4C66 A;  4QSP A;  4Z1Q A;  5KHM A;  3U5M A;  3UV4 A;  4Z6H A;  4HXK A;  4QUU A;  4HXM A;  5EM3 A;  4BJX A;  2YEL A;  4UYH A;  5CPE A;  5A5R A;  2DVQ A;  2D82 A;  5D3H A;  5CU8 A;  3QZT A;  4NQM A;  3UVD A;  5E3G A;  4LYW A;  4HBW A;  3O35 A;  4UYF B;  4Z93 A;  3JVL A;  5EP7 A;  5EWH A;  2WP2 A;  4HBY A;  5HRW A;  5FDZ A;  4UIT A;  4QC3 A;  1JM4 B;  1N72 A;  2RNX A;  5E9K A;  4A9J A;  4NQN A;  5CUD A;  3LQJ A;  4CFK A;  5FH7 A;  4OUF A;  5E73 A;  4YYI A;  4NS5 A;  5A5P A;  4O74 A;  5HFQ A;  2RNY A;  2YDW A;  4UIX A;  4OGJ A;  3P1F A;  4A9M A;  4TT4 A;  4YBT A;  3UV2 A;  5DFB A;  5A7C A;  4MEN A;  5JWM A;  2L5E A;  2NXB A;  2RFJ A;  2DWW A;  2OSS A;  4YYM A;  5DBM A;  5EA1 A;  5F3A A;  5ETD A;  3SVH A;  5FBX A;  4QZS A;  4NR8 A;  4ZQL A;  4Q0N A;  1JSP B;  5ENE A;  4J0R A;  3UVY A;  4MR4 A;  5IBN A;  5EVA A;  4N4G A;  3MUL A;  5FG4 A;  3O36 A;  5FG5 A;  4PKL A;  5TCM A;  3FKM X;  5DW1 A;  2H60 A;  3MXF A;  4J3I A;  2I8N A;  4A9N A;  5L97 A;  4TU6 A;  5CTL A;  3K2J A;  4MEP A;  3G0J A;  3HMH A;  4NYW A;  5CUA A;  4O78 A;  5LKZ A;  5II2 A;  2N9G A;  4O76 A;  5DYX A;  5E9V A;  5FFY A;  5II1 A;  4BW4 A;  4QSW A;  5FFW A;  4QSU A;  1EQF A;  4BW3 A;  4O70 A;  5DX4 A;  2DKW A;  4QSS A;  3JVJ A;  5F36 A;  5D25 A;  4BHW A;  5AMF A;  5D3S A;  4CUU A;  3MQM A;  5DFC A;  5A81 A;  4IOQ A;  4HXO A;  4QUT A;  4HBX A;  5DFD A;  2YEK A;  2R0V A;  5EIS A;  1X0J A;  4O75 A;  4A9H A;  4YBS A;  5F5Z A;  5EQ1 A;  4TQN A;  4TZ8 A;  5H1U A;  3O33 A;  4UIW A;  4J1P A;  4O7F A;  5J0D A;  5FE1 A;  4N3W A;  5D0C A;  3GG3 A;  5I89 A;  4NRC A;  4YYD A;  3RCW A;  5CP5 A;  4C67 A;  5A82 A;  5FE2 A;  5HLS A;  5CFW A;  4XY8 A;  4PCI A;  2E7O A;  4ALH A;  3U5P A;  4NRA A;  4QSR A;  5KU3 A;  4Y03 A;  5CQ5 A;  5CZG A;  5EU1 A;  3O37 A;  4N4I A;  5LJ1 A;  4GPJ A;  4YYN A;  5ENF A;  5ENI A;  5AME A;  4LYI A;  5D26 A;  5L8U A;  4HXP A;  5BT5 A;  3TLP A;  4WHW A;  5CQ6 A;  3IU6 A;  5HFR A;  5FB0 A;  4UYE A;  4UYD A;  3IU5 A;  5D3R A;  5ENC A;  5KO4 A;  2E7N A;  5F1H A;  2WP1 A;  4NYX A;  5FE3 A;  5E3D A;  4LZS A;  2RS9 B;  5I7Y A;  3S91 A;  5FE0 A;  5ENJ A;  4QST A;  5HQ5 A;  4UYG A;  5E0R A;  5EWW A;  5FE6 A;  5C7N A;  4A9I A;  5F1L A;  4YH4 A;  2G4A A;  3JVK A;  5C89 A;  2MJV B;  4WIV A;  5I7X A;  4QEV A;  5EPS A;  5HM0 A;  4CL9 A;  1E6I A;  4A9L A;  4O77 A;  5IGL A;  5D3J A;  1ZS5 A;  4X2I A;  4YK0 A;  5FFV A;  5C87 A;  4YYK A;  2R0Y A;  5F63 A;  5I86 A; 
#chains in the Genus database with same CATH topology
 5DYA A;  5FE5 A;  3Q2F A;  4O7B A;  4A9O A;  2RI7 A;  3UVW A;  5KTX A;  4FLP A;  2L85 A;  4MR5 A;  4TU4 A;  4A9E A;  3MB3 A;  4TT2 A;  5DW2 A;  2LSP B;  5CQ7 A;  3U5K A;  5A5S A;  5E74 A;  3D7C A;  4OGI A;  5I40 A;  4O7C A;  5E7D A;  3LJW A;  4NR5 A;  4QR3 A;  4QSX A;  4HBV A;  4CFL A;  5I88 A;  4IR4 A;  3P1E A;  5TB6 A;  5LKU A;  3O34 A;  4IR6 A;  5ENH A;  4LRG A;  5EI4 A;  5CUG A;  5H85 A;  4ZW1 A;  4NR7 A;  5F62 A;  4UIZ A;  5I83 A;  4IR5 A;  5C85 A;  4YYJ A;  4TTE A;  3ONI A;  5LUU A;  3AQA A;  5DY7 A;  4YAD A;  4QYD A;  4QEU A;  5CQ3 A;  3HMF A;  4LR6 A;  5IGN A;  5EIC A;  5KTW A;  4ALG A;  5A85 A;  5DKH A;  5L98 A;  5HEN A;  3ZYU A;  5DYU A;  2L84 A;  4NRB A;  3QZS A;  4CUT A;  5LKT A;  4PS5 A;  5CUC A;  4HXN A;  4Z1S A;  5L8T A;  5D3T A;  5EV9 A;  5DYC A;  5E9I A;  5E9M A;  4QNS A;  4MR6 A;  5AD2 A;  3MB4 A;  5IGM A;  4UIV A;  5A5O A;  5LVQ A;  5D3P A;  5A83 A;  2OO1 A;  3NXB A;  4YH3 A;  2RO1 A;  5EPB A;  5DKC A;  5F61 A;  5E9L A;  4IR3 A;  5K29 A;  4YBM A;  2DVV A;  3VKG A;  5I80 A;  5EWD A;  4O7E A;  5FB1 A;  4O7A A;  4QYL A;  4LZ2 A;  4RVR A;  5IGK A;  5FE7 A;  3D1B A;  4NUC A;  3SVG A;  5ENG A;  5LVR A;  5A5Q A;  4KV1 A;  3LXJ A;  5I29 A;  5IID A;  2DVS A;  3U5O A;  3D1D A;  5HQ6 A;  2F6J A;  4IOR A;  2YQD A;  4XYA A;  5G4R A;  4HXL A;  1PUO A;  4IOO A;  3SVF A;  5D3L A;  5FH6 A;  4NUD A;  5AD3 A;  2E3K A;  2I7K A;  4QEW A;  4XUA A;  4Z6I A;  2OUO A;  3U5N A;  5FH8 A;  4YAX A;  5EK9 A;  5ACY A;  5EPR A;  4BW1 A;  4DON A;  4CUP A;  5DLZ A;  5BT4 A;  5CUB A;  4YY4 A;  5LJ2 A;  4QR5 A;  3I3J A;  4TS8 A;  5HEL A;  4QBM A;  5E9Y A;  5CQT A;  4LYS A;  4E96 A;  4XY9 A;  5LJ0 A;  4F3I A;  5D24 A;  4YYG A;  5C4Q A;  4LC2 A;  4KV4 A;  5HJC A;  5CRM A;  5H1T A;  3U5J A;  5C8G A;  4QB3 A;  5CQ8 A;  4NYV A;  3DWY A;  5CQA A;  3UVX A;  3LQI A;  4YC9 A;  4HXS A;  4AKN A;  4QSQ A;  5L99 A;  4A9K A;  4QSV A;  4ZC9 A;  5EWC A;  3Q2E A;  3S92 A;  5HCL A;  5BT3 A;  4YY6 A;  4N4H A;  5EWV A;  3P1D A;  5HRV A;  4TT6 A;  5HQ7 A;  4O71 A;  4TZ2 A;  4LZR A;  2DAT A;  2FSA A;  3MUK A;  3JVM A;  4N4F A;  5D7X A;  4NUE A;  5F2P A;  3U5L A;  5FE8 A;  5LKX A;  5CGP A;  5HRX A;  5HEM A;  2R0S A;  4MEQ A;  5D3N A;  3AAD A;  2YW5 A;  5F60 A;  3UW9 A;  4UYF A;  4WHU A;  3P1C A;  5ETB A;  4A9F A;  4PY6 A;  4QC1 A;  4J0S A;  2GRC A;  4Q0O A;  5G4S A;  1WUG A;  2DVR A;  4NR4 A;  3G0L A;  4O72 A;  5CS8 A;  5ENB A;  5IG6 A;  4NR6 A;  3QZV A;  4QR4 A;  5CY9 A;  2YEM A;  4YAT A;  5EGU A;  5FE4 A;  3UV5 A;  4CLB A;  4CUQ A;  5I1Q A;  4HXR A;  4PCE A;  3LQH A;  2YYN A;  5F25 A;  4QY4 A;  2KTB B;  5COI A;  5FE9 A;  4XUB A;  5L96 A;  2RNW A;  2R10 A;  5JI8 A;  1WUM A;  4TYL A;  4LDF A;  5DLX A;  5A5N A;  2D9E A;  4YYH A;  4YAB A;  5FG6 A;  2F6N A;  5CUE A;  3HME A;  4CUR A;  5CRZ A;  5DKD A;  4MEO A;  4KCX A;  5KTU A;  4PTB A;  3P5O A;  4UIY A;  4UIU A;  4NXJ A;  4BW2 A;  3DAI A;  1F68 A;  5H1V A;  4CUS A;  5CQ4 A;  4MR3 A;  4NR9 A;  4C66 A;  4QSP A;  4Z1Q A;  5KHM A;  3U5M A;  4AI6 A;  3UV4 A;  4Z6H A;  4HXK A;  4QUU A;  4HXM A;  5EM3 A;  4BJX A;  4AKI A;  2YEL A;  4UYH A;  5CPE A;  5A5R A;  2DVQ A;  2D82 A;  5D3H A;  5CU8 A;  3QZT A;  4NQM A;  3UVD A;  5E3G A;  4LYW A;  4HBW A;  3O35 A;  4UYF B;  4Z93 A;  3JVL A;  5EP7 A;  5EWH A;  2WP2 A;  4HBY A;  5HRW A;  5FDZ A;  4UIT A;  4QC3 A;  1JM4 B;  1N72 A;  2RNX A;  5E9K A;  4A9J A;  4NQN A;  5CUD A;  3LQJ A;  4CFK A;  5FH7 A;  4OUF A;  5E73 A;  4YYI A;  4NS5 A;  5A5P A;  4O74 A;  5HFQ A;  2RNY A;  2YDW A;  4UIX A;  4OGJ A;  3P1F A;  4A9M A;  4TT4 A;  4YBT A;  3UV2 A;  5DFB A;  5A7C A;  4MEN A;  5JWM A;  2L5E A;  2NXB A;  2RFJ A;  2DWW A;  2OSS A;  4YYM A;  5DBM A;  5EA1 A;  5F3A A;  5ETD A;  3SVH A;  5FBX A;  4QZS A;  4NR8 A;  4ZQL A;  4Q0N A;  1JSP B;  5ENE A;  4J0R A;  3UVY A;  4MR4 A;  5IBN A;  5EVA A;  4N4G A;  3MUL A;  5FG4 A;  3O36 A;  5FG5 A;  4PKL A;  5TCM A;  3FKM X;  4AKG A;  5DW1 A;  2H60 A;  3MXF A;  4J3I A;  2I8N A;  4A9N A;  5L97 A;  4TU6 A;  5CTL A;  3K2J A;  4MEP A;  3ERR A;  2EJN A;  3G0J A;  3HMH A;  4NYW A;  5CUA A;  4O78 A;  5LKZ A;  5II2 A;  2N9G A;  3VKH A;  4O76 A;  5DYX A;  5E9V A;  5FFY A;  5II1 A;  4BW4 A;  4QSW A;  5FFW A;  4QSU A;  1EQF A;  4BW3 A;  4O70 A;  5DX4 A;  2DKW A;  4QSS A;  3JVJ A;  5F36 A;  5D25 A;  4BHW A;  5AMF A;  5D3S A;  4CUU A;  3MQM A;  5DFC A;  5A81 A;  4IOQ A;  4HXO A;  4QUT A;  4AKH A;  4HBX A;  5DFD A;  2YEK A;  2R0V A;  5EIS A;  1X0J A;  4O75 A;  4A9H A;  4YBS A;  5F5Z A;  5EQ1 A;  4TQN A;  4TZ8 A;  5H1U A;  3O33 A;  4UIW A;  4J1P A;  4O7F A;  5J0D A;  5FE1 A;  4N3W A;  5D0C A;  3GG3 A;  5I89 A;  4NRC A;  4YYD A;  3RCW A;  5CP5 A;  4C67 A;  5A82 A;  5FE2 A;  5HLS A;  5CFW A;  4XY8 A;  4PCI A;  2E7O A;  4ALH A;  3U5P A;  4NRA A;  4QSR A;  5KU3 A;  4Y03 A;  5CQ5 A;  5CZG A;  5EU1 A;  3O37 A;  4N4I A;  5LJ1 A;  4GPJ A;  4YYN A;  5ENF A;  5ENI A;  5AME A;  4LYI A;  5D26 A;  5L8U A;  4HXP A;  5BT5 A;  3TLP A;  4WHW A;  5CQ6 A;  3IU6 A;  5HFR A;  5FB0 A;  4UYE A;  4UYD A;  3IU5 A;  5D3R A;  5ENC A;  5KO4 A;  2E7N A;  5F1H A;  2WP1 A;  4NYX A;  5FE3 A;  5E3D A;  4LZS A;  2RS9 B;  5I7Y A;  3S91 A;  5FE0 A;  5ENJ A;  4QST A;  5HQ5 A;  4UYG A;  5E0R A;  5EWW A;  5FE6 A;  5C7N A;  4A9I A;  5F1L A;  4YH4 A;  2G4A A;  3JVK A;  5C89 A;  2MJV B;  4WIV A;  5I7X A;  4QEV A;  5EPS A;  5HM0 A;  4CL9 A;  1E6I A;  4A9L A;  4O77 A;  5IGL A;  1ZKR A;  5D3J A;  1ZS5 A;  4X2I A;  4YK0 A;  5FFV A;  5C87 A;  4YYK A;  2R0Y A;  5F63 A;  5I86 A; 
#chains in the Genus database with same CATH homology
 5DYA A;  5FE5 A;  3Q2F A;  4O7B A;  4A9O A;  2RI7 A;  3UVW A;  5KTX A;  4FLP A;  2L85 A;  4MR5 A;  4TU4 A;  4A9E A;  3MB3 A;  4TT2 A;  5DW2 A;  2LSP B;  5CQ7 A;  3U5K A;  5A5S A;  5E74 A;  3D7C A;  4OGI A;  5I40 A;  4O7C A;  5E7D A;  3LJW A;  4NR5 A;  4QR3 A;  4QSX A;  4HBV A;  4CFL A;  5I88 A;  4IR4 A;  3P1E A;  5TB6 A;  5LKU A;  3O34 A;  4IR6 A;  5ENH A;  4LRG A;  5EI4 A;  5CUG A;  5H85 A;  4ZW1 A;  4NR7 A;  5F62 A;  4UIZ A;  5I83 A;  4IR5 A;  5C85 A;  4YYJ A;  4TTE A;  3ONI A;  5LUU A;  3AQA A;  5DY7 A;  4YAD A;  4QYD A;  4QEU A;  5CQ3 A;  3HMF A;  4LR6 A;  5IGN A;  5EIC A;  5KTW A;  4ALG A;  5A85 A;  5DKH A;  5L98 A;  5HEN A;  3ZYU A;  5DYU A;  2L84 A;  4NRB A;  3QZS A;  4CUT A;  5LKT A;  4PS5 A;  5CUC A;  4HXN A;  4Z1S A;  5L8T A;  5D3T A;  5EV9 A;  5DYC A;  5E9I A;  5E9M A;  4QNS A;  4MR6 A;  5AD2 A;  3MB4 A;  5IGM A;  4UIV A;  5A5O A;  5LVQ A;  5D3P A;  5A83 A;  2OO1 A;  3NXB A;  4YH3 A;  2RO1 A;  5EPB A;  5DKC A;  5F61 A;  5E9L A;  4IR3 A;  5K29 A;  4YBM A;  2DVV A;  5I80 A;  5EWD A;  4O7E A;  5FB1 A;  4O7A A;  4QYL A;  4LZ2 A;  4RVR A;  5IGK A;  5FE7 A;  4NUC A;  3SVG A;  5ENG A;  5LVR A;  5A5Q A;  4KV1 A;  3LXJ A;  5I29 A;  5IID A;  2DVS A;  3U5O A;  5HQ6 A;  2F6J A;  4IOR A;  2YQD A;  4XYA A;  5G4R A;  4HXL A;  4IOO A;  3SVF A;  5D3L A;  5FH6 A;  4NUD A;  5AD3 A;  2E3K A;  2I7K A;  4QEW A;  4XUA A;  4Z6I A;  2OUO A;  3U5N A;  5FH8 A;  4YAX A;  5EK9 A;  5ACY A;  5EPR A;  4BW1 A;  4DON A;  4CUP A;  5DLZ A;  5BT4 A;  5CUB A;  4YY4 A;  5LJ2 A;  4QR5 A;  3I3J A;  4TS8 A;  5HEL A;  4QBM A;  5E9Y A;  5CQT A;  4LYS A;  4E96 A;  4XY9 A;  5LJ0 A;  4F3I A;  5D24 A;  4YYG A;  5C4Q A;  4LC2 A;  4KV4 A;  5HJC A;  5CRM A;  5H1T A;  3U5J A;  5C8G A;  4QB3 A;  5CQ8 A;  4NYV A;  3DWY A;  5CQA A;  3UVX A;  3LQI A;  4YC9 A;  4HXS A;  4AKN A;  4QSQ A;  5L99 A;  4A9K A;  4QSV A;  4ZC9 A;  5EWC A;  3Q2E A;  3S92 A;  5HCL A;  5BT3 A;  4YY6 A;  4N4H A;  5EWV A;  3P1D A;  5HRV A;  4TT6 A;  5HQ7 A;  4O71 A;  4TZ2 A;  4LZR A;  2DAT A;  2FSA A;  3MUK A;  3JVM A;  4N4F A;  5D7X A;  4NUE A;  5F2P A;  3U5L A;  5FE8 A;  5LKX A;  5CGP A;  5HRX A;  5HEM A;  2R0S A;  4MEQ A;  5D3N A;  3AAD A;  2YW5 A;  5F60 A;  3UW9 A;  4UYF A;  4WHU A;  3P1C A;  5ETB A;  4A9F A;  4PY6 A;  4QC1 A;  4J0S A;  2GRC A;  4Q0O A;  5G4S A;  1WUG A;  2DVR A;  4NR4 A;  3G0L A;  4O72 A;  5CS8 A;  5ENB A;  5IG6 A;  4NR6 A;  3QZV A;  4QR4 A;  5CY9 A;  2YEM A;  4YAT A;  5EGU A;  5FE4 A;  3UV5 A;  4CLB A;  4CUQ A;  5I1Q A;  4HXR A;  4PCE A;  3LQH A;  2YYN A;  5F25 A;  4QY4 A;  2KTB B;  5COI A;  5FE9 A;  4XUB A;  5L96 A;  2RNW A;  2R10 A;  5JI8 A;  1WUM A;  4TYL A;  4LDF A;  5DLX A;  5A5N A;  2D9E A;  4YYH A;  4YAB A;  5FG6 A;  2F6N A;  5CUE A;  3HME A;  4CUR A;  5CRZ A;  5DKD A;  4MEO A;  4KCX A;  5KTU A;  4PTB A;  3P5O A;  4UIY A;  4UIU A;  4NXJ A;  4BW2 A;  3DAI A;  1F68 A;  5H1V A;  4CUS A;  5CQ4 A;  4MR3 A;  4NR9 A;  4C66 A;  4QSP A;  4Z1Q A;  5KHM A;  3U5M A;  3UV4 A;  4Z6H A;  4HXK A;  4QUU A;  4HXM A;  5EM3 A;  4BJX A;  2YEL A;  4UYH A;  5CPE A;  5A5R A;  2DVQ A;  2D82 A;  5D3H A;  5CU8 A;  3QZT A;  4NQM A;  3UVD A;  5E3G A;  4LYW A;  4HBW A;  3O35 A;  4UYF B;  4Z93 A;  3JVL A;  5EP7 A;  5EWH A;  2WP2 A;  4HBY A;  5HRW A;  5FDZ A;  4UIT A;  4QC3 A;  1JM4 B;  1N72 A;  2RNX A;  5E9K A;  4A9J A;  4NQN A;  5CUD A;  3LQJ A;  4CFK A;  5FH7 A;  4OUF A;  5E73 A;  4YYI A;  4NS5 A;  5A5P A;  4O74 A;  5HFQ A;  2RNY A;  2YDW A;  4UIX A;  4OGJ A;  3P1F A;  4A9M A;  4TT4 A;  4YBT A;  3UV2 A;  5DFB A;  5A7C A;  4MEN A;  5JWM A;  2L5E A;  2NXB A;  2RFJ A;  2DWW A;  2OSS A;  4YYM A;  5DBM A;  5EA1 A;  5F3A A;  5ETD A;  3SVH A;  5FBX A;  4QZS A;  4NR8 A;  4ZQL A;  4Q0N A;  1JSP B;  5ENE A;  4J0R A;  3UVY A;  4MR4 A;  5IBN A;  5EVA A;  4N4G A;  3MUL A;  5FG4 A;  3O36 A;  5FG5 A;  4PKL A;  5TCM A;  3FKM X;  5DW1 A;  2H60 A;  3MXF A;  4J3I A;  2I8N A;  4A9N A;  5L97 A;  4TU6 A;  5CTL A;  3K2J A;  4MEP A;  3G0J A;  3HMH A;  4NYW A;  5CUA A;  4O78 A;  5LKZ A;  5II2 A;  2N9G A;  4O76 A;  5DYX A;  5E9V A;  5FFY A;  5II1 A;  4BW4 A;  4QSW A;  5FFW A;  4QSU A;  1EQF A;  4BW3 A;  4O70 A;  5DX4 A;  2DKW A;  4QSS A;  3JVJ A;  5F36 A;  5D25 A;  4BHW A;  5AMF A;  5D3S A;  4CUU A;  3MQM A;  5DFC A;  5A81 A;  4IOQ A;  4HXO A;  4QUT A;  4HBX A;  5DFD A;  2YEK A;  2R0V A;  5EIS A;  1X0J A;  4O75 A;  4A9H A;  4YBS A;  5F5Z A;  5EQ1 A;  4TQN A;  4TZ8 A;  5H1U A;  3O33 A;  4UIW A;  4J1P A;  4O7F A;  5J0D A;  5FE1 A;  4N3W A;  5D0C A;  3GG3 A;  5I89 A;  4NRC A;  4YYD A;  3RCW A;  5CP5 A;  4C67 A;  5A82 A;  5FE2 A;  5HLS A;  5CFW A;  4XY8 A;  4PCI A;  2E7O A;  4ALH A;  3U5P A;  4NRA A;  4QSR A;  5KU3 A;  4Y03 A;  5CQ5 A;  5CZG A;  5EU1 A;  3O37 A;  4N4I A;  5LJ1 A;  4GPJ A;  4YYN A;  5ENF A;  5ENI A;  5AME A;  4LYI A;  5D26 A;  5L8U A;  4HXP A;  5BT5 A;  3TLP A;  4WHW A;  5CQ6 A;  3IU6 A;  5HFR A;  5FB0 A;  4UYE A;  4UYD A;  3IU5 A;  5D3R A;  5ENC A;  5KO4 A;  2E7N A;  5F1H A;  2WP1 A;  4NYX A;  5FE3 A;  5E3D A;  4LZS A;  2RS9 B;  5I7Y A;  3S91 A;  5FE0 A;  5ENJ A;  4QST A;  5HQ5 A;  4UYG A;  5E0R A;  5EWW A;  5FE6 A;  5C7N A;  4A9I A;  5F1L A;  4YH4 A;  2G4A A;  3JVK A;  5C89 A;  2MJV B;  4WIV A;  5I7X A;  4QEV A;  5EPS A;  5HM0 A;  4CL9 A;  1E6I A;  4A9L A;  4O77 A;  5IGL A;  5D3J A;  1ZS5 A;  4X2I A;  4YK0 A;  5FFV A;  5C87 A;  4YYK A;  2R0Y A;  5F63 A;  5I86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...