1E6IA

Bromodomain from gcn5 complexed with acetylated h4 peptide
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
110
structure length
110
Chain Sequence
RGPHDAAIQNILTELQNHAAAWPFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVFNNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSCRIPTIONAL ACTIVATOR GCN5
publication title The Structural Basis for the Recognition of Acetylated Histone H4 by the Bromodomain of Histone Acetyltransferase Gcn5P
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Gene regulation
total genus 39
structure length 110
sequence length 110
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2000-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 1e6iA00
3G0LA 4UYHA 5IGKA 4KV1A 4A9MA 4QC1A 5DY7A 2L84A 5E3DA 5FE9A 4QYLA 5A83A 2N9GA 3FKMX 5C8GA 4IR6A 5I7XA 5A81A 4HXNA 5A5RA 5EICA 3IU6A 4NR6A 4NR8A 4N4HA 4LR6A 5FE2A 3MXFA 2RNYA 4IR5A 4N4IA 5F25A 5D24A 3MB3A 5D3RA 5A82A 2KTBB 5G4SA 3MB4A 4MR5A 2R0VA 4XY8A 4TT4A 5L8TA 4XYAA 5ENBA 4UIUA 4MR3A 4ZW1A 3S92A 5EISA 4YH3A 4O76A 5C87A 2RO1A 1JM4B 5A5OA 4LDFA 3O37A 3MULA 5DFDA 4YYJA 4O75A 5E0RA 3GG3A 5FE3A 4LC2A 5F5ZA 2DATA 4O72A 3LQJA 4PKLA 4MEQA 3UV4A 5DW2A 3I3JA 4O77A 4TTEA 5KO4A 4A9EA 5HQ5A 4YBTA 5AMEA 5BT3A 4TT2A 5E9VA 4NUCA 4YYDA 5LJ2A 3P1CA 5LJ1A 4YATA 5IGLA 3QZSA 3Q2EA 5CQ8A 4LYIA 4IR3A 2L5EA 5H1TA 5DYAA 4XUAA 4YYMA 4J0SA 4O7FA 5I80A 5E9MA 4CFLA 2L85A 5CRMA 4QZSA 5CU8A 5D3TA 2RFJA 3ZYUA 2E7NA 3G0JA 5ENCA 4PY6A 5FE1A 5CGPA 5CUAA 4O74A 4NXJA 2F6JA 2YW5A 2RNXA 5LKUA 5KHMA 5HENA 4A9JA 5DW1A 4GPJA 5DYUA 4QUUA 3SVFA 5CUDA 2LSPB 5EWDA 3O33A 3LJWA 4NR7A 2GRCA 2WP1A 5LKTA 5DLXA 4MEPA 5D3SA 5FFYA 5KU3A 5FG5A 5II2A 1EQFA 4CURA 4TZ2A 4TQNA 5DKHA 5E9KA 4BJXA 5L97A 2YDWA 5DX4A 5J0DA 3S91A 4QC3A 5CQ4A 3HMFA 4J0RA 4UIWA 3JVKA 4ZQLA 5D3NA 4UYFA 4UIVA 4PCEA 5A5NA 5A5SA 5DKCA 5E9YA 4HXLA 4O70A 4CUPA 5EWHA 2YEMA 5FDZA 5CY9A 3JVMA 5A5PA 5CQTA 4MEOA 5K29A 5L8UA 3UV5A 3ONIA 3AQAA 4UIXA 4IOQA 4LZRA 5HQ6A 4DONA 3TLPA 5E74A 4YBSA 5D26A 4Z93A 4CL9A 4UYEA 5ETBA 2F6NA 4MR4A 4QYDA 5F2PA 4YH4A 3D7CA 5CQ7A 4YC9A 4YYHA 2MJVB 4IORA 5EWWA 5E73A 3P5OA 2DWWA 3UV2A 5HFRA 4YY6A 3RCWA 4NRAA 5FB1A 4QBMA 5KTUA 5CQ3A 2G4AA 5CUBA 5ETDA 4C67A 4UITA 5C85A 1JSPB 4QSXA 5CPEA 5DBMA 3DWYA 4KCXA 4BW2A 4QEVA 4AKNA 5ENIA 4HXPA 3NXBA 1X0JA 4OGJA 2I8NA 3P1DA 5D0CA 4NYXA 5LUUA 5HLSA 5HJCA 4O7CA 3UVWA 5CQ5A 4NRCA 4QSQA 5IIDA 2I7KA 3U5OA 5JWMA 5HRXA 5F36A 3LXJA 4UYFB 5I40A 4UIYA 5DYXA 4YYGA 2YYNA 5IG6A 2E7OA 3U5PA 5CUGA 5E9IA 4O7BA 2DVRA 5A7CA 5F62A 5TB6A 4QY4A 5C4QA 2R10A 5FBXA 4HBWA 3JVLA 4CUTA 5EPBA 5FH7A 5E9LA 5CZGA 4HBVA 4QSTA 5CFWA 3P1FA 5CTLA 2WP2A 5FE0A 3QZVA 5LVRA 5EPRA 4PTBA 5ENJA 4XUBA 4LYWA 5CUCA 5I89A 4LZ2A 4QSRA 4YK0A 4BW4A 4NQNA 2OO1A 4X2IA 5F3AA 5D3PA 4NS5A 5II1A 5IBNA 4NRBA 4NR5A 4F3IA 5BT5A 4BW1A 2DKWA 2DVSA 4TU4A 2FSAA 4YYIA 1WUMA 5E7DA 5I1QA 5F61A 4A9FA 5EK9A 3UVDA 4Z6IA 2R0SA 5HQ7A 4A9LA 4MENA 5H85A 5I86A 1F68A 2DVQA 5EWVA 4YYNA 3U5MA 5DFBA 1WUGA 4QEUA 2H60A 4J3IA 5D7XA 1E6IA 4QSWA 4NYVA 4QEWA 5I88A 4XY9A 5KTWA 4UYGA 4CLBA 2OSSA 4Z1QA 2YELA 5ENHA 5LVQA 3QZTA 5ENFA 4HXKA 5EGUA 4LZSA 4ALHA 5CRZA 5I7YA 5IGMA 3UVYA 4Y03A 3O35A 4N4FA 4NR9A 4YYKA 4ALGA 4UYDA 4TT6A 5HELA 4QSVA 2E3KA 5FE8A 5H1UA 4QR5A 2YEKA 3U5NA 2D82A 5FG6A 5HRVA 4BHWA 5EA1A 5G4RA 2RNWA 3U5KA 3IU5A 5L99A 3LQHA 3UW9A 4E96A 4QR4A 4QUTA 5DLZA 4HXRA 4WHUA 5EP7A 3SVGA 4CUQA 4NUDA 4NR4A 4O71A 2OUOA 5I83A 4LYSA 5FE6A 4LRGA 3HMHA 5F1LA 5CQ6A 4YBMA 4QSPA 5H1VA 5EV9A 5HEMA 5I29A 5KTXA 4Z1SA 5HCLA 4YADA 5ENGA 3HMEA 4NQMA 3P1EA 4A9OA 5JI8A 4TS8A 5E3GA 4A9KA 5HRWA 5FG4A 5HM0A 5D3LA 5FB0A 4QR3A 5FH8A 5D25A 4QNSA 5DFCA 5A85A 5AMFA 4HBYA 4QSSA 2NXBA 5FH6A 4MR6A 5L96A 5ACYA 4HXOA 4CUSA 3MQMA 3DAIA 4QB3A 4FLPA 4Q0NA 4A9HA 5EWCA 5FFWA 5AD2A 5LKZA 5FE7A 5CQAA 3K2JA 5FE5A 5D3HA 5FE4A 4Z6HA 4UIZA 5D3JA 5EI4A 5EM3A 4CFKA 3O36A 4IR4A 4YABA 3LQIA 5F1HA 5F60A 4HBXA 5IGNA 4NYWA 4O7EA 4NUEA 5BT4A 4PCIA 2RS9B 5DKDA 4C66A 4A9NA 5CS8A 4YAXA 4YY4A 5DYCA 5COIA 5EPSA 4IOOA 4J1PA 3MUKA 4N3WA 4HXSA 3SVHA 4N4GA 5EQ1A 5FFVA 5A5QA 5TCMA 4TZ8A 4OGIA 5C7NA 5F63A 3Q2FA 1ZS5A 4KV4A 4WIVA 5ENEA 4HXMA 4QSUA 3JVJA 3U5JA 2D9EA 2R0YA 5CP5A 4TU6A 2YQDA 3UVXA 4ZC9A 5EU1A 5C89A 5CUEA 4CUUA 4WHWA 1N72A 5EVAA 4A9IA 4OUFA 5HFQA 5LJ0A 4TYLA 4O78A 4BW3A 2DVVA 4RVRA 3AADA 2RI7A 5L98A 5LKXA 4O7AA 4Q0OA 3O34A 3U5LA 5AD3A 4PS5A
chains in the Genus database with same CATH superfamily
3G0LA 4UYHA 5IGKA 4KV1A 4A9MA 4QC1A 5DY7A 2L84A 5E3DA 5FE9A 4QYLA 5A83A 2N9GA 3FKMX 5C8GA 4IR6A 5I7XA 5A81A 4HXNA 5A5RA 5EICA 3IU6A 4NR6A 4NR8A 4N4HA 4LR6A 5FE2A 3MXFA 2RNYA 4IR5A 4N4IA 5F25A 5D24A 3MB3A 5D3RA 5A82A 2KTBB 5G4SA 3MB4A 4MR5A 2R0VA 4XY8A 4TT4A 5L8TA 4XYAA 5ENBA 4UIUA 4MR3A 4ZW1A 3S92A 5EISA 4YH3A 4O76A 5C87A 2RO1A 1JM4B 5A5OA 4LDFA 3O37A 3MULA 5DFDA 4YYJA 4O75A 5E0RA 3GG3A 5FE3A 4LC2A 5F5ZA 2DATA 4O72A 3LQJA 4PKLA 4MEQA 3UV4A 5DW2A 3I3JA 4O77A 4TTEA 5KO4A 4A9EA 1PUOA 5HQ5A 4YBTA 5AMEA 5BT3A 4TT2A 5E9VA 4NUCA 4YYDA 5LJ2A 3P1CA 5LJ1A 4YATA 5IGLA 3QZSA 3Q2EA 5CQ8A 4LYIA 4IR3A 2L5EA 5H1TA 5DYAA 4XUAA 4YYMA 4J0SA 4O7FA 5I80A 5E9MA 4CFLA 2L85A 5CRMA 4QZSA 5CU8A 5D3TA 2RFJA 3ZYUA 2E7NA 3G0JA 5ENCA 4PY6A 5FE1A 5CGPA 5CUAA 4AKIA 4O74A 4NXJA 2F6JA 2YW5A 2RNXA 5LKUA 5KHMA 5HENA 4A9JA 5DW1A 4GPJA 5DYUA 4QUUA 3SVFA 5CUDA 2LSPB 5EWDA 3O33A 3LJWA 4NR7A 2GRCA 2WP1A 5LKTA 5DLXA 4MEPA 5D3SA 5FFYA 5KU3A 5FG5A 5II2A 1EQFA 4CURA 4TZ2A 4TQNA 5DKHA 5E9KA 4BJXA 5L97A 2YDWA 5DX4A 5J0DA 3S91A 4QC3A 5CQ4A 3HMFA 4J0RA 4UIWA 3JVKA 4ZQLA 5D3NA 4UYFA 4UIVA 4PCEA 5A5NA 5A5SA 5DKCA 5E9YA 4HXLA 4O70A 4CUPA 5EWHA 2YEMA 5FDZA 2EJNA 5CY9A 3JVMA 5A5PA 5CQTA 4MEOA 5K29A 5L8UA 3UV5A 3ONIA 3AQAA 4UIXA 4IOQA 4LZRA 5HQ6A 4DONA 3TLPA 5E74A 4YBSA 5D26A 4Z93A 4CL9A 4UYEA 5ETBA 2F6NA 4MR4A 4QYDA 5F2PA 4YH4A 3D7CA 5CQ7A 4YC9A 4YYHA 2MJVB 3VKGA 4IORA 5EWWA 5E73A 3P5OA 2DWWA 3UV2A 5HFRA 4YY6A 3RCWA 3ERRA 4NRAA 5FB1A 4QBMA 5KTUA 4AKGA 5CQ3A 2G4AA 5CUBA 5ETDA 4C67A 4UITA 5C85A 1JSPB 4QSXA 5CPEA 5DBMA 3DWYA 4KCXA 4BW2A 4QEVA 4AKNA 5ENIA 4HXPA 3NXBA 1X0JA 4OGJA 2I8NA 3P1DA 5D0CA 4NYXA 5LUUA 5HLSA 5HJCA 4O7CA 3UVWA 5CQ5A 4NRCA 4QSQA 5IIDA 2I7KA 3U5OA 5JWMA 5HRXA 5F36A 3LXJA 4UYFB 5I40A 4UIYA 5DYXA 4YYGA 2YYNA 5IG6A 2E7OA 3U5PA 5CUGA 5E9IA 4O7BA 2DVRA 5A7CA 5F62A 5TB6A 4QY4A 5C4QA 2R10A 5FBXA 4HBWA 3JVLA 4CUTA 5EPBA 5FH7A 5E9LA 5CZGA 4HBVA 4QSTA 5CFWA 3P1FA 5CTLA 2WP2A 5FE0A 3QZVA 5LVRA 5EPRA 4PTBA 4AI6A 5ENJA 4XUBA 4LYWA 5CUCA 5I89A 4LZ2A 4QSRA 4YK0A 4BW4A 4NQNA 2OO1A 4X2IA 5F3AA 5D3PA 4NS5A 5II1A 5IBNA 4NRBA 4NR5A 4F3IA 5BT5A 4BW1A 2DKWA 2DVSA 4TU4A 2FSAA 4YYIA 1WUMA 1ZKRA 5E7DA 5I1QA 5F61A 4A9FA 5EK9A 3UVDA 4Z6IA 2R0SA 5HQ7A 4A9LA 4MENA 5H85A 5I86A 1F68A 2DVQA 5EWVA 4YYNA 3U5MA 5DFBA 1WUGA 4QEUA 2H60A 4J3IA 5D7XA 1E6IA 4QSWA 4NYVA 4QEWA 5I88A 4XY9A 5KTWA 4UYGA 4CLBA 2OSSA 4Z1QA 2YELA 5ENHA 5LVQA 3QZTA 5ENFA 4HXKA 5EGUA 4LZSA 4ALHA 5CRZA 5I7YA 5IGMA 3UVYA 4Y03A 3O35A 4N4FA 3D1BA 4NR9A 4YYKA 4ALGA 4UYDA 4TT6A 5HELA 4QSVA 2E3KA 5FE8A 5H1UA 4QR5A 2YEKA 3U5NA 2D82A 5FG6A 5HRVA 4BHWA 5EA1A 5G4RA 2RNWA 3U5KA 3IU5A 5L99A 3LQHA 3UW9A 4E96A 4QR4A 4QUTA 5DLZA 4HXRA 4WHUA 4AKHA 5EP7A 3SVGA 4CUQA 4NUDA 4NR4A 4O71A 2OUOA 5I83A 4LYSA 5FE6A 4LRGA 3HMHA 5F1LA 5CQ6A 4YBMA 4QSPA 5H1VA 5EV9A 5HEMA 5I29A 5KTXA 4Z1SA 5HCLA 4YADA 5ENGA 3HMEA 4NQMA 3P1EA 4A9OA 5JI8A 4TS8A 5E3GA 4A9KA 5HRWA 5FG4A 5HM0A 5D3LA 5FB0A 4QR3A 5FH8A 5D25A 4QNSA 5DFCA 5A85A 5AMFA 4HBYA 4QSSA 2NXBA 5FH6A 4MR6A 5L96A 5ACYA 4HXOA 4CUSA 3MQMA 3DAIA 4QB3A 4FLPA 4Q0NA 4A9HA 5EWCA 5FFWA 5AD2A 5LKZA 5FE7A 5CQAA 3K2JA 5FE5A 5D3HA 5FE4A 4Z6HA 4UIZA 5D3JA 5EI4A 5EM3A 4CFKA 3D1DA 3O36A 4IR4A 4YABA 3LQIA 5F1HA 5F60A 4HBXA 5IGNA 4NYWA 4O7EA 4NUEA 5BT4A 4PCIA 2RS9B 5DKDA 4C66A 4A9NA 5CS8A 4YAXA 4YY4A 5DYCA 5COIA 5EPSA 4IOOA 4J1PA 3MUKA 4N3WA 4HXSA 3SVHA 4N4GA 5EQ1A 5FFVA 5A5QA 5TCMA 4TZ8A 4OGIA 5C7NA 5F63A 3Q2FA 1ZS5A 4KV4A 4WIVA 5ENEA 4HXMA 4QSUA 3JVJA 3U5JA 2D9EA 2R0YA 5CP5A 4TU6A 2YQDA 3UVXA 4ZC9A 5EU1A 5C89A 5CUEA 4CUUA 4WHWA 1N72A 5EVAA 4A9IA 4OUFA 5HFQA 5LJ0A 4TYLA 4O78A 4BW3A 3VKHA 2DVVA 4RVRA 3AADA 2RI7A 5L98A 5LKXA 4O7AA 4Q0OA 3O34A 3U5LA 5AD3A 4PS5A
chains in the Genus database with same CATH topology
3G0LA 4UYHA 5IGKA 4KV1A 4A9MA 4QC1A 5DY7A 2L84A 5E3DA 5FE9A 4QYLA 5A83A 2N9GA 3FKMX 5C8GA 4IR6A 5I7XA 5A81A 4HXNA 5A5RA 5EICA 3IU6A 4NR6A 4NR8A 4N4HA 4LR6A 5FE2A 3MXFA 2RNYA 4IR5A 4N4IA 5F25A 5D24A 3MB3A 5D3RA 5A82A 2KTBB 5G4SA 3MB4A 4MR5A 2R0VA 4XY8A 4TT4A 5L8TA 4XYAA 5ENBA 4UIUA 4MR3A 4ZW1A 3S92A 5EISA 4YH3A 4O76A 5C87A 2RO1A 1JM4B 5A5OA 4LDFA 3O37A 3MULA 5DFDA 4YYJA 4O75A 5E0RA 3GG3A 5FE3A 4LC2A 5F5ZA 2DATA 4O72A 3LQJA 4PKLA 4MEQA 3UV4A 5DW2A 3I3JA 4O77A 4TTEA 5KO4A 4A9EA 5HQ5A 4YBTA 5AMEA 5BT3A 4TT2A 5E9VA 4NUCA 4YYDA 5LJ2A 3P1CA 5LJ1A 4YATA 5IGLA 3QZSA 3Q2EA 5CQ8A 4LYIA 4IR3A 2L5EA 5H1TA 5DYAA 4XUAA 4YYMA 4J0SA 4O7FA 5I80A 5E9MA 4CFLA 2L85A 5CRMA 4QZSA 5CU8A 5D3TA 2RFJA 3ZYUA 2E7NA 3G0JA 5ENCA 4PY6A 5FE1A 5CGPA 5CUAA 4O74A 4NXJA 2F6JA 2YW5A 2RNXA 5LKUA 5KHMA 5HENA 4A9JA 5DW1A 4GPJA 5DYUA 4QUUA 3SVFA 5CUDA 2LSPB 5EWDA 3O33A 3LJWA 4NR7A 2GRCA 2WP1A 5LKTA 5DLXA 4MEPA 5D3SA 5FFYA 5KU3A 5FG5A 5II2A 1EQFA 4CURA 4TZ2A 4TQNA 5DKHA 5E9KA 4BJXA 5L97A 2YDWA 5DX4A 5J0DA 3S91A 4QC3A 5CQ4A 3HMFA 4J0RA 4UIWA 3JVKA 4ZQLA 5D3NA 4UYFA 4UIVA 4PCEA 5A5NA 5A5SA 5DKCA 5E9YA 4HXLA 4O70A 4CUPA 5EWHA 2YEMA 5FDZA 5CY9A 3JVMA 5A5PA 5CQTA 4MEOA 5K29A 5L8UA 3UV5A 3ONIA 3AQAA 4UIXA 4IOQA 4LZRA 5HQ6A 4DONA 3TLPA 5E74A 4YBSA 5D26A 4Z93A 4CL9A 4UYEA 5ETBA 2F6NA 4MR4A 4QYDA 5F2PA 4YH4A 3D7CA 5CQ7A 4YC9A 4YYHA 2MJVB 4IORA 5EWWA 5E73A 3P5OA 2DWWA 3UV2A 5HFRA 4YY6A 3RCWA 4NRAA 5FB1A 4QBMA 5KTUA 5CQ3A 2G4AA 5CUBA 5ETDA 4C67A 4UITA 5C85A 1JSPB 4QSXA 5CPEA 5DBMA 3DWYA 4KCXA 4BW2A 4QEVA 4AKNA 5ENIA 4HXPA 3NXBA 1X0JA 4OGJA 2I8NA 3P1DA 5D0CA 4NYXA 5LUUA 5HLSA 5HJCA 4O7CA 3UVWA 5CQ5A 4NRCA 4QSQA 5IIDA 2I7KA 3U5OA 5JWMA 5HRXA 5F36A 3LXJA 4UYFB 5I40A 4UIYA 5DYXA 4YYGA 2YYNA 5IG6A 2E7OA 3U5PA 5CUGA 5E9IA 4O7BA 2DVRA 5A7CA 5F62A 5TB6A 4QY4A 5C4QA 2R10A 5FBXA 4HBWA 3JVLA 4CUTA 5EPBA 5FH7A 5E9LA 5CZGA 4HBVA 4QSTA 5CFWA 3P1FA 5CTLA 2WP2A 5FE0A 3QZVA 5LVRA 5EPRA 4PTBA 5ENJA 4XUBA 4LYWA 5CUCA 5I89A 4LZ2A 4QSRA 4YK0A 4BW4A 4NQNA 2OO1A 4X2IA 5F3AA 5D3PA 4NS5A 5II1A 5IBNA 4NRBA 4NR5A 4F3IA 5BT5A 4BW1A 2DKWA 2DVSA 4TU4A 2FSAA 4YYIA 1WUMA 5E7DA 5I1QA 5F61A 4A9FA 5EK9A 3UVDA 4Z6IA 2R0SA 5HQ7A 4A9LA 4MENA 5H85A 5I86A 1F68A 2DVQA 5EWVA 4YYNA 3U5MA 5DFBA 1WUGA 4QEUA 2H60A 4J3IA 5D7XA 1E6IA 4QSWA 4NYVA 4QEWA 5I88A 4XY9A 5KTWA 4UYGA 4CLBA 2OSSA 4Z1QA 2YELA 5ENHA 5LVQA 3QZTA 5ENFA 4HXKA 5EGUA 4LZSA 4ALHA 5CRZA 5I7YA 5IGMA 3UVYA 4Y03A 3O35A 4N4FA 4NR9A 4YYKA 4ALGA 4UYDA 4TT6A 5HELA 4QSVA 2E3KA 5FE8A 5H1UA 4QR5A 2YEKA 3U5NA 2D82A 5FG6A 5HRVA 4BHWA 5EA1A 5G4RA 2RNWA 3U5KA 3IU5A 5L99A 3LQHA 3UW9A 4E96A 4QR4A 4QUTA 5DLZA 4HXRA 4WHUA 5EP7A 3SVGA 4CUQA 4NUDA 4NR4A 4O71A 2OUOA 5I83A 4LYSA 5FE6A 4LRGA 3HMHA 5F1LA 5CQ6A 4YBMA 4QSPA 5H1VA 5EV9A 5HEMA 5I29A 5KTXA 4Z1SA 5HCLA 4YADA 5ENGA 3HMEA 4NQMA 3P1EA 4A9OA 5JI8A 4TS8A 5E3GA 4A9KA 5HRWA 5FG4A 5HM0A 5D3LA 5FB0A 4QR3A 5FH8A 5D25A 4QNSA 5DFCA 5A85A 5AMFA 4HBYA 4QSSA 2NXBA 5FH6A 4MR6A 5L96A 5ACYA 4HXOA 4CUSA 3MQMA 3DAIA 4QB3A 4FLPA 4Q0NA 4A9HA 5EWCA 5FFWA 5AD2A 5LKZA 5FE7A 5CQAA 3K2JA 5FE5A 5D3HA 5FE4A 4Z6HA 4UIZA 5D3JA 5EI4A 5EM3A 4CFKA 3O36A 4IR4A 4YABA 3LQIA 5F1HA 5F60A 4HBXA 5IGNA 4NYWA 4O7EA 4NUEA 5BT4A 4PCIA 2RS9B 5DKDA 4C66A 4A9NA 5CS8A 4YAXA 4YY4A 5DYCA 5COIA 5EPSA 4IOOA 4J1PA 3MUKA 4N3WA 4HXSA 3SVHA 4N4GA 5EQ1A 5FFVA 5A5QA 5TCMA 4TZ8A 4OGIA 5C7NA 5F63A 3Q2FA 1ZS5A 4KV4A 4WIVA 5ENEA 4HXMA 4QSUA 3JVJA 3U5JA 2D9EA 2R0YA 5CP5A 4TU6A 2YQDA 3UVXA 4ZC9A 5EU1A 5C89A 5CUEA 4CUUA 4WHWA 1N72A 5EVAA 4A9IA 4OUFA 5HFQA 5LJ0A 4TYLA 4O78A 4BW3A 2DVVA 4RVRA 3AADA 2RI7A 5L98A 5LKXA 4O7AA 4Q0OA 3O34A 3U5LA 5AD3A 4PS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G0L A;  4UYH A;  5IGK A;  4KV1 A;  4A9M A;  4QC1 A;  5DY7 A;  2L84 A;  5E3D A;  5FE9 A;  4QYL A;  5A83 A;  2N9G A;  3FKM X;  5C8G A;  4IR6 A;  5I7X A;  5A81 A;  4HXN A;  5A5R A;  5EIC A;  3IU6 A;  4NR6 A;  4NR8 A;  4N4H A;  4LR6 A;  5FE2 A;  3MXF A;  2RNY A;  4IR5 A;  4N4I A;  5F25 A;  5D24 A;  3MB3 A;  5D3R A;  5A82 A;  2KTB B;  5G4S A;  3MB4 A;  4MR5 A;  2R0V A;  4XY8 A;  4TT4 A;  5L8T A;  4XYA A;  5ENB A;  4UIU A;  4MR3 A;  4ZW1 A;  3S92 A;  5EIS A;  4YH3 A;  4O76 A;  5C87 A;  2RO1 A;  1JM4 B;  5A5O A;  4LDF A;  3O37 A;  3MUL A;  5DFD A;  4YYJ A;  4O75 A;  5E0R A;  3GG3 A;  5FE3 A;  4LC2 A;  5F5Z A;  2DAT A;  4O72 A;  3LQJ A;  4PKL A;  4MEQ A;  3UV4 A;  5DW2 A;  3I3J A;  4O77 A;  4TTE A;  5KO4 A;  4A9E A;  5HQ5 A;  4YBT A;  5AME A;  5BT3 A;  4TT2 A;  5E9V A;  4NUC A;  4YYD A;  5LJ2 A;  3P1C A;  5LJ1 A;  4YAT A;  5IGL A;  3QZS A;  3Q2E A;  5CQ8 A;  4LYI A;  4IR3 A;  2L5E A;  5H1T A;  5DYA A;  4XUA A;  4YYM A;  4J0S A;  4O7F A;  5I80 A;  5E9M A;  4CFL A;  2L85 A;  5CRM A;  4QZS A;  5CU8 A;  5D3T A;  2RFJ A;  3ZYU A;  2E7N A;  3G0J A;  5ENC A;  4PY6 A;  5FE1 A;  5CGP A;  5CUA A;  4O74 A;  4NXJ A;  2F6J A;  2YW5 A;  2RNX A;  5LKU A;  5KHM A;  5HEN A;  4A9J A;  5DW1 A;  4GPJ A;  5DYU A;  4QUU A;  3SVF A;  5CUD A;  2LSP B;  5EWD A;  3O33 A;  3LJW A;  4NR7 A;  2GRC A;  2WP1 A;  5LKT A;  5DLX A;  4MEP A;  5D3S A;  5FFY A;  5KU3 A;  5FG5 A;  5II2 A;  1EQF A;  4CUR A;  4TZ2 A;  4TQN A;  5DKH A;  5E9K A;  4BJX A;  5L97 A;  2YDW A;  5DX4 A;  5J0D A;  3S91 A;  4QC3 A;  5CQ4 A;  3HMF A;  4J0R A;  4UIW A;  3JVK A;  4ZQL A;  5D3N A;  4UYF A;  4UIV A;  4PCE A;  5A5N A;  5A5S A;  5DKC A;  5E9Y A;  4HXL A;  4O70 A;  4CUP A;  5EWH A;  2YEM A;  5FDZ A;  5CY9 A;  3JVM A;  5A5P A;  5CQT A;  4MEO A;  5K29 A;  5L8U A;  3UV5 A;  3ONI A;  3AQA A;  4UIX A;  4IOQ A;  4LZR A;  5HQ6 A;  4DON A;  3TLP A;  5E74 A;  4YBS A;  5D26 A;  4Z93 A;  4CL9 A;  4UYE A;  5ETB A;  2F6N A;  4MR4 A;  4QYD A;  5F2P A;  4YH4 A;  3D7C A;  5CQ7 A;  4YC9 A;  4YYH A;  2MJV B;  4IOR A;  5EWW A;  5E73 A;  3P5O A;  2DWW A;  3UV2 A;  5HFR A;  4YY6 A;  3RCW A;  4NRA A;  5FB1 A;  4QBM A;  5KTU A;  5CQ3 A;  2G4A A;  5CUB A;  5ETD A;  4C67 A;  4UIT A;  5C85 A;  1JSP B;  4QSX A;  5CPE A;  5DBM A;  3DWY A;  4KCX A;  4BW2 A;  4QEV A;  4AKN A;  5ENI A;  4HXP A;  3NXB A;  1X0J A;  4OGJ A;  2I8N A;  3P1D A;  5D0C A;  4NYX A;  5LUU A;  5HLS A;  5HJC A;  4O7C A;  3UVW A;  5CQ5 A;  4NRC A;  4QSQ A;  5IID A;  2I7K A;  3U5O A;  5JWM A;  5HRX A;  5F36 A;  3LXJ A;  4UYF B;  5I40 A;  4UIY A;  5DYX A;  4YYG A;  2YYN A;  5IG6 A;  2E7O A;  3U5P A;  5CUG A;  5E9I A;  4O7B A;  2DVR A;  5A7C A;  5F62 A;  5TB6 A;  4QY4 A;  5C4Q A;  2R10 A;  5FBX A;  4HBW A;  3JVL A;  4CUT A;  5EPB A;  5FH7 A;  5E9L A;  5CZG A;  4HBV A;  4QST A;  5CFW A;  3P1F A;  5CTL A;  2WP2 A;  5FE0 A;  3QZV A;  5LVR A;  5EPR A;  4PTB A;  5ENJ A;  4XUB A;  4LYW A;  5CUC A;  5I89 A;  4LZ2 A;  4QSR A;  4YK0 A;  4BW4 A;  4NQN A;  2OO1 A;  4X2I A;  5F3A A;  5D3P A;  4NS5 A;  5II1 A;  5IBN A;  4NRB A;  4NR5 A;  4F3I A;  5BT5 A;  4BW1 A;  2DKW A;  2DVS A;  4TU4 A;  2FSA A;  4YYI A;  1WUM A;  5E7D A;  5I1Q A;  5F61 A;  4A9F A;  5EK9 A;  3UVD A;  4Z6I A;  2R0S A;  5HQ7 A;  4A9L A;  4MEN A;  5H85 A;  5I86 A;  1F68 A;  2DVQ A;  5EWV A;  4YYN A;  3U5M A;  5DFB A;  1WUG A;  4QEU A;  2H60 A;  4J3I A;  5D7X A;  1E6I A;  4QSW A;  4NYV A;  4QEW A;  5I88 A;  4XY9 A;  5KTW A;  4UYG A;  4CLB A;  2OSS A;  4Z1Q A;  2YEL A;  5ENH A;  5LVQ A;  3QZT A;  5ENF A;  4HXK A;  5EGU A;  4LZS A;  4ALH A;  5CRZ A;  5I7Y A;  5IGM A;  3UVY A;  4Y03 A;  3O35 A;  4N4F A;  4NR9 A;  4YYK A;  4ALG A;  4UYD A;  4TT6 A;  5HEL A;  4QSV A;  2E3K A;  5FE8 A;  5H1U A;  4QR5 A;  2YEK A;  3U5N A;  2D82 A;  5FG6 A;  5HRV A;  4BHW A;  5EA1 A;  5G4R A;  2RNW A;  3U5K A;  3IU5 A;  5L99 A;  3LQH A;  3UW9 A;  4E96 A;  4QR4 A;  4QUT A;  5DLZ A;  4HXR A;  4WHU A;  5EP7 A;  3SVG A;  4CUQ A;  4NUD A;  4NR4 A;  4O71 A;  2OUO A;  5I83 A;  4LYS A;  5FE6 A;  4LRG A;  3HMH A;  5F1L A;  5CQ6 A;  4YBM A;  4QSP A;  5H1V A;  5EV9 A;  5HEM A;  5I29 A;  5KTX A;  4Z1S A;  5HCL A;  4YAD A;  5ENG A;  3HME A;  4NQM A;  3P1E A;  4A9O A;  5JI8 A;  4TS8 A;  5E3G A;  4A9K A;  5HRW A;  5FG4 A;  5HM0 A;  5D3L A;  5FB0 A;  4QR3 A;  5FH8 A;  5D25 A;  4QNS A;  5DFC A;  5A85 A;  5AMF A;  4HBY A;  4QSS A;  2NXB A;  5FH6 A;  4MR6 A;  5L96 A;  5ACY A;  4HXO A;  4CUS A;  3MQM A;  3DAI A;  4QB3 A;  4FLP A;  4Q0N A;  4A9H A;  5EWC A;  5FFW A;  5AD2 A;  5LKZ A;  5FE7 A;  5CQA A;  3K2J A;  5FE5 A;  5D3H A;  5FE4 A;  4Z6H A;  4UIZ A;  5D3J A;  5EI4 A;  5EM3 A;  4CFK A;  3O36 A;  4IR4 A;  4YAB A;  3LQI A;  5F1H A;  5F60 A;  4HBX A;  5IGN A;  4NYW A;  4O7E A;  4NUE A;  5BT4 A;  4PCI A;  2RS9 B;  5DKD A;  4C66 A;  4A9N A;  5CS8 A;  4YAX A;  4YY4 A;  5DYC A;  5COI A;  5EPS A;  4IOO A;  4J1P A;  3MUK A;  4N3W A;  4HXS A;  3SVH A;  4N4G A;  5EQ1 A;  5FFV A;  5A5Q A;  5TCM A;  4TZ8 A;  4OGI A;  5C7N A;  5F63 A;  3Q2F A;  1ZS5 A;  4KV4 A;  4WIV A;  5ENE A;  4HXM A;  4QSU A;  3JVJ A;  3U5J A;  2D9E A;  2R0Y A;  5CP5 A;  4TU6 A;  2YQD A;  3UVX A;  4ZC9 A;  5EU1 A;  5C89 A;  5CUE A;  4CUU A;  4WHW A;  1N72 A;  5EVA A;  4A9I A;  4OUF A;  5HFQ A;  5LJ0 A;  4TYL A;  4O78 A;  4BW3 A;  2DVV A;  4RVR A;  3AAD A;  2RI7 A;  5L98 A;  5LKX A;  4O7A A;  4Q0O A;  3O34 A;  3U5L A;  5AD3 A;  4PS5 A; 
#chains in the Genus database with same CATH topology
 3G0L A;  4UYH A;  5IGK A;  4KV1 A;  4A9M A;  4QC1 A;  5DY7 A;  2L84 A;  5E3D A;  5FE9 A;  4QYL A;  5A83 A;  2N9G A;  3FKM X;  5C8G A;  4IR6 A;  5I7X A;  5A81 A;  4HXN A;  5A5R A;  5EIC A;  3IU6 A;  4NR6 A;  4NR8 A;  4N4H A;  4LR6 A;  5FE2 A;  3MXF A;  2RNY A;  4IR5 A;  4N4I A;  5F25 A;  5D24 A;  3MB3 A;  5D3R A;  5A82 A;  2KTB B;  5G4S A;  3MB4 A;  4MR5 A;  2R0V A;  4XY8 A;  4TT4 A;  5L8T A;  4XYA A;  5ENB A;  4UIU A;  4MR3 A;  4ZW1 A;  3S92 A;  5EIS A;  4YH3 A;  4O76 A;  5C87 A;  2RO1 A;  1JM4 B;  5A5O A;  4LDF A;  3O37 A;  3MUL A;  5DFD A;  4YYJ A;  4O75 A;  5E0R A;  3GG3 A;  5FE3 A;  4LC2 A;  5F5Z A;  2DAT A;  4O72 A;  3LQJ A;  4PKL A;  4MEQ A;  3UV4 A;  5DW2 A;  3I3J A;  4O77 A;  4TTE A;  5KO4 A;  4A9E A;  1PUO A;  5HQ5 A;  4YBT A;  5AME A;  5BT3 A;  4TT2 A;  5E9V A;  4NUC A;  4YYD A;  5LJ2 A;  3P1C A;  5LJ1 A;  4YAT A;  5IGL A;  3QZS A;  3Q2E A;  5CQ8 A;  4LYI A;  4IR3 A;  2L5E A;  5H1T A;  5DYA A;  4XUA A;  4YYM A;  4J0S A;  4O7F A;  5I80 A;  5E9M A;  4CFL A;  2L85 A;  5CRM A;  4QZS A;  5CU8 A;  5D3T A;  2RFJ A;  3ZYU A;  2E7N A;  3G0J A;  5ENC A;  4PY6 A;  5FE1 A;  5CGP A;  5CUA A;  4AKI A;  4O74 A;  4NXJ A;  2F6J A;  2YW5 A;  2RNX A;  5LKU A;  5KHM A;  5HEN A;  4A9J A;  5DW1 A;  4GPJ A;  5DYU A;  4QUU A;  3SVF A;  5CUD A;  2LSP B;  5EWD A;  3O33 A;  3LJW A;  4NR7 A;  2GRC A;  2WP1 A;  5LKT A;  5DLX A;  4MEP A;  5D3S A;  5FFY A;  5KU3 A;  5FG5 A;  5II2 A;  1EQF A;  4CUR A;  4TZ2 A;  4TQN A;  5DKH A;  5E9K A;  4BJX A;  5L97 A;  2YDW A;  5DX4 A;  5J0D A;  3S91 A;  4QC3 A;  5CQ4 A;  3HMF A;  4J0R A;  4UIW A;  3JVK A;  4ZQL A;  5D3N A;  4UYF A;  4UIV A;  4PCE A;  5A5N A;  5A5S A;  5DKC A;  5E9Y A;  4HXL A;  4O70 A;  4CUP A;  5EWH A;  2YEM A;  5FDZ A;  2EJN A;  5CY9 A;  3JVM A;  5A5P A;  5CQT A;  4MEO A;  5K29 A;  5L8U A;  3UV5 A;  3ONI A;  3AQA A;  4UIX A;  4IOQ A;  4LZR A;  5HQ6 A;  4DON A;  3TLP A;  5E74 A;  4YBS A;  5D26 A;  4Z93 A;  4CL9 A;  4UYE A;  5ETB A;  2F6N A;  4MR4 A;  4QYD A;  5F2P A;  4YH4 A;  3D7C A;  5CQ7 A;  4YC9 A;  4YYH A;  2MJV B;  3VKG A;  4IOR A;  5EWW A;  5E73 A;  3P5O A;  2DWW A;  3UV2 A;  5HFR A;  4YY6 A;  3RCW A;  3ERR A;  4NRA A;  5FB1 A;  4QBM A;  5KTU A;  4AKG A;  5CQ3 A;  2G4A A;  5CUB A;  5ETD A;  4C67 A;  4UIT A;  5C85 A;  1JSP B;  4QSX A;  5CPE A;  5DBM A;  3DWY A;  4KCX A;  4BW2 A;  4QEV A;  4AKN A;  5ENI A;  4HXP A;  3NXB A;  1X0J A;  4OGJ A;  2I8N A;  3P1D A;  5D0C A;  4NYX A;  5LUU A;  5HLS A;  5HJC A;  4O7C A;  3UVW A;  5CQ5 A;  4NRC A;  4QSQ A;  5IID A;  2I7K A;  3U5O A;  5JWM A;  5HRX A;  5F36 A;  3LXJ A;  4UYF B;  5I40 A;  4UIY A;  5DYX A;  4YYG A;  2YYN A;  5IG6 A;  2E7O A;  3U5P A;  5CUG A;  5E9I A;  4O7B A;  2DVR A;  5A7C A;  5F62 A;  5TB6 A;  4QY4 A;  5C4Q A;  2R10 A;  5FBX A;  4HBW A;  3JVL A;  4CUT A;  5EPB A;  5FH7 A;  5E9L A;  5CZG A;  4HBV A;  4QST A;  5CFW A;  3P1F A;  5CTL A;  2WP2 A;  5FE0 A;  3QZV A;  5LVR A;  5EPR A;  4PTB A;  4AI6 A;  5ENJ A;  4XUB A;  4LYW A;  5CUC A;  5I89 A;  4LZ2 A;  4QSR A;  4YK0 A;  4BW4 A;  4NQN A;  2OO1 A;  4X2I A;  5F3A A;  5D3P A;  4NS5 A;  5II1 A;  5IBN A;  4NRB A;  4NR5 A;  4F3I A;  5BT5 A;  4BW1 A;  2DKW A;  2DVS A;  4TU4 A;  2FSA A;  4YYI A;  1WUM A;  1ZKR A;  5E7D A;  5I1Q A;  5F61 A;  4A9F A;  5EK9 A;  3UVD A;  4Z6I A;  2R0S A;  5HQ7 A;  4A9L A;  4MEN A;  5H85 A;  5I86 A;  1F68 A;  2DVQ A;  5EWV A;  4YYN A;  3U5M A;  5DFB A;  1WUG A;  4QEU A;  2H60 A;  4J3I A;  5D7X A;  1E6I A;  4QSW A;  4NYV A;  4QEW A;  5I88 A;  4XY9 A;  5KTW A;  4UYG A;  4CLB A;  2OSS A;  4Z1Q A;  2YEL A;  5ENH A;  5LVQ A;  3QZT A;  5ENF A;  4HXK A;  5EGU A;  4LZS A;  4ALH A;  5CRZ A;  5I7Y A;  5IGM A;  3UVY A;  4Y03 A;  3O35 A;  4N4F A;  3D1B A;  4NR9 A;  4YYK A;  4ALG A;  4UYD A;  4TT6 A;  5HEL A;  4QSV A;  2E3K A;  5FE8 A;  5H1U A;  4QR5 A;  2YEK A;  3U5N A;  2D82 A;  5FG6 A;  5HRV A;  4BHW A;  5EA1 A;  5G4R A;  2RNW A;  3U5K A;  3IU5 A;  5L99 A;  3LQH A;  3UW9 A;  4E96 A;  4QR4 A;  4QUT A;  5DLZ A;  4HXR A;  4WHU A;  4AKH A;  5EP7 A;  3SVG A;  4CUQ A;  4NUD A;  4NR4 A;  4O71 A;  2OUO A;  5I83 A;  4LYS A;  5FE6 A;  4LRG A;  3HMH A;  5F1L A;  5CQ6 A;  4YBM A;  4QSP A;  5H1V A;  5EV9 A;  5HEM A;  5I29 A;  5KTX A;  4Z1S A;  5HCL A;  4YAD A;  5ENG A;  3HME A;  4NQM A;  3P1E A;  4A9O A;  5JI8 A;  4TS8 A;  5E3G A;  4A9K A;  5HRW A;  5FG4 A;  5HM0 A;  5D3L A;  5FB0 A;  4QR3 A;  5FH8 A;  5D25 A;  4QNS A;  5DFC A;  5A85 A;  5AMF A;  4HBY A;  4QSS A;  2NXB A;  5FH6 A;  4MR6 A;  5L96 A;  5ACY A;  4HXO A;  4CUS A;  3MQM A;  3DAI A;  4QB3 A;  4FLP A;  4Q0N A;  4A9H A;  5EWC A;  5FFW A;  5AD2 A;  5LKZ A;  5FE7 A;  5CQA A;  3K2J A;  5FE5 A;  5D3H A;  5FE4 A;  4Z6H A;  4UIZ A;  5D3J A;  5EI4 A;  5EM3 A;  4CFK A;  3D1D A;  3O36 A;  4IR4 A;  4YAB A;  3LQI A;  5F1H A;  5F60 A;  4HBX A;  5IGN A;  4NYW A;  4O7E A;  4NUE A;  5BT4 A;  4PCI A;  2RS9 B;  5DKD A;  4C66 A;  4A9N A;  5CS8 A;  4YAX A;  4YY4 A;  5DYC A;  5COI A;  5EPS A;  4IOO A;  4J1P A;  3MUK A;  4N3W A;  4HXS A;  3SVH A;  4N4G A;  5EQ1 A;  5FFV A;  5A5Q A;  5TCM A;  4TZ8 A;  4OGI A;  5C7N A;  5F63 A;  3Q2F A;  1ZS5 A;  4KV4 A;  4WIV A;  5ENE A;  4HXM A;  4QSU A;  3JVJ A;  3U5J A;  2D9E A;  2R0Y A;  5CP5 A;  4TU6 A;  2YQD A;  3UVX A;  4ZC9 A;  5EU1 A;  5C89 A;  5CUE A;  4CUU A;  4WHW A;  1N72 A;  5EVA A;  4A9I A;  4OUF A;  5HFQ A;  5LJ0 A;  4TYL A;  4O78 A;  4BW3 A;  3VKH A;  2DVV A;  4RVR A;  3AAD A;  2RI7 A;  5L98 A;  5LKX A;  4O7A A;  4Q0O A;  3O34 A;  3U5L A;  5AD3 A;  4PS5 A; 
#chains in the Genus database with same CATH homology
 3G0L A;  4UYH A;  5IGK A;  4KV1 A;  4A9M A;  4QC1 A;  5DY7 A;  2L84 A;  5E3D A;  5FE9 A;  4QYL A;  5A83 A;  2N9G A;  3FKM X;  5C8G A;  4IR6 A;  5I7X A;  5A81 A;  4HXN A;  5A5R A;  5EIC A;  3IU6 A;  4NR6 A;  4NR8 A;  4N4H A;  4LR6 A;  5FE2 A;  3MXF A;  2RNY A;  4IR5 A;  4N4I A;  5F25 A;  5D24 A;  3MB3 A;  5D3R A;  5A82 A;  2KTB B;  5G4S A;  3MB4 A;  4MR5 A;  2R0V A;  4XY8 A;  4TT4 A;  5L8T A;  4XYA A;  5ENB A;  4UIU A;  4MR3 A;  4ZW1 A;  3S92 A;  5EIS A;  4YH3 A;  4O76 A;  5C87 A;  2RO1 A;  1JM4 B;  5A5O A;  4LDF A;  3O37 A;  3MUL A;  5DFD A;  4YYJ A;  4O75 A;  5E0R A;  3GG3 A;  5FE3 A;  4LC2 A;  5F5Z A;  2DAT A;  4O72 A;  3LQJ A;  4PKL A;  4MEQ A;  3UV4 A;  5DW2 A;  3I3J A;  4O77 A;  4TTE A;  5KO4 A;  4A9E A;  5HQ5 A;  4YBT A;  5AME A;  5BT3 A;  4TT2 A;  5E9V A;  4NUC A;  4YYD A;  5LJ2 A;  3P1C A;  5LJ1 A;  4YAT A;  5IGL A;  3QZS A;  3Q2E A;  5CQ8 A;  4LYI A;  4IR3 A;  2L5E A;  5H1T A;  5DYA A;  4XUA A;  4YYM A;  4J0S A;  4O7F A;  5I80 A;  5E9M A;  4CFL A;  2L85 A;  5CRM A;  4QZS A;  5CU8 A;  5D3T A;  2RFJ A;  3ZYU A;  2E7N A;  3G0J A;  5ENC A;  4PY6 A;  5FE1 A;  5CGP A;  5CUA A;  4O74 A;  4NXJ A;  2F6J A;  2YW5 A;  2RNX A;  5LKU A;  5KHM A;  5HEN A;  4A9J A;  5DW1 A;  4GPJ A;  5DYU A;  4QUU A;  3SVF A;  5CUD A;  2LSP B;  5EWD A;  3O33 A;  3LJW A;  4NR7 A;  2GRC A;  2WP1 A;  5LKT A;  5DLX A;  4MEP A;  5D3S A;  5FFY A;  5KU3 A;  5FG5 A;  5II2 A;  1EQF A;  4CUR A;  4TZ2 A;  4TQN A;  5DKH A;  5E9K A;  4BJX A;  5L97 A;  2YDW A;  5DX4 A;  5J0D A;  3S91 A;  4QC3 A;  5CQ4 A;  3HMF A;  4J0R A;  4UIW A;  3JVK A;  4ZQL A;  5D3N A;  4UYF A;  4UIV A;  4PCE A;  5A5N A;  5A5S A;  5DKC A;  5E9Y A;  4HXL A;  4O70 A;  4CUP A;  5EWH A;  2YEM A;  5FDZ A;  5CY9 A;  3JVM A;  5A5P A;  5CQT A;  4MEO A;  5K29 A;  5L8U A;  3UV5 A;  3ONI A;  3AQA A;  4UIX A;  4IOQ A;  4LZR A;  5HQ6 A;  4DON A;  3TLP A;  5E74 A;  4YBS A;  5D26 A;  4Z93 A;  4CL9 A;  4UYE A;  5ETB A;  2F6N A;  4MR4 A;  4QYD A;  5F2P A;  4YH4 A;  3D7C A;  5CQ7 A;  4YC9 A;  4YYH A;  2MJV B;  4IOR A;  5EWW A;  5E73 A;  3P5O A;  2DWW A;  3UV2 A;  5HFR A;  4YY6 A;  3RCW A;  4NRA A;  5FB1 A;  4QBM A;  5KTU A;  5CQ3 A;  2G4A A;  5CUB A;  5ETD A;  4C67 A;  4UIT A;  5C85 A;  1JSP B;  4QSX A;  5CPE A;  5DBM A;  3DWY A;  4KCX A;  4BW2 A;  4QEV A;  4AKN A;  5ENI A;  4HXP A;  3NXB A;  1X0J A;  4OGJ A;  2I8N A;  3P1D A;  5D0C A;  4NYX A;  5LUU A;  5HLS A;  5HJC A;  4O7C A;  3UVW A;  5CQ5 A;  4NRC A;  4QSQ A;  5IID A;  2I7K A;  3U5O A;  5JWM A;  5HRX A;  5F36 A;  3LXJ A;  4UYF B;  5I40 A;  4UIY A;  5DYX A;  4YYG A;  2YYN A;  5IG6 A;  2E7O A;  3U5P A;  5CUG A;  5E9I A;  4O7B A;  2DVR A;  5A7C A;  5F62 A;  5TB6 A;  4QY4 A;  5C4Q A;  2R10 A;  5FBX A;  4HBW A;  3JVL A;  4CUT A;  5EPB A;  5FH7 A;  5E9L A;  5CZG A;  4HBV A;  4QST A;  5CFW A;  3P1F A;  5CTL A;  2WP2 A;  5FE0 A;  3QZV A;  5LVR A;  5EPR A;  4PTB A;  5ENJ A;  4XUB A;  4LYW A;  5CUC A;  5I89 A;  4LZ2 A;  4QSR A;  4YK0 A;  4BW4 A;  4NQN A;  2OO1 A;  4X2I A;  5F3A A;  5D3P A;  4NS5 A;  5II1 A;  5IBN A;  4NRB A;  4NR5 A;  4F3I A;  5BT5 A;  4BW1 A;  2DKW A;  2DVS A;  4TU4 A;  2FSA A;  4YYI A;  1WUM A;  5E7D A;  5I1Q A;  5F61 A;  4A9F A;  5EK9 A;  3UVD A;  4Z6I A;  2R0S A;  5HQ7 A;  4A9L A;  4MEN A;  5H85 A;  5I86 A;  1F68 A;  2DVQ A;  5EWV A;  4YYN A;  3U5M A;  5DFB A;  1WUG A;  4QEU A;  2H60 A;  4J3I A;  5D7X A;  1E6I A;  4QSW A;  4NYV A;  4QEW A;  5I88 A;  4XY9 A;  5KTW A;  4UYG A;  4CLB A;  2OSS A;  4Z1Q A;  2YEL A;  5ENH A;  5LVQ A;  3QZT A;  5ENF A;  4HXK A;  5EGU A;  4LZS A;  4ALH A;  5CRZ A;  5I7Y A;  5IGM A;  3UVY A;  4Y03 A;  3O35 A;  4N4F A;  4NR9 A;  4YYK A;  4ALG A;  4UYD A;  4TT6 A;  5HEL A;  4QSV A;  2E3K A;  5FE8 A;  5H1U A;  4QR5 A;  2YEK A;  3U5N A;  2D82 A;  5FG6 A;  5HRV A;  4BHW A;  5EA1 A;  5G4R A;  2RNW A;  3U5K A;  3IU5 A;  5L99 A;  3LQH A;  3UW9 A;  4E96 A;  4QR4 A;  4QUT A;  5DLZ A;  4HXR A;  4WHU A;  5EP7 A;  3SVG A;  4CUQ A;  4NUD A;  4NR4 A;  4O71 A;  2OUO A;  5I83 A;  4LYS A;  5FE6 A;  4LRG A;  3HMH A;  5F1L A;  5CQ6 A;  4YBM A;  4QSP A;  5H1V A;  5EV9 A;  5HEM A;  5I29 A;  5KTX A;  4Z1S A;  5HCL A;  4YAD A;  5ENG A;  3HME A;  4NQM A;  3P1E A;  4A9O A;  5JI8 A;  4TS8 A;  5E3G A;  4A9K A;  5HRW A;  5FG4 A;  5HM0 A;  5D3L A;  5FB0 A;  4QR3 A;  5FH8 A;  5D25 A;  4QNS A;  5DFC A;  5A85 A;  5AMF A;  4HBY A;  4QSS A;  2NXB A;  5FH6 A;  4MR6 A;  5L96 A;  5ACY A;  4HXO A;  4CUS A;  3MQM A;  3DAI A;  4QB3 A;  4FLP A;  4Q0N A;  4A9H A;  5EWC A;  5FFW A;  5AD2 A;  5LKZ A;  5FE7 A;  5CQA A;  3K2J A;  5FE5 A;  5D3H A;  5FE4 A;  4Z6H A;  4UIZ A;  5D3J A;  5EI4 A;  5EM3 A;  4CFK A;  3O36 A;  4IR4 A;  4YAB A;  3LQI A;  5F1H A;  5F60 A;  4HBX A;  5IGN A;  4NYW A;  4O7E A;  4NUE A;  5BT4 A;  4PCI A;  2RS9 B;  5DKD A;  4C66 A;  4A9N A;  5CS8 A;  4YAX A;  4YY4 A;  5DYC A;  5COI A;  5EPS A;  4IOO A;  4J1P A;  3MUK A;  4N3W A;  4HXS A;  3SVH A;  4N4G A;  5EQ1 A;  5FFV A;  5A5Q A;  5TCM A;  4TZ8 A;  4OGI A;  5C7N A;  5F63 A;  3Q2F A;  1ZS5 A;  4KV4 A;  4WIV A;  5ENE A;  4HXM A;  4QSU A;  3JVJ A;  3U5J A;  2D9E A;  2R0Y A;  5CP5 A;  4TU6 A;  2YQD A;  3UVX A;  4ZC9 A;  5EU1 A;  5C89 A;  5CUE A;  4CUU A;  4WHW A;  1N72 A;  5EVA A;  4A9I A;  4OUF A;  5HFQ A;  5LJ0 A;  4TYL A;  4O78 A;  4BW3 A;  2DVV A;  4RVR A;  3AAD A;  2RI7 A;  5L98 A;  5LKX A;  4O7A A;  4Q0O A;  3O34 A;  3U5L A;  5AD3 A;  4PS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...