1E6MA

Two-component signal transduction system d57a mutant of chey
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
128
structure length
128
Chain Sequence
SDKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISAWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Towards Understanding a Molecular Switch Mechanism: Thermodynamic and Crystallographic Studies of the Signal Transduction Protein Chey
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Signaling protein
molecule keywords CHEMOTAXIS PROTEIN CHEY
total genus 44
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2000-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1e6mA00
3Q7TA 4TN5A 3HXMA 2FMKA 3SY8A 4KREA 1QO0D 4OBBA 5BRAA 2FQWA 4W5QA 3O2JA 4FE7A 4G0PA 4DN6A 1F4VA 1RPJA 2NUBA 5JNSA 4MS4A 4N0PA 3OMXA 3LFTA 3A0UA 4N41A 2PUCA 4KRFA 2I6FA 1DBWA 4RU1A 3QEMA 3ILYA 4RK4A 2WJWA 4FB4A 3W9SA 3KLNA 2JK1A 3QX9A 3T38A 4Z9AA 1P8AA 3EAFA 4RK5A 4EY3A 4RSMA 2ID7A 1JWLA 3GV0A 4Z4GA 2CWDA 2RGYA 3LKVA 1QP7A 3EULA 3O1HB 4MR8A 5TE9A 4H60A 2A9RA 3QLUA 3SNKA 3OQMA 3CLKA 2LIVA 7ABPA 1U2PA 4G0OA 2PLNA 2R4QA 2IPMA 4MS3B 5HKOA 2QU7A 1QPZA 3QEKA 2WY2D 2ID9A 2JRLA 1ZGZA 5DLEA 2HQBA 2LBPA 4N47A 4DADA 2PJUA 1P6UA 4RKRA 2A9QA 2CD7A 2J48A 4EYQA 4YP9A 3BRQA 3FDFA 3HV2A 3O2QB 1E6MA 1FFSA 1LBHA 4JASB 4GPAA 4TLLB 5TQ2B 4W5RA 4PICA 4ETIA 1BDIA 2RDMA 3EQ2A 4JP1A 4MS1A 5TQJA 3RVPA 2N9UA 3DBIA 3LUDA 3N0WA 4MYRA 2PE5A 4Z4IA 3F6CA 4LE1A 3D8UA 1FSPA 3NNNA 3FFWA 3CNBA 1KRWA 2L2QA 3GWGA 1NXOA 3HO1A 3HUTA 1P6QA 4MLDA 3IP5A 3C3WA 3HVRA 1JYFA 2O20A 3CU5A 3LUKA 1Z17A 4H3HB 4UHKA 4PYRA 5T7BA 1Z2EA 2MSKA 1VKRA 1NXPA 4ZMRA 4UHJA 2WWVD 4EUKA 5DTEA 3F6PA 3A0RB 5EWMB 2PUBA 1BVHA 4MAAA 1JYEA 4EGSA 4YCSA 4NICA 2FVYA 1DG9A 3OQNA 1TJYA 1ZGGA 1EAYA 3B2NA 3M9XA 2IDMA 3D02A 4OATA 3CRNA 3KCNA 3RQIA 3H5TA 5ED4A 2E4XA 4LDAA 2IOYA 2V0NA 3BRSA 4Y9TA 4Q6BA 5B3JC 3HJFA 4RDCA 2VUIB 1P2FA 1QO0A 3HDVA 2GX6A 2YHAA 3O21A 1HEYA 2A9OA 4JAVC 3BREA 2QW1A 4P1ZA 1K66A 4KZKA 4YS6A 1RXEA 3MA0A 2PUAA 2WB4A 4EVRA 4N0QA 2R48A 5BQ3A 1YIOA 3NNSA 1QQAA 3LMKA 3KJXA 1U0SY 1SXGA 4HNQA 2HQRA 1USGA 3K4HA 3GBVA 3I45A 5TPWB 2P4UA 5JNUA 5DGCA 3M6MD 4MQFA 3ROTA 1ZN2A 1GUBA 3CTPA 2ZWMA 1SRRA 4KV7A 4YWHA 4PEVA 4G0MA 1FFWA 3FFTA 1YTUA 2H0AA 3OMWA 1JHZA 3F7NA 3A3KA 1L5ZA 1I3CA 3N75A 5IC5A 4N03A 4S04A 1D5WA 1Z18A 2QV0A 4EYGA 4ML3A 2QR3A 1VLZA 1H9CA 1DBPA 1DZ3A 8ABPA 3QELB 3SAJA 3R0JA 1A0OA 2MSLA 3H5WA 1B00A 4LX8A 5IUNC 3GYBA 1TM2A 2R47A 1YS6A 3H6GA 3MQ4A 4JOQA 5IEBA 3RVMA 4EYOA 1M5UA 5BR1A 1BA2A 3DGFC 2JCGA 2E4YA 2FN8A 4KMRA 4MGEA 4G0ZA 2RJNA 5CNKA 4QYMA 1JX6A 3NHZA 2QVCA 4E7PA 2PUEA 4Z4EA 4B09A 2XDYA 4YLEA 1J56A 3JPWA 3C3MA 1ZESA 3E3MA 2B4AA 1GCAA 2L18A 4QYWA 4ETNA 1SD5A 1PEAA 1QP0A 1ABEA 3UK0A 2IKSA 2FQXA 3KLOA 4RK6A 1DCMA 1U04A 2TMYA 3Q9SA 2IPNA 2JVKA 3MM4A 3OLVA 3QEMB 4XFKA 1C4WA 3C97A 1BDJA 4HYEA 3KHTA 4N76A 2P9HA 4IILA 3I42A 1JF8A 1MB0A 1UDRA 2FEPA 3JVDA 4MR9A 1NATA 4G0QA 4KFCA 1JDNA 1ZHHA 4YGXB 5B3JA 1VPWA 3SM9A 4MQFB 4Z4CA 4MLCA 5DKFA 4YO7A 3MYYA 2AYXA 3SG0A 4LE0A 3GBPA 2B1JA 4RZSA 1ZH4A 1RNLA 5GOTA 3KYJB 1S8NA 2FLKA 4RK0A 3EJWA 1EHCA 3LUFA 4RK1A 4S05A 3DLBA 3RH0A 2FQYA 1DC7A 1C0EA 3KYIB 4CBVA 4YV7A 1DCFA 1PNRA 4RWEA 3VNAA 2GBPA 1JFSA 1M2FA 4F11A 2WRZA 3QLUC 5JNWA 4DQDA 4RY9A 4Z4FA 3QELA 3MF4A 4F12A 3QLVC 5F64A 9ABPA 5JS1A 2VUHB 1LJUA 1EWVA 3BBLA 3IP7A 2L17A 2WMYA 3FFXA 4OG2A 4NCBA 1DC8A 1K68A 1QMPA 3O2SB 1Z12A 1ISSA 1NTRA 1Z25A 4Z99A 3N8IA 2QXYA 4ZMSA 5CNJA 4MS1B 3LUAA 5JS2A 3KS9A 1FFGA 3O1JC 4O5AA 4M88A 3TD9A 1D4ZA 3HSYA 3O75A 4RXMA 4HNRA 2FXIA 5EWLB 1M2EA 1ZITA 4QPJC 5ABPA 3L6UA 1FQWA 1PNTA 3GA5A 3HS3A 2HSGA 5D2CA 4Z0NA 5HSGA 3BILA 5KC8A 1RZRA 4KQCA 3KKEA 3OM1A 4RV5A 3RVQA 4HNSA 3G85A 4RS3A 4KNYA 1VRVA 3JTEA 1ISRA 1D1QA 3H5LA 3MIZA 4LRQA 5C5CA 2PL9A 3HUUA 3HDGA 5FBHA 4QICA 2PUFA 4L4UA 2E4WA 3TO5A 1LBIA 1GUDA 2HJ9A 4G86A 2JBAA 2ZAYA 3OM0A 3TMYA 2QVGA 1YVUA 2FTKE 3EQZA 1DP4A 2VK2A 3NNDA 4KPYA 1PUXA 3SQNA 5IX8A 3RVLA 3K9CA 2X7XA 3GRCA 4RY8A 4XXHA 3CKMA 3H5VA 4IGAA 1AB6A 1Z2DA 2JB9A 2FLWA 3CG0A 3LUGA 4E7OA 4RKQA 4FE4A 1MB3A 4IMJB 3P9YA 2HPHA 2FKAA 4MR8B 4EYKA 4F06A 1CEYA 1D2AA 3KTOA 4JB0A 1QQBA 2MYUA 1NXVA 3H6HA 5PNTA 1DRKA 4TLMB 2JVIA 4Q6WA 2CHEA 3KG2A 5TPWA 5C5EA 3HZHA 1NY5A 3KSMA 4L85A 1A04A 6CHYA 3CS3A 1QNLA 2Q5CA 4WZZA 1QKKA 4OLAA 2NZVG 4KVFA 4WXMA 2LP4Y 3OLZA 3CZ5A 3QLVA 1W9HA 4G0XA 4LE2A 1TVMA 2F8SA 4W5NA 4Q7EA 3DZDA 3IP6A 3JPYA 3N0RA 2CHFA 1DBQA 2MYTA 3CZCA 4RXTA 1JH9A 3N53A 3RVNA 5KWSA 1E2BA 2E4ZA 3S99A 3O1IC 3OLXA 4O1HA 3H1GA 5HQJA 4MPTA 3URMA 2MSWA 4XLTA 1Z16A 3Q7SA 5KQGA 2E4VA 2PKXA 1XHEA 4KK4A 5CNIA 1WETA 1XHFA 5GQSA 5TPZD 4G0YA 5EWLA 1NXSA 2FSPA 5T3YA 4PZ0A 1YK1A 1E6KA 2HQOA 3LKBA 4GNRA 4YR7A 5TQ2A 1MAVA 4EVQA 3LTEA 2IYNA 4KK3A 4XAQA 5IUJC 4RK7A 3GT7A 4D6YA 4LDZA 5JNTA 1YS7A 1JLKA 3CG4A 3CFYA 1E6LA 3LUHA 2PUDA 4MS3A 4MR9B 3GL9A 4OTZA 1PHRA 5IBQA 2FMIA 4F8JA 2W42A 4MR7B 5TQ0A 5FWXB 1YMVA 2IPLA 1ABFA 2LPMA 1CHNA 3HK2A 4F3TA 3DGEC 1AB5A 2JVJA 3H1FA 3LUCA 3C3KA 2F8TA 1TMYA 3Q7RA 4OLBA 1OXBB 5KQPA 1JBEA 3IDOA 4ZPJA 4ZJPA 2NZUG 4MRMB 4KQ9A 5CHYA 4W5TA 4NV3A 3N6VA 2NT4A 2FMHA 3Q41A 3T8YA 3F73A 2H3HA 1KRXA 3OLYA 3RVSA 1CYEA 3FMVA 4MS4B 5DCLA 5HM6A 1ZAYA 4MR7A 5FBKA 5TQ0B 5KI6A 3VNBA 3Q15C 2PL1A 3HEBA 2PMCA 3ROFA 3RVOA 5TPZA 1JL3A 1ZH2A 3OO1A 1GLGA 2MYPA 2WJAA 1OXKB 3LOPA 2RJOA 3TX6A 4ZYLA 5KC9A 3MMNA 4YRZA 5IUKC 4TMYA 3ILHA 4MRMA 1LK0A 1URPA 3IPAA 2VYCA 5FWYA 3IP9A 1DCKA 2GWRA 4D74A 1KMIY 3DLHA 1NXXA 3I09A 2LUOA 3IPCA 1EWKA 5E3JA 2PAFA 1R8JA 2QSJA 3H5OA 3RVKA 4WWHA 2OENG 1TLFA 4XASA 3OQOA 4MQEB 3H5IA 2R25B 2FN9A 3EODA 1QP4A 2M98A 3LUJA 1Z26A 3JS5A 4D6XA 4ETMA 1D1PA 3OO0A 1USIA 2DRIA 1F51E 2KYRA 4Z4HA 3JVIA 1SXIA 2FW0A 4WUTA 1M5TA 2FEKA 3EGCA 1USKA 2FMFA 4PE5B 4WT7A 2NT3A 5IEJA 5KQMA 1JDPA 3H1EA 1KGSA 5JNVA 5BRJA 1W25A 5IULC 1BDHA 1YMUA 2BGGA 1L5YA 1Z13A 4EVSA 3NHMA 3T6KA 1T34A 3HM9A 5EWJA 1MVOA 4MQEA 5I4CA 5JNRA 4IRXA 4JA2A 3JY6A 1PEYA 4H3KB 3G1WA 4RXUA 1BAPA 1ZY2A 3NBMA 3QK7A 1JFVA 1U2QA 2YHBA 2IPAB 1NXWA 2A9PA 2OQRA 4IF4A 3HCWA 3A10A 3C6QA 3UUGA 4WXEA 1ZDMA 1EFAA 1JFTA 4G97A 4W5OA 5EWMA 3N0XA 5EWJB 1NXTA 2M1ZA 4JB2A 3L49A 2PUGA 2GKGA 4NQRA 1A2OA 3CHYA 1APBA 4RY0A 3OLWA 1ZVVA 2GI4A 4XARA 3UKJA 5CNMA 5KQLA 1Z15A 1MIHA 5FWYB 1IIBA 3TB6A 3RVJA 1RXIA 1Y1LA 2MYNA 1SXHA 4O1IA 1RZRD 4P98A 1LJLA 3E61A 2JBAB 3T95A 3QLTA 3RVRA 3EDCA 2E4UA 4LZLA 1YK0A 1U8TA 1DRJA 5FWXA 3QX8A 2FEWB 2QZJA 4NCAA 3I5AA 2AYZA 1DJMA 1EWTA 3M9WA 3H75A 1XWWA 4IMIB 1GCGA 3O74A 6ABPA 4Z9BA 3FGZA 2L19A
chains in the Genus database with same CATH superfamily
4HRAA 1N7IA 1USVA 1Y1KE 3AZOA 4RPJA 2QMZA 4HXYA 4PWZA 1DFHA 2XXJA 1QU3A 3K3PA 1E18A 3MQFA 3DBLA 1TUBB 3AETB 2NUBA 4M0DA 3VU1A 1KZ4A 2EFCB 2GJ9A 4LJ8A 2YY5A 5DHFA 3UAOA 4B82A 4FXPA 4IS3A 1G66A 4URVR 1WXHA 2Q5JA 4AJ1A 1VG9B 2X2EA 3H8JA 2FYTA 2C92A 3PUXA 3BSWA 4K6CA 1L7EA 2IS1A 4Z9AA 1TMOA 1WR8A 2W6OA 1JDBB 2CVZA 4K6FA 5AMXA 3G5MA 3SE7A 3UPTA 2BFOA 2VWQA 3CUKA 3MERA 2JFQA 4IFTA 5TARA 4QVKA 4W8GA 4BVHA 5J43A 3F4BA 4OXQA 4ENWA 1UKVY 3QH4A 4UOQA 3RDPA 3O0DA 3GD5A 4FDVA 1DAPA 2OAQ1 4IVNA 4XGKA 3BWEA 1LLUA 2ZSKA 3IE2A 3GDOA 1WDKA 2MSEB 1WJGA 2R4QA 3HXLA 3TD2A 1W76A 4ZOQI 1CKEA 2XODA 3PHLA 4LQLA 4A5OA 1SQGA 4C1BA 1DQYA 1CJBA 4QYSA 3L93A 1BX1A 1Z33A 2HQ1A 4NBVA 3R3VA 3G6KA 4YT4A 3W5UA 1M2JA 4BV9A 3P9XA 4JJAA 2BFCA 7REQA 4MSUA 3QE4A 3HV2A 2TS1A 4X54A 1E6MA 1Q0ZA 4YJ3F 3KTFA 3UENA 3WY9A 5HZMA 1CF4A 4EX7A 5I5EA 2PKRA 4HY3A 5L7WA 2BFBA 3FN4A 5MFZA 1P1IA 1RAEA 4E6EA 4N8DA 5EUCA 4D4LA 3LUBA 3P5BA 2PWPA 1KHHA 1ZIXA 1HY3A 3FYHA 2VCHA 4TKVB 3GMIA 5BSGA 3EOBI 1IHPA 3IP5A 4R51A 1M73E 3VSDA 4GPZA 4LXUA 1EGAA 2R62A 2Y4NA 4H7HA 1XVIA 4M1WA 1A8SA 3Q8KA 1Z5WA 3E5MA 4MVJD 1PD0A 3KEQA 1GDDA 3MYRA 1P80A 4PYRA 3VVMA 1QCDA 5ALNA 1VDMA 5K3AA 2HCRA 4FDTA 2RK4A 5ER6A 4R6WA 4AUKA 3ZCQA 1QJ4A 3LUPA 4KKVA 1ZW1A 2WFLA 5BQPA 1SJ9A 4CHTA 2J5QA 4K6HA 4EA7A 4Q93A 5IF3A 5KWJA 3DZIA 2Q41A 2G7ZA 5L53A 5HFJA 3CLTD 2P9EA 4QPCA 3S2IA 3TQHA 3WGJA 1OIXA 1H2ZA 4DNFA 2FWRA 2P9TA 3EHDA 3PT9A 1O97C 2FWPA 3LYLA 5F23A 3FMPB 2QGNA 2ZI9A 4BQPA 1ULZA 1XAHA 1DAMA 1LNSA 1YGYA 1YNSA 4PY2A 4Q6BA 4FYWA 2BKUA 2V7VA 3N86A 4LWQA 2P1ZA 4N6GA 3B8EA 2ZKLA 5DGTA 1ORTA 1Q77A 2YHAA 1PQYA 2EFYA 2QN8A 3D0KA 2XMRA 3LYAA 5E1MA 4LVCA 5ECGC 1VCHA 1VMAA 4CM4A 1JU9A 4D1YA 5K0GA 1Y8QB 5L40A 2X8BA 3WOHA 5IZ4A 4M87A 3PZRA 3V55A 4XM1A 3RUFA 2BJHA 2BMEA 3BOSA 4N5MA 2RHHA 3WIVA 1E1KA 2WSSD 3BCUA 1PZGA 3C85A 1EFLA 5DYYA 4O63O 1KAMA 2WUVA 1J20A 4WOKA 1NUPA 1U0SY 1J2JA 1VCNA 2Q50A 1Y33E 4MCHA 3OEWA 2A86A 5F35A 4YC7A 3ICEA 5CM2Z 3G7NA 3X1XA 2NW6A 2PMFA 1U5BA 3EDYA 3ITKA 3U7FB 3QKUA 4CIVA 3OZSA 4QNNA 3WLSA 1SKYB 1OT3A 3WGTA 1G59A 2D5AA 2Z04A 5BN5A 3LSTA 2ZUCA 3KEGA 1FNCA 3BTOA 4D7AA 5IN4A 2RGCA 1FFWA 2C61A 3DMDA 5F4ZA 5TEWA 1B0UA 3NBFA 2CUZA 3MAAC 3RIYA 1E9DA 2MINB 3TM4A 2WAMA 1DAFA 2PMBA 3H3XA 3WNZA 2AMJA 1Z18A 2TSYB 3DFKA 2HW8A 3CCBA 1U3CA 2PQ0A 2R7LA 3STWA 4DMFA 4TXHA 2PXCA 4HXFB 1VLZA 3JQDA 4EUHA 1A7JA 3U4AA 2O7QA 1WDWB 2ESRA 4CGZA 3SAJA 3DFIA 1J25A 2X1HA 4MKHA 4Z0PA 4Q3DA 4D3SA 4OX9B 4BQFA 4ZQHA 4K6GA 5GTDA 5IUNC 2MT9A 3OZIA 1CNFA 4J1NA 2ANBA 4Y6OA 5C8YB 2ORED 3DV0A 3PHCA 4EYOA 3G82C 2V1UA 4WK2B 3RYCA 4JI6B 2YV4A 3B1WA 1X42A 1YZQA 1XLTC 3ENZA 3OX2A 5LMZA 2WVGA 3KAPA 1HRDA 1QH0A 1JX6A 4E7PA 5ALMA 1P5RA 2O6LA 4IJMA 2HADA 3SQOA 3C5CA 4HB0A 1E5LA 1JVNA 1P60A 4RMHA 3THSA 5MF6A 1GCAA 1JP7A 1JQAA 4XGIA 1SD5A 2BMFA 3ZW7A 4DIKA 3AFHA 3ANTA 1L5QA 3JQAB 3OX1A 4G5XA 2XAUA 4GQIA 4BRUA 3JQ9C 3GLSA 5BMVF 5LPNA 4K26A 3L7KA 1Z6ZA 2EX1A 2I6SA 1DRWA 4WFJA 3SLGA 2X58A 4P31A 1IG3A 5KO2A 4ZV9A 4K86A 3FYUB 4NIMA 3TOVA 1TJPB 3MJRA 1ZM9A 2C98A 2YW9A 3PIRA 2A6PA 2REQB 3EEFA 4KFCA 3OTQA 3O9ZA 1JEYB 1HQDA 1RIFA 3GCZA 3HKDA 2VJNA 4ER5A 4HLUA 2VS1A 2GRUA 1IEWA 3L1IA 2PRYA 5TGDA 1FUKA 3E81A 1JE1A 2XUHA 1NJFA 4QQ8A 4BGIA 3HYLA 3IKVA 3T1NA 4FIZA 2FMXA 3AJRA 1IULA 3KKLA 3W5SA 4C6SA 2OLJA 1SPBS 2Q0HA 3EXFB 2B1QA 1FYWA 4MVXA 3ZHZA 3H2BA 3EGEA 1N2CE 4OFZA 3RS9A 1XAJA 4HADA 1K5DA 1O5TA 4CF7A 1CVRA 5FR1A 1EG7A 4KXWA 4DLYA 1Y7PA 1FDWA 1FDSA 2P2ZA 4F12A 5EYPA 1A4IA 1L4LA 3ITEA 3D7RA 4GI3A 1I6KA 1A50B 3LPDA 4OHBA 4IGIA 1K68A 3CWQA 4MGYR 1O58A 2CB9A 1UK7A 1XZNA 2IIPA 2R8XA 3GVXA 4WZBB 3MC1A 4DIEA 5BSUA 1W6UA 2XVMA 2VF7A 2QX9A 2GYWA 1Z6YA 4RV9A 4DV5B 3FI9A 4HN2A 1U8UA 2QW0X 1DFGA 2Q5FA 4J0GA 2FF7A 3VOTA 2HJGA 2RAVA 1Y3CE 1B42A 2WC1A 4G89A 3WMEA 1BCSB 2OEPA 3HKEA 1LXCA 4ZCSA 4PX9A 3U3MA 4P84A 4Z0NA 1SOAA 3PWZA 3LV8A 4D4MA 4ZEMA 5KC8A 4PW0A 2BI8A 3OM1A 1PNOA 1U9ZA 1H9BA 2OC9A 3LYUA 4HNSA 1EJ6A 4LRTB 4BJ5A 2ZVDA 1O87A 4BDTA 3TIVA 2YMPA 3W5HA 3I1YA 3LT5A 4HWTA 4PCLA 5D3QA 3U37A 3HDGA 1G21A 1VMIA 1RT9A 4ENUA 3S4YA 2PUFA 1Q0UA 1VYHA 3WL4A 5DX1A 5HUJA 1B74A 1X0XA 1ORHA 3FWNA 3SIWA 5JS7A 1BQ4A 3CVYA 2QRLA 3IBGA 2BLNA 2CDAA 4B7AA 2QVGA 3EH2A 2QZ4A 3W34A 3OZEA 4K3VA 3V00A 2QDKA 3KOWA 2C7GA 4AQDA 3TJZA 2Q0SA 4KH1A 1M6EX 3VKFA 3UXMA 1JT9A 3KHSA 2P41A 2EBFX 4QPNA 5BNFA 1MAUA 3LFHA 1XLVA 4F60A 3OH8A 4TSRA 2F55A 2YCBA 3O47A 1PBNA 4G0WA 3ME5A 5DNAA 2Z56A 3TE7A 2Q3MA 1X19A 3CISA 2YFQA 4IG9A 5A62A 3ZE7A 1YJXA 2X4GA 4CPDA 2IE0A 1ZD3A 1KP3A 3NO4A 4EM6A 4E22A 4BFSA 1VJDA 2ECOA 4DZZA 2HMTA 3I1IA 5JBIA 3FVTA 3PNLA 1WV0A 3KLPX 1GQSA 2CV1A 1EGQA 2ZS7A 1CZHA 1FQKA 1ZOOA 1I32A 2AVNA 1PJLA 4RMIA 2EKDA 3UGTA 4OA8A 5CB4B 2E1PA 2PH5A 4JENA 3A1WA 3DDSA 3AEKB 3CS3A 1RM4A 1V95A 3IQWA 3M9LA 4ND8A 1W88A 4C0AC 5JW6A 1HDGO 3MMSA 4A6EA 1JKJB 3B9QA 4IJ5A 3F0TA 2CUNA 3GA0A 5E95A 1V37A 4EGAA 4IQ4A 4RTJA 1EP1B 4LAFA 5L4SA 3T4XA 4C14A 5CXQA 3V1LA 4X60A 2DQ4A 3AIMA 1EQUA 3GXBA 3KZVA 2P67A 2CHFA 2D4AA 2IKQA 4V0QA 4L2IB 4YAFA 3OEHA 4ZAGA 5BSTA 2C7OA 1JDSA 3O4VA 4IINA 1M76A 4QBTA 1GDHA 4BO4A 2ZB4A 4WI1A 1NPTO 4FGKA 1YQUA 1RFLA 5T8KC 3N1UA 3O3MB 4CN8A 1PTJC 3ZIUA 2H9AA 1HT1E 2RGAA 1HT2E 4CEIA 2FETA 2HQOA 3JWEA 4ESVA 4HDKB 4NMXB 1AKTA 2DQZA 5JCJA 2OHVA 4QELA 4LBVA 1TMGE 3A6ZA 3CKYA 2GM3A 4N40A 2V9ZA 1TQDA 2R1ZA 3C41J 3HN6A 5H4GA 1GRVA 2IU0A 2XMQA 2XHZA 4QYXA 4B4VA 2EP8A 5HUHA 5CYOA 3FNIA 4KB5A 2H63A 4UHHA 4ASUA 1R8QA 2DPYA 3OQHA 4BQIA 3HVIA 2X41A 1ECFA 3DTVA 3FDXA 3P0IA 1QRSA 1CSEE 4ESEA 4CM1A 2P65A 4HKTA 5BN4B 1PK8A 4EELA 1P2TA 1WU7A 1JSRA 1EFRA 1JZSA 2QN2A 2V3VA 3Q9UA 5F9MA 1U98A 1ABFA 2C5SA 3WMWA 1DIAA 4OAQA 4AN1A 4F9FA 2FK8A 3GUCA 3ROMA 3ENWA 4Z9FA 4HVLA 1QIIA 2DWPA 3QQ5A 1SOUA 4CEJB 3K94A 2MJLA 4Q5IA 1F0PA 5FHRA 4JBNA 3ZLJA 5HDQA 1KEUA 5HFAA 1AKVA 2YNMD 4TTAA 3B1YA 1SGWA 4ID3A 3IC5A 4UBOA 5JR3A 4ND2A 3GGJA 3PR3A 3K0FB 2EX4A 1V0JA 1K6EA 3P9QA 4ME6A 4E5UA 3CVVA 2PGOA 1KI6B 1S2NA 1S2LA 3A27A 4B44A 5JZOA 2J7PD 4PRKA 4RESA 5T64A 4CIBA 4B4UA 1PX2A 3RROA 1Y4DE 1DJPA 1ZX1A 2MYPA 2Q3EA 1OFIA 2OESA 3PCTA 4MZXA 1HTWA 3MMNA 4UU8A 3TDNA 4YRZA 4ZYLA 5C37A 1T2FA 2UUCB 1SBHA 4R54A 5FWYA 1ETHA 3EEYA 1CUEA 1ORIA 3C1UA 5ES3A 2C58A 1WNFA 3QVGB 4IIJF 1H6CA 3T7EA 3G2PA 2E6UX 1V2GA 1YRWA 4JLSA 3WB2A 3OZRA 1FMJA 2R6ZA 5FUWA 3H5IA 2A7XA 2VP0A 1GTMA 5FYQA 5BXQC 3ZCPA 1M2VA 1YD7A 4Q66C 1BGXT 3PPYA 3VC3A 2CXQA 4ZTUB 4IS2A 1Q50A 3AW9A 2AXPA 4OB8A 3ZK9A 2H2IA 2P9CA 1NNLA 1PF7E 2ZB3A 5HE9A 4I1UA 3GLVA 1ODCA 1A9TA 4D8XA 4TYMA 4GRDA 2XIQA 2ZYTX 1QF7A 2PGJA 4M9CA 4PE5B 5IASA 5AOVA 1KOGA 1MU0A 2VNHA 3I9V1 4E13A 5KYUB 1TJ5A 3T1TA 4HZGA 1GAJA 1OXUA 4U0JA 4PGHA 5EMHA 5GGYA 4XYMA 2WKRA 3IHLA 2F1IA 3B6IA 4HDQB 1FFEA 1T0PA 2P9BA 1UINA 3AK4A 4Y2UA 1MJ5A 3DDHA 3SI7A 3QEAZ 3P9NA 4R31A 1PUIA 1N1EA 2VDVE 4C20A 3WV4A 1ZVJA 4DEVA 5B64A 1ODJA 3ZKWA 4BQOA 2EJUA 3M82A 3QVTA 1X6VA 5ALFA 5J2UF 2TYSB 4M1SA 1RBQA 3G1UA 4QO8A 3QK7A 4XE5A 4D0GA 1V8BA 4UFOA 1WVMA 3QW4B 1OTXA 3VBEA 4RPLA 2PVCA 3HCWA 3EAQA 3I0NA 2NUAB 1EEHA 1KY2A 2I7VA 2OD7A 2HHJA 2XV1A 1A5AB 1ZOIA 3I01A 5A6SB 5CVTA 1QP0A 1ISIA 1HI9A 4MYSA 1F48A 2RHOA 4B6FA 5HWSA 4MKZA 5AKLA 4JQYA 2OZVA 3G23A 4M38A 4ACBA 3KTAA 4HDCA 4M46A 1II9A 1WA5A 4EGJA 3AB8A 2AG5A 1ZIDA 2XBLA 3PL5A 3MB8A 2G8LA 2YVKA 4Y2XA 3D8NA 2CMFA 1PS9A 1EVIA 1Z88A 5LQCA 5G4LA 2AOXA 3UKJA 3IOYA 1U90A 2A1UB 2P2YA 2BTQB 4HXGA 1UKZA 4OQLA 3UWMA 1Y4ZA 1UDAA 3STTA 4B4WA 1A8PA 3ON5A 4Q21A 1J9ZA 1XNJA 3RVJA 2QUZA 1CS4C 4E5DA 5FDFA 5JAIA 1RZRD 5L6MB 3NU1A 4XJXA 1YJCA 4FFLA 2IPXA 4RJTA 3EQ7A 2FZWA 4EAQA 2F4VB 2WM3A 5K03A 1XROA 1YVRA 4FYIA 2QZJA 2ZE7A 3IAM6 5FTJA 1DJMA 4NQZA 1LDMA 2E85A 2A9FA 4RMJA 3A9UA 3WYDA 4ZYZA 1GCGA 5JCOA 4JJGA 2ZYGA 1R9MA 4F3YA 2G1JA 2XMCA 4FINA 3OU7A 4JLOA 5DBHX 1JB9A 3ELBA 1MT0A 3OURA 5ITZA 2FMKA 1E59A 4NFLA 1MEOA 3SY8A 2ONZA 1QO0D 2GZDA 1Z6QA 2IQ5A 2WM9B 1AGYA 1KYIA 2IVZA 2IZ5A 4DN6A 1NA5A 2QLMA 4PC6A 4XGQA 3A0UA 1TKRA 1Z8HA 2OBMA 2PLRA 3SKYA 1N5MA 4HQRA 5B1IA 5IFLA 4KRFA 3BWVA 1GNSA 3DOIA 4FDLA 4WY2A 5F3RA 2COUA 2C9BA 1TAHA 3P71T 1XPJA 4LZJA 3T3MB 1K3TA 3PXAA 2X0FA 3O92A 3KJIA 4LF4B 2ZRJA 3WB0A 4RK5A 4NP6A 3UKDA 2O1XA 4DCOA 2N47A 3G2HA 3HI6A 4BLPA 4XEHA 5IYZF 4MR8A 3FGNA 3GGGA 2A9RA 1I7DA 2AQ8A 3EDRA 1T24A 2CLDX 2FF5A 4GOKA 4ZVTA 1T6BY 1ZKDA 1JT2A 1TUBA 2XE4A 3EF0A 3S29A 5KWVA 2YQZA 4HLDA 4ZZ2A 2I4RA 5JUWA 2E7ZA 3DV0B 4GKJB 2VDRB 4UNIA 2ZBRA 1LPPA 5C8VA 2DTDA 4ZOAA 1HQCA 1E3JA 1PR6A 2SNIE 3RAEC 5TF4A 3TQIA 4C0JA 2LBPA 4B40A 2YHSA 1XC7A 2NPFA 4N47A 1TUIA 1KIAA 4W4TA 4AZ3A 4TKZA 3ER9A 1T5BA 1U28C 1V8PA 5REQB 1NSTA 5DLQC 1QO9A 5MHTA 4ZDKA 2CD7A 1JJAA 5TMBA 4L07A 3LZCA 4UQOA 1OROA 5AJXA 3IUYA 1P62B 1OKKA 1KJNA 1TD1A 3N2KA 3JD4A 4CTKA 4MYRA 5HIMA 1NI4A 1Z4PX 4QGBA 3PE3A 2IYXA 4WSOA 5LQMA 3LZ6A 2W6CX 3CNBA 3ZVLA 5HOQA 5KNDD 3I5XA 2G5CA 2Y4OA 2ZCJA 2EDAA 3KQMA 4Q00A 1MZVA 3U7RA 3W2IA 1LS6A 1XZCA 2O20A 4BVBA 3DV2A 1ZC4A 3BERA 3I9LA 3Q2IA 3BVPA 1PZMA 1J00A 4R9NA 4HWSA 1SCQA 3L7IA 4R1LA 4KIWA 3DFZA 1C3JA 3CE9A 4FCWA 1GTZA 3GJ6A 1VKRA 3RG8A 4CDGA 5U9CA 3ONWA 4ZTZB 3MXTA 3RTDA 3OZCA 1WHTA 4MJXA 2JBHA 3ZDZB 3F6PA 5E4JA 3V4VB 3EF1A 4PFSA 1S96A 3AY0A 2PSSA 1QH8B 1S4MA 1O9BA 5F7XA 2CCGA 2H2FA 2RK6A 5FWDA 5SY9A 2Q0XA 2OC4A 3KXKA 1G8HA 2BDUA 3NEJA 3MWEA 4LDAA 5JDCC 4CF4A 3WX0A 3GC6A 2VSOA 3V1TC 2ACEA 4HH4A 4IVRA 1V6AA 3MJCA 4XCVA 5DE3A 3ANMA 4CMEA 4QATA 3G0GA 3B70A 4ZCPA 3K2BA 4R5MA 1F1BA 1XKXA 3KJHA 4J03A 3TIGA 4V1CA 5AVUA 2ZJBA 3IMCA 5LKRA 4FI3C 1V7ZA 4QARA 2G8NA 3F9IA 4GOXA 2G77B 1YR2A 1P4SA 1POWA 4IFEA 1CQPA 2I62A 1ZC3A 3W6NA 2V7PA 2IA5A 3OHPA 4HAUA 1X3LA 1F7UA 4RC9A 1HDEA 5C52B 3AUUA 1PV1A 4FYPA 1ZD9A 4C0HA 4PYJA 1SKAA 3U4IA 2UZ1B 3RHTA 4CJXA 1Y1PA 2NNLD 1P2BA 3BQMB 4J94A 1UZLA 5EZYB 1Z07A 4MA4A 4XIYA 4DSNA 1TO1E 1DKQA 2A9KA 1VSVA 4OK6A 5EMJA 2NAPA 2ZJ8A 5A5EA 5LIRA 1E8DA 2BM1A 1NZFA 1S3SA 2F3PA 4RETA 1GTVA 1PL7A 4NEQA 1W52X 3N2ZB 1JEJA 5J1TB 5IC5A 1P4RA 3DYBA 3QITA 1R0RE 4Y2QA 3E6AA 2P8SA 5JPDA 1X8XA 2J67A 4GPIB 1UH5A 4WA8A 2G72A 4CGYA 1H8ED 4D3DA 4QXPA 5J59A 3MGGA 4JLVA 1HPLA 1N9GA 2E48A 2PUJA 4DLAA 1N2JA 3PQ3A 4AECA 2AC4A 4ZT5A 1TM2A 2ZWOA 4DR2B 4RH3A 5ADVA 1E1YA 4KO3S 3NGMA 2UU9B 1M5UA 4HX5A 2AOTB 5GZ3A 2JCGA 4F2HA 4I1SA 4ARZB 2PUVA 1DG1G 2FN8A 2JAUA 5CJJA 5BYBA 3SYKA 1NMQA 3NHZA 4OXKA 4BBAA 3JVVA 3RJ5A 1U65A 4PLVA 3T5PA 1RE1A 1P3DA 3Q6NA 1HDIA 1XRLA 3F1KA 3GJSA 2ZIXB 4PYMA 3HR7A 4NYMQ 4PLCA 3UXYA 4EHFA 2KE5A 4GHWA 5CH5A 4X63A 1OWPA 2IU3A 2V96A 3IEKA 2O1WA 3L7BA 4Y9RA 3VM6A 4K40A 4P34A 5KJEA 2CDNA 3Q9SA 3LPLA 4XRGA 3Q8LA 1H4TA 3MM4A 3OUZA 1KJIA 1C4WA 5TT1A 5ALKA 4DSAA 1QG6A 2GERA 2Q5LA 3ESQA 3FWZA 3LKDA 3ZXSA 4AY5A 4UC0A 1C1HA 2Q5IA 2VH5R 4J9UE 2B0JA 2HREA 5HK8A 5B3JA 4F4CA 3WVNA 2CC2A 1FX0B 4E15A 3SE0A 3ANLA 2QNRA 3P0HA 4MIKA 3SG0A 3L46A 1W0JD 4HI0E 4DRXB 2XRFA 3ZGVA 2HU5A 4RZSA 1TKBA 3IPRA 4FT4A 1ESCA 4C4AA 1ULTA 5EXPA 5LZ7A 1K75A 1V8FA 4KQ1A 1M1YE 2Y1CA 2D6FA 1WMFA 1SXJE 2WWYA 1KEVA 1J70A 4TSFD 1VL0A 5LXTA 2AHRA 3LQQA 3C3XA 4RWEA 4X0EA 2XSZA 1Z2AA 5AOBA 3ZJVA 1XF1A 2VT2A 1Y98A 3JYHA 3ASVA 3QJYA 3K9GA 3FYUC 4JB3A 5A6SA 2H7CA 4A16A 4G9EA 1QHXA 5A4FS 4HWGA 2WMOB 3HV0A 2PVPA 2QD1A 3LT4A 4L72A 3I61A 4RF4A 2WJGA 2JD0A 2ZJFA 2YMLA 3JZAA 4WCFC 2PN1A 3L6BA 1ISSA 1O08A 4C01A 3R6TA 5B5SA 2HT1A 3CRZA 4QASA 1I7PA 2B4YA 2PHZA 1ZOSA 3O03A 3RYFB 4ABYA 1OUMA 2GPNA 3KJQA 2JLYA 5CA0B 2G1KA 2NZ2A 3L4KA 3FOBA 2P7IA 3LH5A 3H17A 3OFNA 1FS4A 1JXMA 2ANCA 3DE5X 3ETJA 4KPGA 4BNXA 2QAIA 5FPKA 3EPKA 2GM4A 4HNRA 4BB6A 2ZYDA 3VJRA 2ZJAA 1EEXB 3HS3A 4DYVA 2B7CA 1V8DA 2P3LA 1W4ZA 5EOVA 4ID9A 4Q7KA 5A2GA 1ONNA 5DU2A 5A5GA 1XLTA 3MIZA 5BOSA 2FOLA 1W5BA 2ZU6A 3DVRX 3SDZA 1Y42X 2OAGA 1RFGE 5FBHA 3NBKA 5B58T 5EXTA 2E4WA 3AP3A 1MJFA 4JYBA 1YZ3A 1LI7A 2ZE6A 3MCZA 3MEQA 4WESA 3UOAB 4ALKA 1ZHOA 4E3WA 4NJEB 2XXAB 4X1YB 2BHNA 3GZ4A 4CMCA 1SU7A 1LS1A 4J3JA 1I2BA 4QFBA 4XYGA 3TS1A 4YAGA 4H0NA 5IK2A 1EFRD 4RTNA 3QHAA 1R4MB 1ZD1A 4HUQA 4RF2A 3REQB 1NQOA 1R5OA 1T5TA 4J8PA 1NVGA 2BFFB 2QX7A 1MX1A 2QQEA 3L2OB 1I3KA 2ZXEA 3PQFA 4IDEA 1JQKA 1SBTA 2Y93A 2XT9A 3WHLA 1IIRA 4AMUA 4BNLA 1OJ7A 3IAS1 2O0JA 4ASUD 3HRKA 2E5LB 3UH0A 5ENVA 4CKXA 2PV0A 4OMCA 4IO0A 4MI6A 3ANSA 4RKQA 1M1NA 2YQ5A 3KO8A 3P9YA 1ENZA 3UWSA 1AT1A 1G7CA 4PVCA 3DT9A 2H18A 2GETA 2GN0A 2ZZKA 3ZWKA 4BL5A 1VHWA 3KTOA 4IDQA 2B8NA 3LVRE 3H6HA 1UC9A 5PNTA 3DO8A 4LSMA 4MWEA 4DUGA 4Q37A 1YUBA 3NHAA 3DMYA 4MUFA 4PZ9A 4WBSA 2WP8J 4DCGA 2OK8A 4GE3A 3M2PA 1ZRNA 4LHSA 3AJDA 2NZVG 2X8WA 1UJNA 4WXMA 3BAFA 2EARA 1LF0A 2M32A 2Z8ZA 3CM0A 3M8KA 3T54A 4YRFA 3EVNA 4LE2A 1IUKA 5LP6B 3ABRB 2HV8A 3ANNA 4AT1A 5CCXA 2UYHA 1KHTA 3FTPA 4JP3A 4E5NA 1U2GA 2IYOA 3U7QA 4DB2A 3KXPA 1QJCA 5IVIA 1ZWKA 2BL4A 2HCJB 1JH9A 4QDOA 4XSHA 4B3JA 1OV4A 2JGIA 1BOOA 1DTWA 3AGQA 3DNMA 3K8QA 4HB2A 4IKEA 5FLKA 5FTMA 3H1GA 3V4PB 5KYXB 2IYTA 1XRQA 4AZSA 2QG4A 3IE0A 4O8ZA 3PQCA 5KQGA 1O95A 3ITDA 4JLBA 3V1YA 1GKLA 3ZE6A 4D0SA 4TTPA 1RJFA 3AL0C 4ZZIA 3KOYA 3HCFA 4CKBB 2V97A 3U7JA 1E2HA 2I2XB 5EXEA 3ZQKA 4C7VA 4YDRA 1VG1A 5KOIA 1VBMA 4MKRA 2ZDHA 4L2IA 4TS1A 4HYYA 2B3DA 4Q19A 2I4TA 5ALXA 3T7JA 4LOKA 2QNBA 2R68A 3LUHA 2W4QA 3F67A 2O07A 3S7ZA 2OT3B 5CLIA 3TOXA 3BDAA 4PAOA 2RB4A 1L1RA 4FYXA 3TZHA 1HFKA 4BO0A 4C88A 5BT9A 1Y7IA 4NX2A 2AHOA 2IYPA 4NDAA 1WXGA 3DB2A 3VNUA 3E0QA 2EX0A 3C3KA 4L1KA 1JQDA 1KERA 1YZYA 2I3DA 2YV3A 2ZJ1A 1ELOA 2XQKA 1ARZA 3M3PA 4REMA 1SKYE 5B4UA 2HU7A 3ZVMA 2BKXA 4C06A 1XPUA 1JG7A 4DG5A 1BWQA 4AULA 3LCRA 2J9RA 4QNRA 2O5EA 2P0EA 1H0SA 1EFHA 1JHUA 3FZQA 1LPSA 2YMQA 4KIGA 3EPLA 1ZUD1 4JLWA 3JQGB 3KLMX 4U2GA 2ZUFA 1QZZA 1LGYA 5BWLA 4F4HA 4MMZB 4YJFB 3Q9LA 3VNBA 1Z56C 1RKXA 3PQ8A 3DCYA 1DLIA 3C2QA 5A05A 3RSLA 4XIIA 1S8FA 1CUVA 1DEKA 2ZAMA 1AG9A 4ZO9A 1FL9A 4BE7B 2X8JB 2RGUA 4NR0A 5F1YA 2ZG6A 3W8DA 4ETMA 5HM8A 1TE2A 4DC9A 2AR7A 1OGIA 1ULSA 3CF2A 3AF1A 4PM4A 4ZIRA 2ZXUA 4N48A 5DBFA 3OTHA 1XCLA 5JLJA 4GWLA 2EKBA 2EFGA 2Q1WA 1JKFA 3IDZA 3A6HA 3DLHA 3I09A 4A26A 1DE0A 2LUOA 5EHNA 5KVQA 1S2MA 1XMOB 4EZEA 2ZUBA 4LZNA 1EIWA 4WWHA 3KE8A 4RA6B 3UANA 5K3BA 4KXVA 3OPVA 2VYNA 3FPSA 2XB8A 1MAHA 1DLJA 1PG0A 3BIJA 4A2QA 3ZJUA 2NO4A 2SBTA 1VSBA 3OAAA 1DV1A 3RJTA 1W35A 1J1UA 4JKIA 2WYHA 1Q95A 2H2WA 1C2YA 3TLCA 2XUZA 4S2UA 1KI7A 4CT0A 3ZK7A 3K32A 3GLIE 2OXRA 4BV8A 3RS5A 4BNWA 1LK5A 3QNWA 5A7FA 3IILA 3DO5A 4CF6A 4MMXB 2IUFA 4R2KA 2H00A 3RIGA 3ID6C 2M6KA 4GGOA 1Q1GA 4I1OA 4PFQA 2Q1TA 1MVOA 3EK2A 5DX8A 3I04M 3OCXA 2OUKA 4ITVA 1OLSA 4JA2A 4YI3A 4DV7B 7ADHA 1D6NA 2KI5A 1P61B 1OD6A 3EMBA 5K0FA 4DILA 4OHCA 3HVKA 4GQAA 3UXEA 4E07A 3ZS9A 1R0CA 3OQIA 3DMFA 2JRCA 3COYA 2FVXA 1WCYA 3B5EA 4GECA 4LX0A 3X44A 1AKRA 2C2ZA 3IEUA 3PJEA 3O91A 3ZDAA 2FZVA 2O4UX 3I6MA 2R44A 5IWCA 2CF6A 4C0XA 5FOXA 4D2IA 4OI1A 2Q4EA 4YRSA 3T9AA 2H0QA 1DO0A 5AH0A 1JQ5A 3K35A 3WWDA 2EFHB 4G97A 4RIGA 2PD4A 2ZI5A 1TKCA 3MWGA 1Z0FA 1QONA 1XQYA 3RASA 4YP5A 4QFCA 4DT1A 1UCFA 1ZEMA 3JYPA 4TVOA 4I2NA 4RNCA 1E4EA 1UMCA 3F5MA 3A2MA 3FD8A 3WOVA 2WA1A 2VJMA 3U49A 2I2CA 3UJHA 1YS2X 1NQTA 4I2VA 5CB4A 1MHPA 2V4MA 2QYTA 3A25A 1IIBA 1YDMA 2SKCA 4OLJA 4LDPA 4PYOA 1FZQA 1EE1A 1Y1LA 2CVHA 2R00A 2YVLA 4JUCA 4L4YA 3FTNA 2XVZA 3CF0A 1TT7A 2IH5A 3PC7A 4U9IS 1CBUA 1KC1A 1TZBA 4FFDA 1SN7A 3EXAA 4G4SO 1L5VA 4IQGA 2E4UA 4D98A 5JJKA 1DQRA 2QMUA 1N6OA 5FUVA 2PU5A 4OQ4A 2O0LA 2Q9AA 2WTNA 2AYZA 4P08A 1EFPA 3HJTA 4ECEA 1FP7A 2OGUA 1Q0LA 1Q92A 4ZVLA 1T0UA 4D43A 4E11A 5LU9A 1GITA 2BP7A 2I2WA 3OFJA 4PS1A 1QB8A 1JIVA 1HOXA 3BMCB 4UAVA 3MW8A 2A1UA 3GEDA 4GU5A 1NWHA 3DOFA 3CX8A 3DT6A 4NECA 4B2PA 3U5ZB 1WSAA 2HLNA 1VGRA 4AS3A 4EGQA 3QI2A 1WBBA 1JG3A 1VKHA 2H29A 2DX7A 2HTEA 2CBGA 4NYIQ 3GDWA 4XWKA 1TTQB 3LHIA 4BN5A 4LN1A 5FTNA 5EMKA 4IKPA 1BVUA 3BH7A 4QGSA 4QJIA 5EZYA 1DCTA 1L5FA 4F21A 3KUCA 4FFPA 3G0DA 1OSNA 2DU8A 3GJTA 4Q3EA 3ILYA 4NHEA 3D2CA 5E6UA 3JAWA 3W9SA 3YASA 5TX7A 1E5VA 4YT8A 1P8AA 3KQTA 2WFMA 3EFBA 4WEQA 2PFGA 3I6QA 3UG6A 4F6LA 1G3IA 1QGDA 5I7OA 3ORRA 4IIYA 5DNVA 4JXJA 5T4HA 4PIVA 1WCWA 2F9FA 4AZWA 2QS9A 5K4GA 2Y0DA 3E1KA 1SKBA 1MO5A 3G0HA 5K6TA 3EEOA 4REQB 1X7XA 1GCIA 1XWFA 5DTJA 2BZ1A 5DYWA 2ZRCA 5KYTA 1U2PA 2XNKA 3JSAA 3PSHA 4H1VA 4QX6A 3CGWA 2PMKA 2VHYA 1QF6A 5JJIA 2GT1A 1M6NA 1QAOA 4BRZA 3GB9A 1SBIA 3R9WA 2ZAGA 5AVYA 2HQBA 3LY9A 2WJYA 2HO5A 2VBGA 4L8WB 2RHTA 4NTZA 1A5SB 2Z43A 4MW6A 4WADA 5DM2A 2RI1A 3O8QB 4J0JA 4MVJA 1SHUX 1GT91 5DBEX 1MR3F 1FTGA 3D5EA 1YQQA 5F2EA 3C3CA 4GM4A 4Z4QA 4JASB 2A0FA 2ZYIA 4FBMA 4GPAA 3HM2A 4GX2A 4WW0A 2XA9A 4BIMA 2GF9A 3UKOA 1Z2NX 4AIRA 4EW3A 2DETA 4QZVA 5AKZA 5DT9A 4LE1A 4DIUA 4YMGA 2FPPA 3NNNA 4HO1X 1DVRA 2L2QA 4IIGA 5LP1A 4QJBA 4LY9A 2BGWA 1EK1A 2XT6A 4HH0A 4C2UA 2FZ4A 3DFUA 5IYZA 4UUPA 4RELA 4FTWA 3LX8A 3QVMA 4UBIA 2WLSA 5H8WA 1JA9A 4IHJF 3ADCA 2J6BA 2Q1SA 4FOLA 4XWAA 4AICA 2DHDA 1R50A 1JA0A 5D1HA 3TK1A 4QHYA 4J49A 4JI2B 4ROTA 2AD5A 4K87A 1K4YA 3F9RA 1OBHA 2WSLA 5EUQB 1ZJZA 1E2UA 3LHSA 3M6LA 4P58A 3A2LA 1LZKA 4WKOA 3TG8A 3FW1A 4GBGA 5ESDA 4AP9A 4FOOA 1BGWA 2JI4A 4LRWA 1JLHA 1FYFA 2AC7A 2JIPA 2O8CA 1CR1A 3BRSA 3F49S 2GEDA 4JI1B 1JIKA 3ULKA 3WWPA 5BQFA 2UZ4A 4G5OA 3PC2A 4GICA 1K27A 2W7TA 2VATA 1ZUNB 1N8NA 3JR7A 3VDNB 4A27A 3G59A 3FR7A 2QW1A 4HX9A 1K66A 4KOAA 2WB4A 3W06A 1P74A 5IBPA 1O5IA 5F1OA 4UEOA 1JVSA 4L9AA 5D85A 1ZK1A 3T5TA 4C0SA 7MDHA 4N65A 4PNEA 3WIBA 2H5JA 3EZ9A 3BE8A 4V39A 4HVTA 3TSAA 3ZIAD 5K0ZA 1DJLA 1ESNA 1SVWA 1YO6A 3GBVA 3HLKA 4KLNA 3GCGA 4NFHA 5KWEA 5BV1A 3AR7A 2NSYA 3L41A 3R5KA 4A92A 3SBEA 2O9JA 1SRRA 2RHMA 3U3KA 1W94A 1O6FA 4ZAYA 1PLLA 1YC2A 1ZCZA 2YXEA 1XZGA 2OCDA 4XFDA 3OM8A 1GV1A 1A3CA 3TSOA 5BSKA 3AIKA 2B5OA 2VP2A 1M8KA 3E8XA 4Y1GA 5HGJA 3G2MA 3SZMA 2Q3DA 3HUDA 1WULS 3HKCB 2J3MA 2AFIB 1N0WA 2PEZA 3AIOA 4HFNA 4INAA 1B6SA 2R6GA 4JT8A 4LW8A 2PL5A 4UVEA 4BKPA 5BUQA 1M54A 2D0PB 2I4IA 3NIFB 3AUTA 1N3IA 2FSSA 4F9GA 3SSAA 1GTJ1 3BKXA 2IRWA 4RANA 2CDRA 1DS6A 2WJVA 1GLVA 3KV3O 5ELXA 1JHRA 1K1EA 3PNMA 5I3ZA 3BGSA 2H9IA 2HF8A 1UBOS 3N3BC 2DECA 3PD7A 1RE0A 2EC5A 1V16B 3K2EA 2YV1A 2NU7A 3SJAA 5DWVA 4B09A 5LQNA 2VA8A 4KIUA 1ZFNA 3VR6D 5AXDA 3FPAA 1UWCA 1AKUA 2JJ2A 2CDCA 2DWQA 2C94A 2I7TA 4M9XA 1MQ9A 3I73A 2QTNA 2Y9MB 1Z8NA 4QU8A 5JTUA 3P5SA 2H06A 5H80A 4MV6A 2XCSB 1KI9A 2GLTA 3IAHA 2E82A 4TYPA 3F6YA 1LQTA 4TLCA 2PFKA 1X9GA 2FWIA 3RK0A 3FOZA 2GPBA 4XB1A 4E4TA 3O8BA 1UODA 1WF3A 1ZNXA 2Q29A 2C8VA 4OO3A 4PO9A 1A8IA 3R9XB 2R5WA 1NJ5A 1U9IA 2H54A 3GT0A 4WK0B 1JDNA 4YGXB 4MX8A 4C5AA 4BFCA 1UXKA 2W11A 5TS2A 4DCNA 4MQFB 5CAEB 4XKJA 2JGDB 2I6XA 3EBPA 4YO7A 4AF8A 2PBLA 4G5GA 5A4MS 3OIWA 4GOLD 5C8DA 1T5DX 3K5HA 4JVNA 4EECA 4F97A 3JQBC 1NC3A 1NVVR 2VNJA 3WE7A 2ONCA 5HRAA 4Z53A 3R20A 1P73A 3C4QA 4HDNB 4B45A 3C1OA 4Y9DA 4P4TA 1QH1A 1MCZA 2QA5A 1IQPA 2VJDA 5EZ6B 1DCFA 4WACA 3TBHA 5IH7A 2QQGA 5KYWA 4HJXA 4E70A 3UAWA 3IUEA 1U3GA 2I4OA 1P7WA 5JJBA 3VSBA 1NV8A 2QM0A 4HHEA 4MO9A 4B1FA 4Z4FA 5KNBD 3ES9A 3JVUA 2VUHB 1RYMA 2ZYSA 4RVHA 3BAZA 5BUSA 4OG2A 3DVAA 2X4LA 1JHVA 1I7SB 1GA4A 1PQPA 2YWJA 2VZ0A 3NM4A 4EO7A 2CFIA 3ZHYA 2FPWA 4RSGA 4Z99A 2QXYA 4ZMSA 5GINE 4CT4B 2HJSA 4TV8F 1KVRA 2JZOA 4MO2A 4JT2A 1I13A 1ZIOA 4YONB 4CKYA 4DWOA 5K8JB 4HLNA 2HPZA 4ITUA 3DTYA 5FF9A 4NCJA 3LRXA 4PO8A 3H19A 3P20A 2FPLA 3FIJA 2BEUA 3O73A 4OOFA 4UVIA 4W82A 3WGUA 2A0UA 2Y9PB 2OBFA 4BZZA 5ADWA 1IXKA 4HWKA 1HG0A 4IOJA 5HSGA 2B20A 2C04A 2IHVA 1GTSA 1ONOA 3KKEA 1JRLA 4IJKA 4LGVA 2ERXA 2IFTA 3G85A 1HOTA 1BO6A 3ASUA 3GFGA 3GJ5A 2X1LA 1G8SA 3KPWA 4NV0A 2DXIA 3QKWA 4GPEA 1D1QA 1VGVA 3H5LA 1FTQA 5JIBA 2PL9A 2B21A 4LFCB 3VHQA 3DBHA 4G85A 2YV5A 2O7SA 1Q19A 4AJHA 5HS4A 1JKIA 1AGPA 5HP4A 1GAEO 4DNPA 1BMFA 4D57A 4DSUA 2HZ7A 2XWBF 1WOYA 3R3SA 2B78A 2IW1A 4II3A 4CG2A 4E5PA 3CSUA 1KYTA 3CCFA 3PEFA 4JLUA 4MXDA 2Y1FA 3EQZA 5GIPE 4QUBA 1U5BB 2Z95A 3AKZA 3QPDA 5IG2A 5DM1A 3ZU3A 2H1SA 1XG5A 2X7XA 6AT1A 3HUFA 3TCXB 1L5OA 1W73A 1SVIA 4L50A 2NAFA 4ZVQA 3ZQUA 1OVGA 5F5LA 4NZYA 3FWPA 3ZEAA 3H65A 4HATA 1MOZA 1WCIB 4RMGA 4TTIA 1RSZA 4FSXA 3VC1A 1I5EA 2QTCA 3CEMA 1CUIA 4CDRA 2BKAA 2ZBUA 1XCJA 3WKCA 2LW7A 2Q3FA 5JI2E 2XZDA 3I32A 3KG2A 4HMPA 2DC1A 2FLVA 4AKEA 1G1MA 5EJ4A 5IXYA 3I2GA 3PFGA 1KWKA 4YREA 3UT5A 4TXNA 4ESOA 1Q91A 4WBNA 1KVUA 1RVV1 3FG9A 3KC2A 3L6OO 3A37A 1RI5A 3OLZA 4G0XA 4GRIA 4GX1A 3WAKA 4DE5A 1MD9A 2FW1A 4JLKA 5FNVA 1EP3B 4ZWNA 3T12A 3UCFA 4EHAA 5AW6A 4UCWA 5DHAA 3JSXA 2J4FA 3G0BA 3UF0A 3GOHA 1P6XA 4PRYA 3N0RA 5ER9A 4ALMA 1JI0A 2GJAA 2VDWB 4PBRA 5KTPA 3RE1A 2GYYA 1NR7A 2OILA 4EMTA 1JBQA 1U8FO 3OU6A 4Q4LA 1GZDA 4DDWA 4B80A 1C5KA 4MYCA 1KMQA 1RHKA 2FPPB 5BNWA 5MGNA 5C34B 4X3OA 1CJVC 2I80A 3DAOA 1UBJS 2REQA 5CXXA 1DU4A 1P8JA 1QHEA 3SC4A 1CZRA 1DNPA 4ER7A 4MQMA 3RO7A 1OAOC 5LOVF 1ECCA 1XAGA 4IHQA 1N4AA 4QUAA 2WU0A 2HBYA 3CF6R 4RD6A 3EDOA 4KK3A 5TJ9A 2AVDA 1BU8A 2B7LA 4K0KB 1NQWA 3UAGA 2B94A 3SK0A 2DPHA 3NRBA 3P9KA 4LC0A 3Q10A 2WYWA 5KTSA 3PA6A 3LC2O 1JLKA 4LHXA 1W47A 2VJMB 4N3GA 4HNAB 2V7XA 4OIFA 3SIXA 2YH2A 2E1RA 3OM9A 2OLEA 5CEEA 1J0EA 1FYDA 3GL9A 5CA1B 3ITNA 1J5EB 4LA4A 2QL6A 1HO3A 5K6RA 3NANA 5J5CA 4P4SA 4MR7B 3PTZA 3DEIA 3W5VA 4X65B 4IAOA 3O4HA 4FMCF 3RIXA 2YXPX 2AZDA 2H1RA 2OFFA 2GYUA 4AUNA 4IIVA 2Y99A 2PQ2A 1PFKA 1SC1A 4EUEA 3IVAA 1J8VA 1JJFA 3FSGD 3BFPA 2XKAA 4BP9A 4PYNA 4FYHA 1KIFA 2E89A 3CBQA 2QTVB 1N3BA 2FMHA 2GPJA 4YAOA 1NC1A 10MHA 4PFKA 1FZTA 1YS4A 4Y3UA 4R0MA 1TQ4A 3MCVA 4ZHQB 4M8IA 5KJCA 4RQUA 1QFMA 5TQ0B 3ZS8A 4CTJA 2AR9A 3Q15C 1CQWA 1JAXA 4CLXA 2G1AA 4C4TA 1C8LA 2NYRA 1SG0A 3PC3A 1R88A 2XMDA 4M21A 4Q39A 5ITWA 1XTZA 1T9BA 1JL3A 4UZSA 5KC9A 2RJOA 4CETA 2C2WA 4PXSA 1CLEA 2Y05A 1PJ2A 2NM0A 3IP9A 4F3KA 3JWJA 4WJKB 8AT1A 3PQEA 3BA6A 3BX1A 2PXXA 1M2GA 1U6IA 3RVBA 2KB0A 3SDSA 3SOZA 1XXHB 2IP4A 4DARA 2QSJA 4BBPA 1J24A 1TLFA 2OENG 3OPYA 4XASA 3SYTA 3WRXA 1K4MA 1E2JA 3NHFA 3AHIA 2DQSA 1G20E 2PXAA 1BDBA 2VYQA 4P92A 4UZFA 4BBJA 5BN3B 5JASA 1D1PA 1USIA 3TTTA 4EH1A 1GPYA 3WL8A 3RG2A 4Z5XA 5FOWA 3HCNA 5D86A 1SVLA 1IOLA 1WF6A 2ZSHA 1OBCA 4MWZA 4LZWA 3CIOA 4X5OA 5ILOA 1Z75A 1OYOA 3WFIA 3VKHA 1SQSA 4YWJA 5HEKA 3ZWDA 3PITA 5KZMB 2CHUA 4LKOA 5DWDA 1H2BA 4RFSB 4ZRNA 1VB5A 2PKEA 4QYTA 5AJHA 4EG6A 4ZOLB 1KMNA 3UGQA 1UBKS 4KR6A 1BHSA 4PLYA 4JFRA 2PX2A 1IY2A 1CVLA 3R7SA 3RAGA 5EJ8A 2ODPA 1RJGA 3ED1A 4HGRA 3AWDA 1ZY2A 2C3OA 4JHLA 4ND8B 4I4NA 3FNQA 2PT9A 3MMZA 3E1GA 4I4LA 4MHSA 4EWLA 2IUEA 2H59A 2ZR8A 2WILA 2YMMA 2C4HA 3X1JA 3C16C 2JIDA 2R7KA 2OORC 1KOFA 2C2KA 4WZ6A 1T9GR 5HF8A 3I5MA 2ZJOA 1R37A 1L4EA 3OZAA 1FEZA 4HFRA 4U7GA 5FLEX 1JA1A 1RJWA 4UD2A 5CITA 3EPJA 3QX3A 1WSDA 1NXTA 2ECFA 2DFDA 2ZANA 3K1TA 4NU8X 4XB6B 3UVEA 3GLFE 5LR6A 2VLIA 2O7VA 1JPVA 1XMXA 1GIAA 2HDNB 2QTZA 3QPWA 3VQTA 3IAEA 4BJ1A 4C43A 5UKDA 3FBGA 5BSRA 4LXHA 1UOQA 3CONA 1HORA 1E4YA 3EGIA 4XARA 5SV2A 2QX6A 3ZVKA 3D7KA 4G6ZA 3VR2D 2D59A 2GRJA 2DKFA 2VXBA 2WF6A 3LO8A 1MVNA 3U13A 4NAUA 1N6LA 1R6TA 5IS2A 1E0AA 3GFRA 1X92A 5JAHA 1K88A 1ZI6A 3PC8C 3WWYA 5A3QA 1PVOA 3ZC3A 1SM4A 3D64A 4RHFA 3BRWD 1W93A 1MXHA 1KBZA 2KLBA 2EKPA 3DBOB 1GGFA 4I4CA 4OQZA 1EM6A 3PVZA 5I7FA 2WWFA 3COPA 5F2OA 5LOVB 2C3YA 1T5HX 4B5LA 1IE3A 4DLKA 4QG3A 2O0MA 2ZIVB 3QBVA 3OP1A 4PZPA 3WMFA 4CNQA 1NVEA 3SKVA 5JJLA 2NLOA 3BK7A 1ZN9A 4L51A 4OQYA 5JDIA 3HXMA 2WNSA 2ZSFA 3M81A 3DJFA 3KSAC 3F5SA 1D7OA 2ODEA 3H2SA 4M1EA 3BH6A 4XWWA 4YRTA 3T7RA 2X5NA 5C35A 1Z63A 1IK4A 2DQKA 2XIJA 1K8QA 1CQZA 4NBWA 5HZHA 3DE4X 3VPAA 1GOTA 2GNAA 1C7JA 4A6PA 2CJPA 3OA2A 1FSZA 1UFQA 3MUFA 4ESHA 4CMEC 1J2EA 2LVBA 2WD7B 3PRKE 1PV2A 4WN9A 2JK1A 3BE6A 4JOCA 2CLFB 2DULA 3EAFA 2XMBA 3C7AA 1T5SA 2HJVA 1AVTA 3RUHA 1TX4B 3AH8A 3HEAA 3UGKA 1TJ4A 1U8XX 1U0OC 2YFKA 3UJBA 4CUJA 1ZISA 4CMKA 3BRWA 5AW0A 1XZKA 1JR3A 3CH6A 4RPCA 1QKIA 1HSOA 4BZXA 3UMMA 1SG9A 3ND8A 4ZI7A 3WLPA 5J2TB 2C1EA 2YWDA 3EYWA 4GOOD 4KLAA 3UT5B 3HL4A 4PR0A 2J3KA 1QPZA 3RIEA 2XDQB 2XWSA 3JWIA 2FFBA 2W4IA 2CB0A 4A0GA 2QX8A 4OM7A 3D4OA 1SCJA 4QTZA 1OW3B 4UDOA 3RV4A 5KDLA 3V9PA 3VJLA 5LBIA 5KEIA 4BNYA 4H1HA 1LU9A 5K3SA 3WLNA 1SZJG 1ZK0A 1Z6GA 3W90A 1BXGB 4A0FA 2QY6A 2UXBB 1G20B 2ZT6A 4G9BA 4DMHA 4BO1A 3L1VA 4G3XA 3OCUA 1UBFA 2ZP1A 4BB9A 3GRZA 2QWXA 1L5SA 2N9UA 1JFFB 4JBWA 3TDMA 3ZTWA 3D8UA 4Q03A 1KNQA 2JHPA 5AKKA 1FSPA 1DHRA 4R8LA 3AKEA 3CKLA 2FR0A 2YW2A 1NVDA 3GUHA 3RF7A 4MLDA 3TIFA 4TTSA 3U3OA 3JZDA 5FUMA 5LYJF 2OO7A 3UWOA 1YC5A 4FN5A 4BPRA 2WAXA 3A4MA 3CU5A 3VFDA 4AKGA 2QROA 4UTXA 1K06A 4TMTA 3RSSA 5C2JB 4S3MA 3QIVA 1HZZA 5HIKA 4UVDA 1IEXA 4Q24A 3O8DA 3GIWA 3EXEA 4Q3BA 5CYPA 3HN2A 3R5TA 5EPEA 4EUKA 3GA7A 3H2KA 4BFWA 1OKKD 3RBZA 4DY6A 3HR4A 4EGSA 1J0CA 5B1HA 1WZ2A 3ABZA 2N3ZA 5JG7A 2X0NA 1RQXA 2GZSA 4PZLA 2CEAA 1EKXA 2X9GA 1E3IA 2ZCUA 1YQDA 3AGPA 2FAXA 1A95A 4FR5A 5IP5A 1UBGA 1YB5A 3KETA 1I3LA 1W85B 3AFOA 3DE3X 3PGLA 1QTRA 4KE7A 5B3JC 1CRWG 1N2EA 1D09A 4X8HA 4RDCA 4GC9A 1PSWA 3ODPA 3UHJA 2XCUA 4ZAZA 2Z2KA 3ZKWB 1HEYA 2A9OA 5FTLA 4L6IA 3O8NA 3O2NA 4P1ZA 1U7HA 4BMSA 3FMGA 3D7LA 4L9SA 5CA1A 3SS8A 4FFRA 2ZEJA 2BH2A 1WQ3A 2MSNA 4DOMA 2OP0A 4JBGA 1Q7GA 3NNSA 4JGGA 4YPVA 3WA7A 1QQAA 3PZBA 1K8YB 1Y6QA 2EW2A 1E7WA 5JISA 3M6IA 4RTRA 2WG1A 3AZQA 2IUYA 2ZWIA 4EJSB 2QTTA 3QSYA 2YHIA 2ZRNA 3T5GA 4MVJE 4OFWA 3UHAA 3FOWA 4WDQA 2PO7A 3EJ6A 1M34B 1U8AA 2GN2A 1F8XA 3L5OA 2PKYX 5CLQA 2AA3A 3QWBA 3SEAA 3ZHVA 3LBAA 4KGZA 1E3LA 4JP8A 4QOFA 3GLGB 4FJ2A 4MDFA 1IZ8A 3UJ6A 2B1IA 2VK4A 3EX7C 2C7VA 3HNPA 4WK6A 3FSGA 1SMKA 3RWBA 3S2ZA 16PKA 1DEXA 4O8CA 1K8RA 4JMPA 3ECSA 3RTAA 1R15A 3F7TA 3KAJA 4RIHA 1FTSA 1FXSA 1PDOA 2HC9A 3JZMA 1YIDA 1LWNA 2RK3A 3L4BA 1TZCA 1TJ3A 1L7NA 3A9TA 4FZ5A 4CG0A 4ZGWA 1TVKA 1Z8DA 3UMRA 1Z4MA 3SM3A 1Q1EA 3DGFC 4EPVA 5BXYA 1HRKA 2F1KA 3N8DA 1QHHA 2E4YA 3WAJA 1D2NA 2I4MA 3O8LA 4I6EA 4RS4A 1NMYA 1ODSA 3WKAA 1H05A 3K0FA 4RF3A 1SIBE 2IYUA 5JFGA 1VE7A 2GN8A 4MV5A 1JHMA 4BUJA 4IFIA 4QAQA 1DO8A 1P0IA 1T3TA 2OHJA 3KDAA 3O7MA 1XMQB 3C7TA 4X8LA 3A6KA 1BJKA 5A4AA 3PNYA 3RPEA 4CQMB 3LBNA 1QIJA 4BAGA 2VYFA 4NZNA 4ARZA 3E23A 5FWNA 5IT9A 4PNZA 3FUTA 3IV9A 4FBLA 4EY6A 2B4QA 1SZPA 1Y9ZA 2RE8A 1MB0A 4UQLA 4AJLA 4YCLA 4DIBA 2QN9A 3HU2A 3L1KA 1MW9X 4YRAA 1YT5A 1F2UA 1V39A 3R1IA 2ZIXA 4H2DA 4XYLA 4QXRA 1DTWB 4GD3Q 4WPGA 3TW4A 3VHXA 3HB4X 1JR3E 4DLNA 3QLEA 1EGHA 2OYSA 3K20A 4HEA1 3S2EA 1TM1E 3KYJB 4F1JA 5FV7A 1FLNA 2Z9DA 3QTBA 3S2YA 1PD1A 3KKKA 4S05A 1L8AA 2IITA 2P9YA 3TDKA 2CJWA 2GPSA 4N82A 1VCIA 4F11A 4WBNB 1SCUB 1P4AA 3GLHB 4KWTA 3Q1LA 1JLRA 2YJNA 3N2IA 3NIBA 1YQTA 1KQNA 5K99A 5FH9A 2J9FB 3F5DA 2L17A 4NF2A 3DZCA 2ZRGA 2WUEA 1P18A 1QWSA 2WJHA 1Z12A 3WLQA 3U4CA 3I53A 2P9JA 2VDKB 1A7AA 4NE2A 2H0RA 1S2OA 4GVLA 5ESXA 3K0SA 1BJTA 1OA1A 2VRBA 1XO1A 1Y1RA 1ZL0A 1NP6A 2YOHA 1OFVA 2ZTLA 1X1SA 2FG5A 3LFUA 3O75A 1N5IA 3S1SA 3LL4A 4F2GA 2P2LA 2ZDQA 1VPDA 3S0JA 2FJUA 3VU9B 2GK7A 1JB1A 4A3SA 1ZGAA 4BC0A 3WYGA 1QIGA 3N07A 1FFHA 1ZQ9A 2PGNA 3I0MA 4FE3A 4RV5A 3SEZA 3AW8A 4DUPA 5IJ0A 3L02A 1RLMA 1RRFA 3JTEA 4H4EA 3R6LA 4WH0A 3L1HA 4W1RA 2D74A 1LDGA 1MEJA 1YL5A 2A1IA 3E9DA 3K0EA 2HJ9A 5KVVA 1XTQA 1DEHA 2XW6A 2PZLA 2ZAYA 1AU9A 1ZI8A 1TYDE 3H6KA 3I72A 3K7EA 3LBIA 3OIUA 3F6SA 5AIBA 5C7IO 3IMFA 4AC9A 3ACCA 2XF8A 1FUIA 3FYCA 3KT0A 3V1UA 4EARA 4GWKA 4LMAA 3LDAA 3R0XA 4P5DA 4WZAE 5AJWA 3STUA 4R1TA 1DUVG 3OZFA 1AF4A 3GRCA 4ZEXA 2BR3A 2W2PA 3NT4A 4UASA 4L6AA 3L6EA 3TRDA 4IIFA 4RHUA 5CDHA 2UYYA 1ZN7A 3D31A 4L0QA 1R0SA 1B8OA 4EPRA 3LX5A 1MIOA 3I9NA 3LUGA 2A1TR 1X3SA 1NVAA 2VDQB 4OK5A 3IP1A 2JEZA 3WMRA 3V42A 2GILA 2H07A 2W8BB 5ALTA 1HE3A 1UBLS 1M10A 1UEXC 3FWYA 1NVUQ 3PNQA 3TRIA 5KSWB 1MJNA 3R6DA 2VK1A 4KE9A 2V03A 4O0LA 4O59O 2XE6A 4P4UA 4KG7A 1FB5A 3CKKA 4YTEA 2OTCA 3PC8A 2SICE 4YRQA 1NY5A 1RYBA 1WEKA 1A04A 4OSOA 3ZU2A 4C9BA 5DW3A 1LW6E 3VYTB 2Z5LA 2JLBA 2V5AA 1EXVA 3TVTA 1XWIA 4BEWA 1G6OA 1FK8A 2I66A 1ZGHA 2GN4A 1HLGA 2C8JA 3EIOA 1CRQA 4R9VA 3BKWA 3ESCA 3OIDA 1OLSB 2QTFA 4TV9B 3DNFA 4REOA 1PN3A 3TTWA 4P4LA 4QC2A 1NW9B 1DG3A 2HMAA 4R81A 4LF8B 1G20A 3PPWA 1N2ZA 5LLSA 3SF8B 4G09A 1WY7A 3N2YA 1U3UA 1EA7A 1VHTA 3OPNA 2WKQA 1YACA 2G04A 1GQ2A 2IY9A 4J2TA 3EG9B 3KOZA 2O3QA 2Z1MA 2HF9A 3PDCA 4O1HA 1Z0DA 1G5TA 1EUCB 3P4YA 2M6LA 4EPWA 1FRZA 3IR7A 2BM9A 2ZSJA 2E4VA 2EWVA 1BKYA 4J6FA 1XHFA 3ZZUA 3KYCA 1AMOA 1Z5NA 4KQIA 3G2IA 1WEHA 4D99A 2O19A 2B37A 2VKQA 5EGNA 1W0KD 2K87A 3L4JA 1JKMA 1E61A 2FFAA 2OCBA 3P9IA 5CB6A 3Q7EA 2PLWA 3T61A 5F9FA 2DCMA 4X44A 1Z5GA 3P4UA 4LYEA 1Q83A 4Q9DA 1E1CA 4EYEA 2H4ZA 1GYQA 1D3AA 2P4EA 2BVNA 2V8OA 3QFFA 4AQYB 3BXFA 3U7HB 4XDZA 3KEOA 1YS7A 2PT7A 1PSDA 2BHRA 5KDOA 2ZI6A 3QKRB 4ROSA 5LC1A 1G8YA 2NTVA 1T3GA 4IMPA 5JS6A 2CL0X 3CW9A 2WYUA 3I2FA 3D8SA 1JHOA 1EDOA 2ZJ2A 1QFJA 3ZWMA 4CCYA 2FSGA 2OUIA 4Y2SA 5EJ9A 3O8RA 1OB2A 2PJZA 5B1SA 4HQFA 4LOHA 3DGEC 1FTYA 2Z5GA 4OQXA 1Y5RA 2B30A 1M2HA 3Q85A 3GQVA 3IDOA 1PHPA 4UQPA 4KL8S 2XUOA 1HFEL 4H0FA 2G0TA 3L77A 2ENWA 2FZCA 1JS1X 4HDMA 1CUHA 4WOBA 2DY1A 5GONB 3DMHA 4N6OA 1H6AA 5IM5A 2TMKA 4ZN6A 1XYYA 3GAZA 2H3HA 2KBEA 2ORIA 3B2EA 1A82A 3M49A 2OA0A 3ZGLA 1MP0A 4C3OB 4MR7A 1U2RA 4XM2A 5AW1A 1WXEA 3CNEA 2R00C 3OQVA 2WSBA 4Q3NA 1Y6JA 3H2JA 4CM4B 1FJGB 3FHJA 1L8XA 2X9LA 4NZPA 3II6X 3CY6A 3OO1A 4Q4HA 1GLGA 2VK8A 1HZZC 4Y2GA 1K7SN 1Y1QA 3TX6A 3FJOA 3ILHA 2VYCA 2A9VA 2C0CA 1H65A 1QSGA 1WOMA 1XZIA 3CWZA 3MD0A 4QJ5A 2LD4A 2PO5A 2G09A 1XNRB 3WC4A 1HR0B 2AI2A 2BY4A 2WIAA 1G42A 3K8OE 2OSVA 3HP1A 2VP6A 1LSUA 1IXRC 3OEYA 5B6IA 2O2GA 2CYBA 1R0KA 2VH1A 3OEEA 3VZDA 4J0QA 2P0AA 2QE7D 4JLAA 3OO0A 2ZIUB 2I65A 1R4NB 2QEQA 4HH3C 4MP8A 3F46A 4U2DA 1ZCFA 1JDUA 3OX3A 3NMUF 2J87A 1M6VB 3M5PA 4D9FA 4AJ9A 5A3JA 5LVAA 4MQBA 5IEJA 5KTRA 1YBAA 4L0DA 1B7GO 5K2OA 5EMNA 3HB0A 3K6SA 4K9KA 2ERYA 3LWZA 4N9WA 5HMMA 3PSAA 3KUUA 3EXIA 1DKNA 3M5CA 4PC7A 3VMMA 4DR5B 4X8MA 2NU6B 1L3CA 4NOLA 4R1OA 3HSKA 5L3QA 2H1LA 3EPRA 3D2AA 3T4EA 3AL2A 3ROZA 2GD6A 2V4UA 1DQNA 1RBMA 4INPA 4KQGA 4NMHA 1CDEA 1IBLB 4ALIA 2QTGA 3ZDDA 5K20A 2WUDA 1ETUA 3PNPA 3FMFA 2LZ0A 4C05A 4EMBA 2OQRA 1I2CA 3E5RA 4AYXA 4I8DA 1LV8A 1GPMA 4IWYA 3LP6A 3C6QA 2W9XA 3HB9A 1LUAA 4X6LA 3UUGA 1RYFA 5KBYA 1E2EA 5HXAA 2OYRA 4UFNA 3DW3X 3RU2A 1REQB 1ZJWA 4R1UA 3TECE 5A04A 3JWGA 1ZGCA 5C5DA 4W9RA 1RLTA 2QAGC 2BMWA 3L49A 4JVMA 4OXNA 4BLWA 4CLOB 3T3EA 3EGWA 3VTZA 1X70A 2CVPA 2EFEB 4MLZA 3TSZA 2QPTA 3PGKA 3IRUA 3QW2A 3AR8A 4EITA 1RXCA 1WU8A 1Y3FE 4EL0A 2BMJA 3WGMA 5KJ6A 2AMVA 3EXHB 4O1IA 4LFAB 1NF9A 3W4KA 3D3WB 1P7PA 2DP4E 4CLRA 2AL7A 2JBAB 2QR5A 5KNBH 3ED5A 1XZBA 1SA0A 3K1YA 3O9VA 4LZLA 5M2QA 1PGOA 1SG6A 1TEHA 1PR3A 2WTAA 1XZJA 5EVCA 3I5AA 1GWNA 2GQ0A 4A8HA 3D8TA 4IY1A 2F43A 4ND7A 1EGVB 3WQQA 3TLKA 3NONA 4Q7JB 4RPHA 1VHQA 2X19A 4KAXA 4Z9BA 4A91A 2R11A 5IKEA 1XZFA 4QGFA 3PDUA 3N59A 1X7ZB 1TTHA 1WZNA 2XUDA 2EWWA 3DTTA 2WFZA 4OBBA 1E1MA 3TFOA 4W5QA 4KSBA 4U00A 1IY8A 3DDZX 4HGPA 4DQ0A 4MUNA 2GGSA 1BFKA 2D54A 2HX1A 4MS4A 3LQ4A 5E0KB 3DP9A 2Q1YA 3OP4A 1A9XA 2I6FA 4RU1A 5IABA 1HC7A 3IUQA 2V58A 3EASA 4C21A 2ZIZA 2XUAA 3GZJA 5DBOA 5HJEA 4FB4A 5ADUS 2SECE 1C7ZA 1VZ3A 2AFIA 2IZ7A 1T9AA 3MS7A 3MRVA 3I1FA 4EY3A 1BH6A 2QE7A 3DL7A 2AFRA 2R84A 2ZZNA 1DKMA 4WBXC 1OI2A 5IFKA 3H9JA 3O3CA 3CE6A 4MCIA 3GVPA 3WYFA 5TE9A 4B71A 2WSSA 1BMQA 3QLUA 1H94A 1OX4A 4F4UA 3IIEA 1M8JA 5JROA 3FCOA 2PQMA 4MI1A 1GG9A 1T25A 4EHNA 4QT4A 4LYAA 5C8XA 3L0YA 1LFAA 1QORA 2OORA 4YHBA 3CJRA 1W8IA 2ZJ0A 5LUBA 5FBVB 1O1YA 2J30A 1V1JA 5F51A 2PJDA 3UA4A 3UBMA 3PHBE 2VQSA 1UDXA 1P6UA 5E1DA 3G9QA 3N2GB 2Q3BA 2R1TB 3CV3A 5BV2P 4D6PA 2G5TA 1Y82A 2IY8A 3A8TA 1L7XA 4IVPA 2QSYA 3JXEA 5ECWA 4EJFA 4YMVA 3B8HA 2NYVA 4UNQA 3AP1A 1UP7A 5H70A 1R6DA 4JP1A 2IODA 3GQBB 3NYWA 3VPCA 4BCDA 4CTOA 4Z9YA 4CM8A 1JLMA 3RSGA 3S27A 4LVNA 5KSYA 4LZPA 1N78A 3LK7A 2Q7XA 3OPQA 3P7MA 5C46F 4ARCA 2HHHB 1JEQB 1GPJA 2FFQA 2I3GA 4K9MA 1I0IA 2H85A 4MRVA 4H3HB 5B1EA 2DB3A 1NL3A 2IYQA 3U60B 1GZSA 5T7BA 1NVKA 5H83A 3DOJA 1EFVA 1VLLA 1KDOA 3PU6A 4DLLA 3V7FA 4RULA 1AN0A 2ZPTX 4QODA 4UDXX 1QX4A 2JLCA 3CA8A 3QKTA 4Q47A 3ESZA 4LC1A 3AR4A 5BN5B 4KDRA 4BPBA 4PXYA 3QUAA 1KY3A 1UAGA 1ZYUA 1EAYA 3KU1A 3M4XA 1N9KA 2OFXA 3L79A 2PJRA 2I2DA 1Q7TA 2HDWA 4MWCA 1VP9A 1VIVA 2JH8A 2PUWA 5DGIA 1G38A 2V7WA 3D6FA 1E32A 3FNFA 5M7EA 1A4XA 3GCXA 5FLYA 4YCCA 4DJJA 4IBOA 2DJ5A 2O8DB 3WSTA 2NNWB 3QEJA 2I55A 3O21A 2QRNA 1TQ8A 3GFFA 2BFBB 3F6EX 4K9PA 5D7NA 5IJAA 4NG5A 1NLFA 1YFZA 1QGUA 1C8BA 4JKYA 1PQWA 3C6KA 4B46A 4MUHA 2CD9A 3SC2A 1NNI1 1RRCA 1E0SA 2R86A 3CT4A 1CIPA 4IWXA 2SCUA 3KWMA 2HBZA 3LMKA 1EPUA 2D1QA 2OCAA 3CH7A 4I3HA 5LJLA 1RRVA 1Z68A 3IT3A 3UQYS 5TPWB 2G40A 3M4NA 3K6JA 3F4LA 3M6MD 1RHMA 2B9VA 4UU0A 3ROTA 1K2VN 1EFPB 1T4MA 1DXQA 3CTPA 2VHXA 1XA4A 1KFJB 1G16A 5T57A 3EFHA 2AOWA 1ZRMA 3UK2A 1K2WA 1LC3A 4RKEA 4NMWA 4YUVA 3KQLA 3T0IA 4FP9A 3FNBA 2ZVQX 5EJGA 1JHXA 4BNZA 2BTEA 2W00A 3BHNA 7MHTA 1FXWA 2CHGA 4A73A 3GGDA 4L7VA 1SO8A 1U80A 1M72A 4P8RA 4XW2A 1FW8A 3EWIA 1AMUA 4GYYA 1M0TA 1Q3TA 2Q3CA 4IUYA 1GHTA 4NXNB 2C2XA 1CUUA 1TYCA 4NCKA 1QE0A 4RVDA 2G9NA 5BW4A 2JGJA 1YB6A 1KSHA 2R47A 3B3JA 3P45A 4I6JA 1Y8QA 3H2IA 4LXGA 3U0BA 4K7JA 4EB0A 5FRDA 2ISCA 2Q4DA 3T9EA 1BCRB 4XYEA 1I2AA 2PX0A 3HBAA 4MVCA 4RCYA 3S55A 3UTCA 4G4IA 1OB5A 4ZYYA 4IQFA 3WLFA 3NVKI 4K8OA 1FMTA 4TVBA 1DIGA 2XLCA 1QYVA 3EC7A 1GGKA 2FWBA 2HQSA 2WUFA 4MW4A 1N2CB 2WQ6A 4RHYA 3BB3A 3CW2A 2O2HA 2RGXA 4RIIA 1J8DA 2FQXA 4I3FA 4OMDA 3SSOA 4DRZA 3CEHA 3KOOA 1EJ2A 4Q4AA 2JVKA 2MTBA 1XKTA 2HL6A 3OWXA 3WGGA 5FEUA 2QN6A 4I55B 4CTNA 4EEKA 2B36A 1NM5C 2GNPA 2IY7A 1NYRA 2TMDA 4I66A 4MR9A 2HHAA 3OPXA 3OPYI 5KJFA 4KVZA 1Q1NA 4DR3B 3RC8A 4LDNA 3O8QA 2OVBA 4Q1CA 5GM1A 3KELA 3PLNA 3K0CA 4ZV4A 5DKFA 1VCMA 2C29D 4P83A 4RJIA 1XRPA 3GG9A 1THZA 4KN9S 4ERNA 1JMVA 2F1RA 2OV1A 3GLFB 1XGKA 2PSJA 4L9WA 4LIPD 4C22A 3T3OA 3Q3EA 2HSZA 1MB9A 3NT5A 3EJWA 2HBRA 1QS0B 2HDHA 5IARA 3S28A 1RXYA 2A78A 3SFVA 1XALA 2EWMA 1L0BA 5AKXA 5TQVA 2PK3A 1T0JB 1D0VA 4MEAA 4BO7A 4JGIA 1KPIA 2GBPA 4CLDA 1L7AA 1YZVA 3K8ZA 1DI0A 3ND9A 4ATNA 4V03A 4DQDA 1SU6A 1NNUA 1MA0A 3QELA 1CY8A 2PWAA 5F64A 5AESA 4OI0A 4ZGGA 1DWUA 3KB6A 5JS1A 1EFUA 1DGQA 3IP7A 3THYB 3TSCA 2GKOA 3DB1A 4DLXA 1WMBA 2WJZB 2GEUA 3K2IA 4RX1A 5CK5A 3NG1A 1NNEA 4AMGA 2XXBA 2QD4A 4OPMA 4W1SA 5JE8A 1JG4A 3GFBA 5L51A 4J7CA 4PF1A 4D3FA 1AHHA 3DW1X 4IIDA 4M99A 1WQ4A 1W4RA 2KQUA 2WQZA 3DAPA 1HK7A 1NVFA 4PC3A 1X15A 4Y2RA 2V3CC 3TR5A 2O8FA 1IB6A 3LGAA 4N3CA 1SKQA 1KAGA 4KPUA 5ELMA 2WDPA 1I5RA 1TYAE 1W9MA 1OC4A 4CKWA 4F93B 5JRDS 1MPXA 2VHVA 3WSWA 1G8GA 1ORWA 3FE2A 1ICEA 2OZPA 5JSKA 2ZJ6A 3SVTA 1RZRA 3DLCA 3PEVA 1N92A 1AGXA 3RR2A 1CR6A 4DMRA 3WYCA 4F4FA 1Y8ZA 4KNYA 1O7JA 1JAHA 4MWDA 2QRPA 3CUSA 4QICA 1O94C 3B7PA 4Y18A 1QOQB 5LBUA 1AS3A 4G1VA 3U7EB 5MDHA 4BWYA 2BF4A 4GI5A 1VI5A 3MRXA 1S2IA 1YL6A 2V7QA 3NPMA 3FYSA 4G1BA 4QXQA 1ZM2A 2FTKE 5FL7D 1JZQA 1B2LA 4KN5A 1EUDB 3K71B 2OGWA 1VXOA 4QUGA 5F76A 1E58A 3DNPA 3IUSA 2RD2A 4ZJUA 1OHHA 2Q6TA 4OYYA 5CFPA 4E2YA 4DMKA 2IK8A 2BRUA