1E6OH

Crystal structure of fab13b5 against hiv-1 capsid protein p24
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
219
structure length
219
Chain Sequence
EVQLQQSGAELARPGASVKMSCKASGYTFTSYTMHWVKQRPGQGLEWIGYINPSSGYSNYNQKFKDKATLTADKSSSTAYMQLSSLTSEDSAVYYCSRPVVRLGYNFDYWGQGSTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutual Conformational Adaptations in Antigen and Antibody Upon Complex Formation between an Fab and HIV-1 Capsid Protein P24
pubmed doi rcsb
molecule tags Immunoglobulin
molecule keywords IMMUNOGLOBULIN HEAVY CHAIN
total genus 45
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2000-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1e6oH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1e6oH02
2V2WA 2HJLB 1GVIA 1MCFA 5IP4A 4PJIE 3EGSA 5HHNA 1XF2B 1AC6A 4NFBA 1EHNA 5DS8B 3BZEB 3QDGD 2V5RA 3F62A 2GK2A 2JCCF 1CLYH 2C7UB 3EOTL 2NLJB 1WQVT 4OB5L 4KRMB 4U2ZA 5EC2B 2HTLD 3KPSA 3X12B 2C26A 2YUXA 1INEL 2NY3D 4PTUB 4I0PC 4XGZA 1UEMA 3L3IA 3UC0L 3QDAA 3WS6A 2FEDD 2X89D 5AD0B 3BI9X 3T0VA 3P9LB 5HYSA 5DQDH 5H37G 3N1PC 1AHWB 2C9AA 2MSPA 1AFVH 4IOSD 1QRNB 4KKAC 4YFEA 1YY8B 3B9KA 3QUZA 1ETZA 1OF2A 3HA0A 1PG7W 3UTSE 3LDBB 2VUOA 5ICXB 5C0BA 1DLHB 3MOBH 4OD2B 1OP5H 2FX9H 4JFOA 1FDLL 4IHOB 2X4UB 1PY4A 1FO0B 2ADFL 4NP4H 1PVHA 4BELD 2QADB 4Z5RB 4FZEL 3WHXA 1VEMA 4TSAL 4YFLF 3QIWD 3WO4B 3PV6B 3EAKA 5EIQA 1YEEL 1VENA 2WQ8A 3QZWA 3L3HB 1GIGL 3MCLL 5DEGB 5AWNL 2XI9A 1C5DA 4FFVC 3T3ME 2IWGA 4Z7OE 1JNLL 2VLRE 4GS7C 4LCWA 4JAMA 5JPNB 3RWDB 4Z77A 3QISA 3QDMA 1E27B 4S11A 4GW5B 4LAQH 2BRQA 4F7EB 1YEFH 3O2VH 3CXDH 2IAMA 4M7LT 3S34L 4QRRB 3HZVA 1GGYA 4I8DA 4ELMF 5LXGL 3NACL 4C56E 1TVHB 1ONQA 3K8LA 4QGYA 5HYQA 4M6OH 3S88H 1AIFA 3MJ6A 2J5LC 1MJJB 4KXZH 5I8OH 4PIRF 3PWJB 3O8XC 5GISL 5IFJA 1I1FB 1DQQB 4LK4A 1CE6B 3LPGA 3T4AB 3NPSB 3ZYZA 1D5IH 3VWJD 3Q3GB 3SEPA 4FQXD 3ZE1F 2X9XA 1YNLH 2F53B 1FRGL 1KFAL 4WTWA 2PXYB 1NGXB 3QDJE 3LKOA 2DM2A 4JPVL 3VA6A 3QDMD 1AE6L 1Q1JL 4NC2B 1O0VA 4KJQC 3RWJA 5I19L 2D03L 2A74B 4XHJD 4WW1A 4L8BA 4WWKA 1SJHA 1UH4A 1BEYH 3U4BH 4EI5A 4ZAKC 1BIIB 4XPAH 5F9OH 3NMEA 5BV7L 3AAZB 4DGYL 1YEHL 4OIAA 4EN3D 2OJZH 3BUYA 3L5XL 5DO2D 3FT3B 3OAUH 3ESVF 1LO3H 4HJGA 5J12C 1QBLH 3T0EA 1W72A 3FB7B 2AERT 1HXYB 3CFCL 2D7PA 4NKDB 3TNMB 3U4AA 1QSEE 1IT9H 1R3IL 4FQHB 4Y5XA 1A1NB 5K9JL 1H8SA 3B9EA 4G7YL 3NBNA 1CDIA 3KHOA 2HVKA 5IR1A 3PWPA 4PJIB 1JRHI 3O2WH 3MC0A 1EO8H 2HRPH 1U92B 3L7EA 2EE3A 1A6WH 4JFYA 1E4XH 1NGQL 2A6JB 3A67H 4R4FH 1MCEA 4X7FC 5FUOH 3B5HA 4NZUL 4FN0A 2E9WA 4HDIA 2NX5E 3BWAB 2ARWA 3CFDA 1H15A 3BDYL 4HX1A 3N9GH 5TGBB 3VGFA 1JIBA 1FIGH 4D2NA 4JKPL 4HPYL 3T2NL 4PRID 3F7PC 5KG9B 1J87A 1Y6MR 4OLUL 4J1UA 4P4KC 2LE9A 3HI1B 3DXAB 4H1LH 5EUOA 2VRAA 5DDHA 4WCYL 1YEIL 4JFFA 4ZYKA 4L5FH 4FHBD 5F96L 3B3IB 3QI9B 3WJJA 4KQ4H 3U2SA 4CVUA 4R97B 5D6CB 2CRZA 3I75B 4Y4KB 4TTDD 4Z7WF 3FN9A 1CZ8H 4DKEL 5TDOA 3TVMC 3EJJX 5I2IB 5TE4H 4N1EA 4OFYA 2MNUA 1N3NB 1Q0XL 4F9LC 1QHPA 1HKFA 3TBVB 1WIUA 1HHKA 2B1AH 4EN3C 5GRWA 3NCJL 3BP7A 3GI9H 3DETC 1II4E 3F6IA 2BVOA 3JZ7A 4XNZB 1XF3A 1OAZL 2EYTA 3DX9A 2F19H 5F96H 4OI8A 5D2LB 3C6SA 5AZEL 2GIYA 5FA3A 3MRMB 4MDIB 1S9VA 3U0TB 3KYKH 1A4JA 4KU1A 1W8NA 3RWHB 4UDTA 1V3LA 1I1YB 3UBXA 3QQ4A 4FNLH 1QLFA 4JKPH 4BYHA 4FQXA 2ED9A 3U6RA 1J7VR 1DL7L 4P23C 3VXSB 4NO3A 1U3HB 5C0CE 1J1PH 3CJJA 4YXLL 5MHSD 1Q9LB 1F4XL 2BSTA 2ITCA 4CL7A 2WLZA 1A9EA 4HGWB 4U1MB 4MHHG 4MAUL 4EKXA 4JLRA 1HH9A 3LV3A 1FJ1A 3ILPA 5EU4B 1K8DA 1FVDB 1EO8L 2R0WH 5GHWH 3SPVA 4E41D 4M5YL 5KJRH 2BNQE 4JM4H 1TJIH 2WUBH 3QHTC 5A2KH 5C3LD 3IXTB 3VH8A 3LKSB 3TO4C 1NC4B 5D1XD 1NFIA 4LEOA 1WZ1H 3QCUH 5CKGA 4LPWA 4YDKL 3U46B 1FL6A 2D4DA 2VL5B 5D7KE 2LV4A 2VDPL 2EDWA 5KSBF 1ZEAL 4L9LA 2OJZL 4H25A 2OTUA 4P5KB 1IAII 5DF0A 3G5XB 3MFFA 5GGUB 1YEHH 4PBVC 4U1IA 3IU3B 5EUOF 3TJHC 2GQHA 4U4BA 4PB0H 8FABB 1BEYL 2QSVA 4QWWD 4DVRL 2XV6B 4PTTA 2ZPKL 4ISVB 2NNAA 2D03H 1H3PL 2CSPA 1TZHA 1ZGLA 2UWEF 3PUCA 4OGAD 2VLLB 4WGWB 3UZVB 2V17L 4YZFE 3AREB 1DANT 5E70A 2WINA 1FV1A 1FPTH 2G75B 3EZ8A 3VXOA 5H8DA 1D5IL 4NJ9H 2YXFA 5JO5A 2RAMA 5F9WB 1A7OH 5KSBE 3RZCA 1KTLA 3PE9A 4PJHA 4YDIL 4K9EL 1D6EB 2Z91B 1L0XA 2F5AH 2R1XB 1YDPA 3CZFA 2Q86B 4XNXL 1MNUH 3P2TA 3WFBL 1CF8L 4MD0B 3RKDD 1HHGA 4TUKL 3D3VE 3NCYS 1OAYL 4M8VA 5TE7H 3TLRA 2GHWB 5IV2A 4Q9RH 4JDTH 4Z0BH 3C2AL 4EQ3A 4HJ0D 2IAMB 5IESL 1NGWB 5EU3B 5I18H 1XR9B 1T5WB 5MENB 1KPUA 4YZFF 3X17A 1I7TA 2Y7QA 1F2XK 1QACA 2V7NA 3KPLA 4F9PA 4LKXB 4FZ8L 5EPMA 3MCKB 2BJML 3QO1B 1UADC 4PJGE 5I1HL 1MRDH 5D8JH 2EXWD 4UNUA 1M4KA 1EFXB 2DQIH 3MGAA 2NY1C 2XKUA 3NGBB 5I1IL 1RV6X 2JB6B 3NZHH 5D2NE 2FX9L 3GKWH 3VRIA 1S9YA 5FKPA 1AR2A 1MJ8H 3EHBD 2X4NB 4KTYA 1FVCB 4HPOH 3EYFA 5IMLA 4KVNL 4S2SA 3DX6A 1N0XH 4ODXA 3SDXA 5EOCL 1KCRH 3RWIA 1SJVA 4H8WH 1M71A 4F37K 1B0RB 3F7VA 1QVOA 1F8TL 2OZ4H 1J5OH 1P4LB 2Q7NA 5DQDL 3WFCH 4N9OB 4YDVA 3U79A 5D7LB 2A73B 3G5ZA 4ODTL 1F00I 4YHPA 4Z78A 5TE6H 4PJGF 2BVPA 3OKEB 5K59E 1UZ8A 2KH2B 1ZA6B 2QTEA 3RDTB 1EIBA 3ULVH 1I1AC 4KGLA 4RGOH 1N5YH 4OCXL 2DJUA 3TBSA 1KN2L 1LEIB 5LAXB 3TNMA 3CU1A 4HXBH 5IM7B 3WLWC 1JWMB 1IKNC 1SYVB 2XNAA 3OJ2C 3N1FC 4P2OC 3STLA 3LKRA 4LVNC 1XIWA 2ZKHL 1TTUA 2IGFL 3FTGB 4MHHI 4NOFA 1ZLUK 3QUYD 5HHOD 4PJIA 4HK3N 1L7IL 3LAFA 5HD8D 1XF4B 1NEZG 4PJAF 5J6GA 1MHHA 3WNNA 4HULB 4M8QB 2W9EH 4R4NC 4YLQT 1JRHL 3MLSH 2YC1B 5FHAL 3FN0H 3KWWA 5DZLA 2Y1VA 1R5WA 3I02A 3MACL 4ZXBB 1SJEB 3N1QC 4XHJC 3SJVB 3EBAA 4NKMA 4O4YH 1RJLA 2IADB 3OL2A 3RBSA 4U1NA 1ZTXL 3TNNA 1FYTB 3VFPA 1A7RH 1RIUH 1BFTA 1H8NA 5TFSH 3EYVA 3VFMA 5EO0B 1UM6H 4BQ9A 3VFUB 5KS9A 3QNYB 4HKZA 4KQ3L 5C6PB 3VFWA 4PJ9D 4MJIA 4HQQH 3PHOA 4HFUL 2OX5A 1LO5B 1UM5L 1LDPH 4HS6A 3C6LA 1JWSA 5D6CA 4A6YA 5DZNA 2J4WL 1Y18A 4XMKH 1G7QB 3KLAB 2JCCA 4HXBL 1CFBA 1AXSB 5ERWB 5HDQL 4JFEA 4IRSC 4OCXH 3ULVL 3KPNA 4QEGA 4H88L 2Y4SA 3GSOA 3BXNB 4HKBB 3SDAB 3VDBA 5FV2A 3FFCE 4G8FA 3DUSA 4CVZA 1AHWC 3H42H 5BS0B 5D5MF 2VR4A 1Q9KA 3TJEH 1MCOL 5GS0C 5FOBA 3BIKB 5DFWH 3HUJE 1JV5A 4GRWB 4XRCA 2FB4L 1IGIH 2B4CC 1RJYB 2AI0L 5L2KB 1MJ8L 5J89A 2HTLC 3I2CH 1AO7B 5I1IH 1IAIH 2A0LC 2DQIL 5D7SH 1DLFH 1ZWIA 4BFIA 1JYXA 2BJMH 5FGCE 4PV9A 3WFEL 1ED3A 1CD0A 1CD1A 3OKNA 4HUWA 5IFAH 2YXMA 4WFGE 4AENB 1P7KA 1E6OL 5MEND 4L4TD 1T22A 3ARBB 2FHBA 1FFOA 2X4PB 3IF1B 4OM0L 1FHGA 3BE1H 3I85A 5CHNB 4Z0BL 1L6ZA 4HIIA 1VHPA 3N1MC 4IIQA 5GSRA 3TBYA 2EXYD 3ZLQC 5J1AA 5ELIA 3DV4A 3UROR 1YN7A 5I9QC 4BFEA 5GGTA 1U8OB 5CD5D 3QNXB 1KEGL 1NMAL 3ZTNH 3C09B 5D96B 5I71B 4L29B 3V5KB 4ZSOA 2BX5A 2VSDA 1LEKA 5FECA 1WWCA 1V05A 4Y4FB 3GSNA 1RZIA 3Q6FB 3GIZL 4QRTB 3GSVA 2K1MA 2YOCA 1DZBA 4Z95H 1CE1L 4FS0A 2Q8AL 5EIIB 3D0LB 4NFCA 3KYNA 1DLFL 2IJ0C 2FO4A 4XP1H 5DMJB 1IAIL 4NT6A 3F58H 3ZHKA 3K2MC 5E8PB 4WO4C 5C08D 1G6RL 1UM4H 1KTDB 1PX4A 2JTDA 1PKQB 2FATL 2EC9T 3AVEA 1JNHB 3VRLF 1ZHBA 4AMKL 4RFNB 5DHXB 4XVUD 2EIZB 5D7JA 5IVXB 3TJEL 3OPZL 2B0SL 4QHUB 5F6IC 4WI9A 4HV8A 5BRZD 3ULUH 1J05B 2QQNH 4BH8A 4LVHC 1TIUA 3PP3K 2Y7QB 5EU5B 4RGNB 5J1TC 4K94H 5E4IA 1GCFA 4NQEE 4IS6B 3HRPA 4M5YH 3SJVD 2H26B 4Z7UA 1ZV5A 1UKTA 4QNPF 4WIQA 4ZAKD 1N4XH 3G04A 3UYPA 3D5OF 3MJ9A 4TPRH 4HFWA 1YECL 5KSBB 4Z7QF 2UY6A 1WZLA 4JHBA 3FOLB 2GY5A 2NMSA 3VRLE 3PJSB 1HKLL 3EGSB 1XF2A 3DX6B 1LDPL 5I66A 1TQBC 4ORZC 3V52H 4I0KA 4FNLL 5DD1H 4POUB 5E9DE 5DURB 5GGTH 4XAWH 3QJFA 3BKMH 1WC7B 1S7WA 1UM6L 3V2AR 4OAWB 3WUZA 5EO9B 3UTPE 4XX1G 2AEWA 5CINL 4PLOB 3E2HC 4ZAKA 1N6QL 2ITCB 1T6WA 1B0WA 2GKIA 4XBEH 3VXPA 3PDOA 1AGFA 3WXVH 1ZTXH 2Y25A 4PTUA 5L7XH 5F7MC 1AKJB 3SE9L 3RZCD 5SWSE 3ZSTA 2J8HA 1ZT4B 2L0DA 2NXZC 3D39A 1RVFH 1T6VN 4XPFL 5FYLH 5TE4L 3U83A 1PQZB 1NSNL 3PWVA 3U1SH 4CDHA 3T0DA 4Y16D 4OLXH 3MJ8A 1SEQL 2IC2A 3NH7L 4FQIH 1XGRA 3UTTA 4KQ4L 3QUYA 4LLMA 1DBAL 2DYPD 3S6CA 4U3CA 2IGFH 5C0BB 4B5EA 4R0LB 1BGXL 1AQDA 1FNSH 1WCBB 3MJ9L 1ODAA 3GJFB 4JB9H 1YMMA 3LN4A 4ZUVA 5TF1L 3S37H 4HIXH 2QKIA 3LD8C 4FQ1L 2GTZB 3MLYH 2O61A 1N5YL 2IANE 4Z7VF 4EOWL 1MFBL 4ZTPL 2NZ9D 2VDKL 1FYTA 2F8XC 3BQUC 5KVDH 1MRCH 5DEFA 3ULVE 1CDUA 5E56A 5JXAL 3UPRA 3MV8D 2BNQB 5E5MA 1MH5B 4U1KB 4XVSH 3WFCL 1RUQL 2YK1H 4UV7L 1FO0L 3B83A 3EHBC 4MJ6A 2NY7H 4UNTA 1RD6A 5JNYB 1JWSB 1SEBA 4KVNH 4XPGH 5EOQH 3QCTH 4F7CA 3RZCC 3TPKA 2FEEL 4L8CA 5CWSB 3FB8B 4JR9L 3PWJA 1G7QA 2I9TB 1NL0L 1MCNA 2FDBP 3GFUA 2XWJA 5ILTL 1CYGA 3A6BH 4ENEC 2UUDK 2BDNH 1ORSB 2XPGB 3L3KB 3OAUL 5EFIB 4IOIB 1TQCB 1DBBH 1U0QA 4FZ8H 3ZYIA 3GM0A 1PFCA 4X99B 1KPUB 5J7CC 4CVZB 2VLJE 5JW4N 3KPLB 3QXAB 5IESH 3U4BL 1XGPA 2PO6D 4PJCA 5F9DC 3IFOA 2UYLA 2MWCA 4Q9RL 5FOBB 3S35X 3NIFE 2VXQL 4HS8L 2VLME 2VLKA 1DVFA 5I17A 4RGNE 3VWJC 1AE6H 1JZ6A 3BAEH 2HVJB 3NCCB 3VFSB 3I6LD 4X4XB 4UNVA 4CDGC 4TVPD 2RQ8A 4AK1A 1NCBH 3MV7D 4PFEA 3BPOC 1F58H 3ULVD 5C09B 5DMGC 3SCMB 4N0YL 2FL5A 3QUXC 4XCYB 3QBTB 4EXKA 4FXKA 4F8TA 2OSLA 1T20A 1P69B 3TT3L 3BAEL 3X3FH 4PREA 3PXJA 3NACH 4I18B 4TUOB 5LXGH 3JV4A 4YHZH 4G80B 4X5XB 3TIEB 3BGMA 1UYWH 1XGQA 4NO2A 5FKAA 3Q0HA 2HA1A 5ETUA 4H5SB 1U93B 5DQJB 5SX4I 1ZA6A 1IKNA 4E41B 5HVHC 4GSDH 1IQDB 1T83A 1YEDA 4LGRB 4FABH 3WN5C 4R96A 3MCLH 3GJFK 2VDLL 3ARDD 4LPVA 1YEEH 2ILLA 3LKRB 3MJ7A 2DIAA 3GDBA 4AM0A 3KNBA 1VACA 3D25A 5ILTH 3G6AA 1FDLH 3KPRA 4MX7B 3BESR 3VXRA 2HTKC 3Q6FA 4NC0B 3TO4B 1MI5D 4X6DE 3V5DB 3IYLW 3VXRE 3VXNA 4JO2H 5DFVD 5C0EA 1D5MA 5KJRL 4XPGL 1JCKA 4U1HB 4HLZG 3GMNB 3I75A 5DC9B 2NY7L 2CGRL 4KXZI 4PJEF 4D0BA 2YK1L 2ADIB 2EE9A 3MLWH 4OSUL 3WNMA 2P5EA 2ZUYA 3IJYA 3RBGA 3UC0H 3U9PH 2XTJD 1KJVB 1RZGB 2WQRA 3E8UL 4LCWD 4JO1H 4M3JA 4MJIB 4UU9B 3ZZ1A 4GW4A 4ZDHB 3QRFM 3IDYB 2V9QA 3HZVB 2DQTL 3BEWB 4PRBB 4YWGH 4FQ1H 2D0GA 3MRMA 4HIXL 3OR6B 4M6MH 5TF1H 3RTQA 3MJ9H 3FQRA 4XVTL 4Y5XB 1M05A 4FFZH 4W70A 1HINH 1EAPB 1DE4B 3RVWC 4NNYA 3DGGA 4M7JH 4WI3A 4NSKB 4PGEA 3X13A 4LSUH 1LP9B 1OSZB 5TH2A 3JV6A 3QCVL 3UX9B 4DGVL 1JN6B 5FB8B 4RAVA 4JPWH 3LY6A 1U36A 2XICA 3ARDC 4HHAA 3EYOA 1WGOA 1XGUB 2OL3H 4HX1B 1DBKL 1Q9KB 1K8DB 3MRQA 1B9ZA 2QQQA 1DJSA 2HFGL 4D0CB 3O81A 1MOEA 4I0PA 4WCYH 4BSWB 2E7CA 3ARTA 2YD6A 4J1UB 3SKMA 4WUKH 1R24B 1CFTB 5I1CH 2ESVD 4XNYH 5CJ5A 3LS5H 4KTEH 2W92A 4PRDA 5DD1L 3T2NH 3W5NA 1W72B 4JANA 5FO9A 3M17A 5GS1A 2ZUWA 1C12A 3O3DA 3HNSL 3PL6D 1BQHG 5EU6E 2R0KL 3FKUS 4S1RH 2Z8RA 1LK2B 4L4VA 5I2IA 1YECH 4DCQA 4G7VH 4R4FL 4AT6B 1N26A 3A67L 2VO5A 1R0AL 1OM3L 4ISVA 5D1XC 2CXKA 4Z77B 1KB5L 4HH9A 3QDMB 4DJMA 1XGRB 4I9WD 4WFHD 4R8WL 3UTTB 3FZUD 4LSSH 3NTCH 3ULUD 3GSUA 5B39G 2G9HA 2F9BT 3OTTA 4DZ8B 1D6VH 2EIDA 1WZMA 3ABZA 4U1SB 5FUCE 3TWCL 4O02L 1U8OA 4CU6A 1RZFH 3QDJD 5CIPB 1MJ7H 4V1DE 4GRLB 4JZNB 2IPTL 4QHNB 3KPOA 1Q9OA 3FO0L 1P6FA 4MAYD 5JZ7C 1YMHB 5C09D 5FECB 5FFLA 3ULUC 2OMBA 1BQHA 2C5DC 3S3JA 3KPPA 5BV7H 3ZTJH 3FFDB 3UJJL 5F9OL 1Q9LA 1JZ8A 3GSVB 4PG9B 4ZS7H 3BPNB 3MUY1 2BOBA 4XP1L 4HMCA 1L7TL 5I76A 5B3JE 3KYNB 1CK0L 2NY3B 1CE1H 2Q8AH 3ARFD 1MCLA 3WSQH 1T80A 1K6QL 3HZMB 4MDJB 4PJCE 4KKBD 4KV5F 1G9ML 5CZXC 2OP4H 3GGWB 4YBQD 4LKCB 2DLHA 4PJ5B 4EI5B 3W9DB 4OBSA 4JQIL 4ZOEA 3RJQB 4WUUA 1KFAH 2DTMH 1PEZA 3B2UC 3ZTJG 1KTDA 4LDLB 4LVOB 3MRDB 4OLZL 3OAZH 5AYUL 3MRKA 1S7TB 2P24A 1OGAB 1ZGLM 2XPGA 4K2UL 4LIQH 2EDRA 3S4SA 3ZTNL 5JIPA 4MDIA 4PV8B 2ESVA 2Z4QA 2X70B 1UCBH 4WEMB 4MJIE 1NBYA 3MMEB 3TZVC 2ZUSA 3S34H 4NWTL 1J8HE 4QLRA 3SGJA 2AXHA 8FABA 3CXDL 1Q9WB 4LSVH 5F1IB 4PJCF 4F37F 2HP4A 5DGQA 3UTQA 4E5XA 1CR9L 3MREA 3RNQB 4JZJB 5AWNH 1OW0A 4MCZB 1IJ9A 3KYMA 1TVBB 3OX8B 3FT4B 3LKQA 1KNOA 4QHMB 4WW2A 1GOFA 4KRNA 3SGEI 5CJXC 5FGRA 1U8HA 1UZ8B 1RPQA 2DQFA 2R0ZH 3WLWD 5HGBB 4M4RA 4X9BA 1CL7I 5D7SL 5A3ID 3K80A 4K3DL 3UTSD 4DQOH 1CT8A 1A1MB 1VKXA 1P7QD 5I15L 3IXTA 1EEQA 4LLAA 5KOVC 3KLHC 3W11D 2Z92B 2IAMC 2R2BB 4N9GB 5DYOA 4P2RE 1T21A 1BBJA 3G08B 1W72H 1K4DB 2X4RB 4YK4B 3OHXB 3RVUD 2FD6L 1ZT1B 4O58H 3KWWB 2E6QA 3OKMA 4RFNC 1KT2A 1ZK9A 1HNFA 2NPLX 2RR3A 3NN8A 1XR9A 1ZT7A 2BVTA 4ZXBA 3SJVA 5BXFA 1RZJC 1D9KA 1RUKL 3PWVB 3PWNB 3VWKB 2MQCA 4H88H 5EZJA 3LQAL 3MCG1 1INEH 2I25N 4NBYB 5A16B 2DI9A 5K9OA 5EU6B 2ATPA 3LQZA 1QPXA 5IGXH 1A7BA 1D5BA 3V0VA 4CUCA 5EO0A 2ERJC 2VN7A 3DETD 1KG0B 4ZFGL 1YEJH 2IMMA 3KPRD 3HG1A 1T0NB 4E9LA 5IMLB 1KEMH 3MRHB 1I3GL 4RQQA 2XG4A 5TF0A 1EDQA 4A6YB 4U6HB 2BFVL 1XR8A 4HS3A 1AH1A 4ORGA 4RWYH 3ORJA 2P4AB 1EV2E 2A77L 4KMQA 4AG4L 5KSAC 1A7QL 2VZUA 5DD6A 4Y89A 5HYJE 1BREA 5EC1B 4ESKA 5HY9B 5ERWA 3VXMB 5BRZE 1N6VA 3LVEA 1HYRC 4MVBC 5F7UA 2YSSB 4BZ2L 3F65A 5JQ6L 4LP5A 3MRCA 4LVNB 4UTAL 4XGZB 4YQXL 1T7VA 3DO7B 4G6KL 1JYWA 2WWMC 2HN7B 5AUMA 1LO4L 1KBGL 2ID5A 3RTQB 3X3GL 4L3ED 4ZUTB 1GC1C 2V7HB 5FHAH 4CKVX 3MCKA 3B9KD 4Q0XH 4PJDA 3DNKA 1V5JA 2VISB 1XF4A 1RIHL 3B4NA 1MHHB 3ZL4H 2P46B 2NY0C 2A0LD 4LCIL 4OD2A 2CLRB 5I9QB 1HHHB 3EYFB 4J4PA 4OLWL 2W0LA 3QSKB 3D87B 3OGCA 1DEDA 4C54A 4MNGE 3QIWA 2PO6C 4EUPG 4HHAB 2AV1B 2WZPD 4CVXA 4POYA 5MEPA 2XTLA 3F7VB 1OB1B 1JUFB 5TE6L 4QRSB 1HEZB 3G5ZB 3T0BA 3EYVB 1C5DB 3CSYA 1FFOB 1P4IH 2D4FA 1R24A 2BY1A 2EDLA 4WEUD 3QQ3A 5CHNA 5FHBL 2QHRH 1MCDA 4HBCH 3GSWB 4LHQB 3TO2A 4H8WL 3RDTA 2Q8BL 1CDYA 4G6JH 2DBLH 5CD5C 3ARGD 1LEIA 3VWKD 5CMAA 4BM7A 5IM7A 4ZUSA 5FA4A 1AP2B 4PB9H 3BDBA 3R0NA 3GKWL 1KYOK 3MRBB 2MCG1 3MLVL 3MROA 3T0AA 1AXSA 2VXTH 4JM2D 2YMXH 2ZSVA 1MRDL 4LCYA 5C2UB 4PBXA 4X7TB 1YNTB 5C1MB 2D2OA 3H8NA 1NFDA 4F7TB 3W9EA 3T65A 1U3HD 4S10A 1UKSA 5DUBA 1JHTB 1MI5B 5CEZH 1A21A 4FQ2L 1I75A 5C7XL 4JDTL 1CFQB 3FO9B 2EDOA 1RY7B 3RY6A 3RHWK 2BNUA 1FNEB 3L3JB 4X4ZA 1QSFD 3RVXD 1MNUL 5I8KH 5LCVL 3LN5B 3G6AB 3IDNA 1IEAB 1GZPB 3O41A 3O4LA 4NGHL 4NHUA 3OXRB 3R1GL 4X7CC 1DBMH 3VFRA 4XNUH 3FN3A 3VXNB 3LMJL 5GRZA 2AJUL 5F9WC 1A7OL 4S2SB 5CJOL 4ODXB 3FO2A 1LD9B 1LO0H 2Y6SD 1DSFL 3U82B 2H32A 5IHZA 4X7EC 5JORA 1B0RA 4U1LA 3UMTA 3MUGB 2NLJA 4KJPD 2H32H 5JPMA 2YRPA 2CK0H 1LE9A 2AGJH 4PJBF 3DJ9A 3KPSB 4WO4D 1CDBA 4QXUL 4OCYL 3G04B 4IMLA 1YPZE 4A6YL 4L8DA 4ODHH 5GS0L 3LSOA 4PB0L 5IJKC 4WU5B 4ZFOB 4OBRA 3HPJB 2JB5L 5AAWA 4N0RA 4WV1C 5LAXA 3PL6A 4NQED 4GJTB 1CLZH 3CK0L 1XMWA 2X42A 4NJAH 3GB7B 5JHDE 1IC1A 2H1PH 1PG7L 1URLA 5F21B 3CFEA 5DD5H 3LPFA 4MNQA 3MO1B 4G42A 2R1WB 1GAFL 2X44D 2H8PA 4O9HL 3BP6A 3W0WB 2XZAL 4MD4B 4N0FA 2D7TL 3MREB 3MBEA 5IBLC 4PGBA 5IVOA 4FQCH 3MV9A 4O2EA 3I02B 4OLVL 2WP3O 1J88A 5H2BB 3LD8B 5DJZA 1INQB 1OCWH 2PTVA 1BQLH 3HE6C 4S1SL 3ARUA 1NDMB 5D70L 1ZT4A 2IAMD 4OM1H 4PJHE 2AABL 3D9AL 4K23H 5J1SC 3ROOB 4YXLH 4YEFA 5F7NC 4LPTA 1RHFA 1EVUA 2EYSB 1OHQA 3IJHA 1T21B 3QDHA 3DVFA 5T3ZL 5CZVL 3K2UL 5IKCA 1HSBA 5A2FA 2HAZA 3BYTA 4R26H 2EKSB 4Q7DA 1IBGL 1U58B 5DTFA 3QEQA 1JI1A 5BO1L 4QHUA 1MIML 2C4FT 4X5LA 3RWHA 1P1ZA 1OAKH 1QUNA 4OV5B 4LL9A 2F19L 4X9GA 4M1CC 3F5WA 1LEGA 1LQSR 4Z7UB 4OF7A 1JTTA 4OLYH 3MNWB 4MJ4A 3SDYL 1U3HA 1N5AB 3CFKA 3ETBF 2QSQA 1KACB 3W39A 3VXSD 3TBTA 5T3ZE 1MAKA 4KAQH 4G8IB 2V2TA 3WO3B 3RWJB 4DKEH 3LCYA 3KR3L 2DYPB 3L7FB 5ID0A 4Y5VB 2X40A 1M7XA 3RA7L 5EU4A 3SPVB 3GSNH 1CICC 4RMQA 5E9DB 5F71A 3KLHD 3DMMA 3IAGC 1AD9A 1RHHA 2UWEB 4PJIF 4F7CB 1OTSC 2WWKO 1IFHL 4KY1H 3RAJH 3VH8B 3HI5H 4HG4J 4P9MH 3TT1H 3BUYB 2XY1A 4NOBA 5HY9A 3LHPL 1JNHA 1WK0A 1IC5H 2VB5A 4WU7B 4JDVA 4ZPTB 4CU8A 5HHQB 3GHEL 4NKDA 5EU7E 1AGDB 4XAKD 3P9WB 3DO7A 1J05A 5E1AA 4EJ1C 1RZ8A 1A64A 1KELL 4I5BA 1PQZA 5DD3L 5L2JA 5E8EA 4KDTC 5EA0H 5D4QA 2XN9D 4PJ8D 5KVGL 3QIBC 3QULB 4JFYB 3MRFA 3RGHA 4R0LC 3TPUA 1DEEB 4I4WA 5DRZB 2VISA 2A6JA 3EO9L 4WI2A 1S7TA 5DJXA 3I3DA 1NBVL 4D9QD 3CLFH 5EBMA 4NQEA 3VFSA 3NA4A 1NCCH 4WUUE 4G7YH 2FX7H 4MVBD 4GAGH 1S7QA 4KK8C 6FABH 3MXVL 1DUZA 1NC4D 1VGEH 4YHKH 5ENWA 1WUNT 3TFKD 2Y5TB 3ZE2E 3GSNB 1B88A 5EUOB 2GI7A 2VOTA 2X1XR 5FYKD 5I6XC 2VDRH 4PJ5E 5FM4A 4XPAL 3B3IA 4NRXB 4Z8FH 3HR6A 3TIEA 4PRPA 2CIKA 1AQKH 1A6AB 1UWXK 2FJFA 1LE5B 2NYYD 2EDQA 1YA5A 4BZ1H 2WBJB 5IBUG 4LF3B 5I19H 4AIXA 3QXTA 5BQ7A 2NX5A 1AI1H 4APQA 3G6JB 5F6HI 3E3QE 1SVCP 4FXGA 4L8SA 3MA7A 3IETB 1FRGH 2X7LA 3LIZL 2FGWL 3G08A 3HZKB 3UO1H 5EN2A 4NQVA 4O5LH 4ALAL 4WENB 4LCYB 1B4RA 5GISH 3V6FA 4JFFE 1AJ7L 1G7JA 5LGJB 4P2RD 1IAIM 3I6KA 2GK0A 2MJWA 4ZUUA 2AJZB 2J8UB 2YEZA 2RBLA 2CDEA 5EOTA 3QQ4B 5F3BB 5M7QA 3QXAA 1I9JH 2ZOKB 3GK8L 3VWKA 1FFNA 2CR6A 1FZOA 2GJ6A 4LAQL 2HKHL 5ITFA 1CCZA 5C92A 5TQ2L 5DEFB 4G3YH 3LQZB 4UQ3B 5IHUH 4JVUA 2DQUL 2EH7L 5BJTB 4YBLB 3V0VB 5I16A 3V4PH 3CC5B 1BFVH 4ZNCD 3RX5A 1MLCA 4XI5C 1BFOB 4CMHB 2YD2A 5AZ2L 3T77B 4YHOL 3TJHD 4C58B 4F15C 2A83B 4NP4L 4X6EB 5BZWB 3IKCA 1LD9A 3FO2B 5L0QC 3BW9B 3FRUB 4LRIC 5B39A 2J7LA 4YHMH 1EZVX 2DAVA 3R0MA 4KJWC 5D6DC 3FTGA 4Z7VA 3V6OE 4L3EB 1AXTL 4X8XA 3SOBH 3IDGA 5FYJD 1UKQA 3WD5L 1ZXQA 5HGGS 3V4VH 3P77A 2UZIL 4JN1H 2VAAB 1NUNB 2CRIA 5F6IB 3I50L 3VDCA 4KROD 5EULV 4YR6A 3VG0H 4JRYA 5D1QD 1MFDH 4R4BB 4RAVB 1OPGL 1T2JA 4FRWA 5DXWA 1A3RL 1WWBX 1MCBA 1XGUA 1CGWA 3O2DH 1MFCL 4M7KH 2VERN 3OKKA 5CP7B 2VE6B 1N59B 3WLBB 4MMXC 1X5ZA 3BGAA 3MRIB 5J4MA 3VFMB 1VACB 5DQ9A 3QRGH 4OB5H 2AXFA 2NY3C 3FONB 2GYSA 4ETQB 3CH8A 1CLYL 3EOTH 2G60L 1I1AD 4LCCB 4C56B 2GAZA 1ZLUH 4OGXH 1LO5A 5IG7A 2C3HA 1SY6H 3PGFH 3P4NA 2AV7A 2ZSWB 5GZND 2APVA 3BMVA 5TPWH 4LPCA 1X7QA 4ZD3L 4NNPH 5I1GL 5LGHH 4NDMA 3IKKA 1YPZB 2BRRH 4L4VB 4E0RB 3OBAA 3HZYB 3QEHA 4UINH 5TDPA 4YC2B 5MP6L 3JV4B 2ITDB 2R0LH 3WUWA 5T3XE 5IF0A 5KBNC 3QWRA 3PV7A 4G9FB 2DDQL 5J8OA 1T2QH 2XT1B 4MCYA 3BXNA 4EEEA 4ELMB 3S36H 2VDQL 1X5FA 4WWKC 3O3BA 4U1SA 1UXWA 1IM9D 5C9KA 2DF3A 2JCCE 2BZDA 2F5BL 2VN4A 2RHEA 3GBML 5BS0D 3QUKA 4Z7UE 1JZ2A 2GEEA 4AM0B 4HF5H 3WV0A 1E6JH 3T0EC 4MX7A 5E00B 3EO0A 2BSSA 5FKPB 3S3SA 5BVPL 1G9NH 3GBLA 2MKWA 4MA3B 1I4FA 1D5MB 1RZKH 4UT7L 2V2TB 1YN6B 1I8IB 4HC1A 3WDHA 3BZDA 1A5FL 1OL0A 3L7FA 2B8OT 1LK3H 2GITA 1X4XA 2ADIA 2CKBB 3GGWA 3QT2A 1MCPH 1RHHB 5E2WL 4Q9BA 5SWZD 2DQDL 1D5ZA 1C16B 4Y4HA 3QHZH 5E2UH 2BHZA 5L88H 3LN5A 2HLFD 5IMKA 4FFVD 4UILL 1ITBB 3ZDYF 1Y0LB 4J3VA 2KKQA 4Y4KD 2NTFA 3WFDH 1JGEA 5DMIH 1JL8A 1IARB 1ZLWH 3WJLC 1FSKB 2GCYB 1XGYH 4AEFA 3H6JA 5IMMB 3G9VA 2VLRD 1X5AA 1KC5H 1DQLL 4FXKB 3P4LA 2HFEA 3RPKA 4DCQB 3B9VA 5T3XL 3VDAA 4Z7VE 1A6PA 5FM5M 5C0GB 4C56D 3RU8H 4NN5B 4NRYB 1BD2E 4P5TA 1UG9A 3LSOB 1CQYA 1FP5A 4MJ5B 5L9DL 1RAMA 3KGRA 3SKOB 2CIIA 5KSUB 1PZ5A 5F1OB 1I1RA 5E4EB 5T1MB 3P0YL 5DJ0B 4FTVB 4Y16C 3VFNB 3HMXL 3VFPB 4RNRB 1OP5K 1KXVC 4D0CA 2Y5EA 2NXZB 1YJDL 1YQVL 1OOAA 3W0WA 3QWQB 4P3DB 4HKZB 3HNVH 4ZNEA 1CD9B 2AK1H 5DJCB 4DTGH 1DFBH 5JMRA 2HH0H 2E7BA 4FQLL 4L4JA 2Q20A 4U1HA 3KS0H 2ICEB 3P4MA 2NY0B 4K7FA 4YUEL 2IALA 4JFDA 4N1CA 5D72L 5E8OB 2FJHB 2BSRA 4X4ME 4URTB 2XIDA 4UT9H 3KXFB 5DJDA 4ODSH 4Z7OF 3QPQC 4UT9L 3PWNA 2DQGH 1M7IB 3WHE1 2EEAA 4MLIA 1NCUA 5DUML 2E7HA 4U1GB 5EU6A 1TJHH 3U7WL 4HZAA 4TRPH 2HJFB 4G6FD 1YC8A 3DECA 5E1HB 2LQRA 3FT2B 4GFTB 3CX2A 2A1WH 1U58A 3HG1B 1FORH 1X5GA 3U36B 3Q1SL 2PYFA 3TH2T 4D9LL 1J18A 2J8OA 4HWEH 1C1EH 1FGVL 1CLOL 4LSQH 4NN6C 2ZJSH 1MRFL 1N0LA 3PP4L 2EIEA 5DD6B 2Y23A 2Z93B 2E6JA 3D2UA 1DDHB 4XI5D 1IGYB 4OKDA 4RDQG 4MGXA 2DLFH 3SE4C 1JGDA 4NO0D 1S9XA 5HVWA 5K9QI 3RU8L 1REIA 2JIXA 5B8CC 5F3HA 5E5RB 1SBSH 1GZQB 5EBLB 3S97C 5IB1A 1CQKA 3D69A 2I5YH 3Q48A 3HE7A 2GUOA 2KQNA 3IT8D 4JCMA 5DMIL 2AJYL 3GMMB 3PGDB 3IAQA 4OD3H 4L3CA 3E0GA 4XP4H 4AIZB 1ZT1A 4IRJA 2ZCKH 4JJ5A 4PRHA 1RUPL 2WP3T 1NPUA 5GRUH 2YPLB 2J12B 2AXGA 1BM3H 4K7PX 4HWBH 4PRHE 3H9ZA 5E2UL 5IOPB 3E6FA 3EYSL 2HKFH 3FQNA 3P9LA 5HYSB 3KPSD 4EQ2A 2Q7YA 3MLTB 1EUTA 1KIRA 1U8PB 2BNRA 4M1DH 5ADPH 5I8CA 5C0AD 3HN3A 1H3UA 2OK0L 4W4OC 3RL1B 3ILQC 3OMZA 1JUFA 4UAOC 1RZIB 1FGNL 1JE6A 2MCPH 3UPRB 1UWEH 4HH8A 5KAQF 3P40A 2NY4D 3KDMA 2DMBA 3F8UB 2JK5B 5IVXF 3MV8B 2YUZA 5F97E 2ED8A 4N5EC 2FBOJ 3EDFA 2YKLL 2AQ2A 4MNHA 4MJ6B 4PJGA 5I1KL 1C5CH 1T0NA 2UY7A 3L95B 1VFMA 1T2XA 5F9JB 1UACL 1X4YA 1GH7A 5D7IF 2C4XA 1WEJH 3TCXA 4GT7A 5CILH 3VFTA 4QTIL 3UCRA 3TYFA 2VDMH 3ZE0E 2APFA 3SDXF 1K4DA 1EBPA 3SE3C 1QSVA 3RDTD 4APQC 1PAMA 3QWRD 4OTXH 4M1GL 5I76B 2R69L 2LABA 3FQUB 1EEUA 4UIKH 4LF3A 1MI5A 4BH8B 3O3BB 2ZCLL 3O6LH 4PP2B 3ARGB 3RUGB 5EDXA 5K9KA 3TN0D 3DSFL 4QHKI 3MA7B 4NNPL 1T0PB 5I1GH 2NQCA 1MCWW 1CTOA 4GG6F 1N64H 2IH3A 3KXFE 3LH2H 2ADGB 2H9GA 4HWBA 4PGCA 1EERB 4PJFF 2VXSL 3VU2A 3EO0B 3P30L 2Z4QB 2CLRA 2YRLA 5EUOE 5T1DH 3UJIH 1P7QB 4QOKB 1MCQA 3LOWA 5INCA 1BVKB 4W6XB 1T03H 5E2TH 3EJYD 1TFHA 4Y4FD 2DL2A 3V8CA 2WBWB 3CMOH 1FZOB 4HG4K 4X4YB 3UAJC 3BT2L 4ODWB 1QNZL 4UT6L 5EC1A 3VD7A 4ENED 5E99L 1HZHH 5CGYD 3VXPB 1J1OL 5F7KC 5B3NA 4U05A 4FFYL 3INUH 4GMSL 2UZIH 4QGTA 3IU4H 3LEYL 5HI3C 3WIFA 1GGCH 1BZQK 2NY6B 1F6FB 3EOBB 4EN3A 1GPOL 4ZUTA 2R2BA 1CVRA 3MX0A 1I8MA 1TQBB 3WN5A 2DN7A 4JKLA 4M5ZL 3SQOL 1BBJB 2J1KA 4LNRB 3QQ9D 4OZIA 2CDGB 1FL3B 5FYJU 5KAQG 1B6DA 3SDAD 3VGHA 4K3GA 4GAFB 4X83A 5ESQB 3IDMA 2EH7H 2A6KB 1ZLSH 5C2BH 2OR9L 4HUNB 1INQA 1D9KB 4PJ8B 5MEPB 1S9WA 2BP3A 1CGTA 4KMTL 5H94B 4F33B 1ZLSL 4ZTOL 1HCVA 4IRZL 4HBQA 4MA1B 1KG0A 3SO3B 4DEPC 3IJHB 4NWUL 3SGEH 2ORBH 3KPQA 4OJFL 4QRRD 1UGNA 5HDLA 4O5LL 1IZKA 1HI6A 3B6SB 3RTQD 7CGTA 1MHCB 1MQKH 3IJSA 4OZFG 4I3GA 4OZFA 2AV7B 2EKSA 4MA7H 4Y19B 3P4MB 4G6AC 1XZ0A 2X4TB 4O2FB 3VXQA 2F15A 4NC1C 4GKZA 4V2BA 5DVNA 3BZFB 3DARA 1GGCL 1U8NA 1X5KA 2P5WE 1WBXA 3WUWG 3TBVA 4RDQF 2FLRT 4NSKA 4P2QD 5C0JB 2P5WA 2Y07L 4S1DD 2ARJA 1R3HA 2LU7A 2BMKA 3WKMH 2BCKB 4ZUWA 3GMOA 1J1OH 1NUFA 2HT4C 5ITBH 2VITB 3MRNA 1KCUL 3T04D 1JN6A 4JN2A 5JHDB 1GHFH 5I6XB 2VLRA 4JREC 3DLQR 5CAYB 1QNZH 4HUKB 4DGIL 3WNPA 1R5VA 3FFCA 2P8LA 4UDTB 1EHXA 1JFQH 4TNWF 1UVQA 1MREH 3PGCB 5HHVH 3TYGL 4K55A 2DD8L 2R23A 2AQ1A 4I0PB 1ND0B 4BSWA 3SKMB 1A6TB 3IDNB 4DN4H 3SDAC 4KWUA 4NPYB 1S7VB 1FN4A 5FUZH 5E94A 4NRZA 1BX2B 1XF1A 4WGVB 1MF2H 3QUML 1NBVH 4ZPTA 1KV3A 4HT1L 3VXME 5H2BA 3EO9H 2ARJQ 5IB3A 3IFLL 1MUJB 1X5YA 1EFQA 3DSFH 4AY0A 2JJVA 5T1LB 1QG3A 4J3SA 1BIIA 2ZCLH 4LEXH 4P46B 3O4OB 1QRNE 5CZKA 1CWVA 4B53A 3NFPB 3MRFB 1I7UA 2FWOA 3MPCA 1X5IA 3GHEH 1OT2A 1TZIB 4E41A 1U8KB 4EVNA 4M7LL 2X89A 1VFOA 1IKFH 5LWYH 3MRLA 3BKJL 1IEBA 3K3QA 4PRHB 2B1HL 3VXUA 4ZUSB 4P9ML 3TT1L 1YNKH 5DTFB 3MLUH 3HI5L 1J12A 2FYYA 3HS0A 4HWZB 4PY7A 5GJSL 4KY1L 1WEJL 4X6CB 4M7LH 1UACH 5CJBA 4X5WB 2R1WA 2H6PB 3C8HA 3DX7B 3QG6A 4NCDA 3GNMH 5C0DB 1MCWM 5ICZB 3BP4A 2CO6B 3CFKB 4F7TA 3QUZC 4K71C 3KPMB 5FF6A 3HI6H 5MEQA 2CIKB 5CJ8A 3REWB 2CIIB 4KK5D 4RMWA 2MCPL 3HRZA 2WINB 1FV1B 1T5XA 5I74B 3SDYH 5ID0B 4JY4A 1KB9K 5T1MA 2WBJA 1ACYL 1NAKH 3AY4C 5E6ZA 3HUJF 2C3GA 2NXZD 4WHDA 4APQB 1GC1L 3L3JA 3EYSH 4HGKC 1MF2L 1F11B 3VI3E 3ZT5A 5FUZL 1HOCB 3VFTB 2X5PA 3OXRA 2C3VB 5HBBA 4UU9A 2Q86A 2D31B 3OJVC 5C6TH 3EZJB 4WU7A 3WIIL 1QEWA 3K2UH 1MREL 5HHVL 5CZVH 2AJYH 5T3ZH 5IV2B 2NY5C 2VLJA 4UUJB 1P1ZB 4Z9KB 4JPKL 1MLBB 4PP2A 1LE9B 3ZT7A 3MRPB 4OIIL 5B8CB 1F4AA 1SHMA 4G9FD 5FYJH 3K81A 4Y2DC 3BP7B 4UAOB 4XP5L 3CFJB 2ZP0T 4FTVE 5TH2B 1EFXA 1IM3A 3IDXH 1YC7A 3W39B 2H9GB 1OAQH 3LEVH 3KLDA 2D7NA 2XQYG 2XZQL 4KGJA 2DLTA 1FC1A 3BKYH 4HK0B 4MA7L 4M93B 5EWIH 1CLOH 1G6VK 3CFEB 2XZCL 4JFQB 4ZO6A 2DLIA 1MHPL 2W0PA 4D9LH 2IBZY 3FMGL 4F57H 5DD5L 2AJ3B 4I0CC 1CFTA 4NJAL 3AREC 4FFWD 5HDOA 4PJ7B 3QIUA 4IRZH 5JR1H 3F7YB 5D7LA 3SDDA 5MEOB 2XACC 2CKBL 4YGAB 4JQXC 4Z78B 4KMTH 3TESA 4U6XB 2JJTA 4A6YH 4LAJH 3DI2B 2OL3B 3O45A 5ACMA 2B2XH 5DUMH 2XXCB 2KQMA 1NDMA 4PYGA 3K7UA 2OR9H 1BQUA 1KJ2B 3BDXA 4LRNL 5KN5B 4GMTH 3VA2C 2XKNB 5HI5C 1T04B 3BGFB 3DTXB 3L9RB 5IUSA 4FP8L 3FQXA 4JFDD 4NYLA 3MYJB 5CJOH 5EBGA 5D7JD 5SWQA 3JTTB 4X98B 1QBML 2IH1A 5INDB 5DK2A 3S5LG 4DUXA 1NCWL 3MLZH 4LHUB 3R1GH 1MAJA 3HNVL 2E3VA 2GJ6E 3MFFB 5GGUA 2NY1B 1IAKA 3NGBC 5LCVH 2P42B 3P4NB 4UV4H 2A2QT 1QBAA 2DJSA 3EKCA 3DYMA 4M3KB 5D1QB 2AK4E 4FFYH 1QLRB 4NKIH 4ONGL 1FVEB 1I1AA 2AVGA 3HZYA 5H94A 4GBXB 1S7UB 4Q74A 3CDGB 2X4OB 1T3FB 4N8VA 4ONOA 4RX4A 3BH8A 1LMKA 5F7DA 2YMXL 4OGYH 3ROLA 4YK4C 1IC4H 1M6OB 4P3CL 3DMMB 1G6RA 3I6GA 5F7EL 3MV7A 3MNZB 3B2VL 4DVBA 4XPBH 2ATKB 2V7HA 5D1ZD 3QUXA 1G9MC 4IRSD 2FCBA 4PJXF 2VXSH 3QUKB 2NXYD 1WBXB 3HR5B 4Q6IA 4ZO7A 1FIEA 2J88H 3IDIB 3WFDL 43C9B 4WHYG 1ULVA 1SMOA 3IVKB 4PJAE 3SN6N 4ZUWB 3WIHL 2W38A 1YYLL 1HQ4A 1HHHA 3ET9F 4BZYA 4Q2ZA 3OGCB 1VB9A 1YN6A 5IW3A 4M02A 3W2DH 4YBHA 3DROB 3HE6A 3W82A 2X4QB 3UTTD 5GQBA 4ZNEE 4JO3H 3ZDZF 2Q87A 4MWFA 4LNVA 4Y8DC 4PJXA 2VQTA 1WT5C 4OGAC 3MRIA 1JGVH 3LB6D 1CD8A 5C0BD 7FABH 4E41E 4JRXA 5IJVA 4NPYA 4PJXE 4KZEL 3T0WA 5J56B 4KHXH 1FH5L 4IDJH 5GGQH 1U8HB 3GMRA 1JGLH 4QHKJ 2A83A 5E2VH 2DQEH 3OKDB 1A3LL 3K4AA 1MUJA 3RWIB 1BOGB 4QYOA 5T1LA 1KBGH 3PWPB 4N5UA 4OGZA 2PYED 4U0RC 7FABL 1WTGT 5TDPB 4S1DC 1NCDL 2DQCH 4QRPA 5JQ6H 2OK0H 2HLFC 5ADPL 2NY4C 3TA3C 1NFDB 4MCYB 2Q3ZA 3VMNA 3W2DL 2R0LL 4NQCD 4UINL 4HWBL 3DV6B 1A7QH 1BM3L 2DTSA 5DJ2B 1CL7H 1FYTD 1YYLH 5HYQB 4X6CE 2IFGA 2CUIA 3OKKB 5DJ0A 4F7MB 5TPWL 3SY0B 1G0XA 4OD3L 4X6CA 5K9OB 3QZWG 4L29A 3V5KA 2J88L 3UAJD 4O00A 4WTZA 1KCSL 1QBBA 2H6PA 3HI1A 4TVPL 3EFFA 4QRPD 5C0DA 3TA3D 2XRAH 1A2YA 3T08A 5DRWB 2EEBA 2OXHA 3PIQA 3QRGL 3IDMB 4IHOA 5F7EH 2BVYA 4NZJA 5DJ8B 3U2SB 5DRNA 2O26U 3SGDI 4WNQB 4Y4KA 5EIIA 4PJ7F 1KPRB 1JWUA 3QPQD 3RX8A 2GJ6B 5E4EC 1A7PH 2DQHL 3C6LC 3KJ6L 3QO0B 4TUJB 3N85L 1R6VA 3FB6B 2VTFA 1D5ZB 5JA9A 2R15A 4OQ1A 3ZKND 3VG0L 4JY5L 1PGRB 2FR4B 4P5MA 1MLCB 4YPGA 3TH3T 4NKIL 3ZKXC 4JN1L 1C1EL 3ARBC 5D2LA 5FA3B 5D7JB 3WD5H 5A40E 4X6EA 1S5HB 2YD1A 5C0ND 5DMYA 3WKNA 1AXTH 1A8JH 1BJ1H 1ONQB 1OTTD 3DUUA 3O11A 3JWOL 4TTDC 1MAMH 2A1WL 4R2GC 5DT1H 4MNQD 2X2YA 4OZHA 1KPVA 4R2GB 4Z7VB 1P84J 3GMPB 1HXMB 1QBMH 3DX8A 1C5BH 2D7OA 4K3DH 3O2DA 2RFXB 3BP6B 4L3AA 1N2RB 4LLWB 4X80L 5I1EL 3QUZD 2PN5A 3UJTH 2VAAA 3ZE1E 2AKRB 4P46C 2DQGL 2UVEA 3LEXB 4BFBD 2R2HB 2NW2B 1E4KA 3D1MC 3UP1A 3PDDA 4WTXA 2PYEA 4LRNH 3H9SB 4O2CB 5C0FA 2UVFA 2GITB 4WWKB 1OB1A 3WNLA 3CMGA 3BIKA 4YHNB 2OMNA 5MHSE 1YY8A 5KG9A 1WSST 3AAZA 2F8VA 2W07A 3CZJA 3NAAH 4PRPE 1AJ7H 4JQVA 1VSCA 2EYRA 3HUJA 4HJGB 4IRSB 3T0EB 1QRKA 1MHPH 2Q76B 5IWLC 4ODUA 3UO1L 4PRNB 3OWEA 1EHAA 2FGWH 4RGMB 3RHWF 3BKYL 1ZWIB 3AM8A 4JRYE 4KKBC 5CZXD 3VGAC 4BFIB 4BQCA 1OGTB 4NHCL 2FJGB 4RGMC 1S7SB 4JQIH 2Y6SC 1CD1B 3OXSB 4X9IA 4OCWL 2OP4L 5FM8A 4JO4H 5HYEA 3D3VB 3GRWL 4LCWB 4MJID 3S3PA 1CG9A 1R3JB 3OV6A 3QEUA 1RZJH 1ZGLB 2QQLL 5LBSH 5J1AB 2HTKD 5KSAA 3HG1E 1P4BL 1T1WA 2Z8WC 4JQVC 2F74B 3BWAA 3M07A 3D85D 3TZVD 1JZ4A 4TYUA 1ZA3B 2EC9U 2PCPB 4PJGB 4RRPG 5IROA 1W8OA 4J8RB 2B5IC 1V7MH 4YHKL 4TSBH 5EUKA 5C08B 2R8SL 4V1DA 5D2NB 3ECBA 4UILH 2JE8A 1RZFL 1Z3GH 3O3EA 4KH2A 3TYFB 4H1LG 3VXTA 1FFPA 4JFFB 4ZYKB 5E08L 4K8RC 1JF6A 15C8L 4KKLC 3REVB 3RVUC 2JJUA 2CXGA 3PXHA 3O8XA 2APTA 3DIFB 5DLML 3BP5B 3MLXH 5EO1B 1KIPB 4F2MA 4X0KA 3STZB 1OM3H 5KVGH 4XXDA 3W11C 5JMOC 5CSGA 1RZKL 3NA9L 4LDOB 4S1RL 5BVPH 5TJWK 5SV3A 2OTPA 2GY7B 1E6JL 1K4CB 2EECA 5EU7C 3M1BB 4D9RD 1KXQE 5BMFH 3D48R 2ICWI 5ANME 2Y72A 4U6YA 1P9MC 3LHPH 1S9YB 3PL6B 2X1OA 5DVKA 3D18B 4KDVA 35C8L 1S7QB 5D2LE 5I1CL 4JVWA 4LMQE 4XP6H 1MJUH 3TA3B 3B9DA 1OWWA 4WY7H 5IOPA 1TPXB 4JM2B 2COQA 4LLUA 4GO6B 4PJCB 5ENWB 2I60H 4OZHE 3RWFA 3GSNL 1AD0A 2M8XA 3K4ZA 2BOCB 1OARH 4ODWA 3ALPA 4JFZL 4MWFB 2Y36L 3QNZB 4GBXC 3UBXG 1DDHA 3SJVE 2DOCA 3QCVH 2BRRL 4JGJA 1CIDA 4K3JL 2IBGA 3P0VL 2YD7A 2J5LB 4XT1C 2BVPB 3OKEA 3C5ZB 4ZD3H 3HTLX 1FG9C 4LU5H 1FVDA 5HHMB 1SY6L 3Q5OA 4G8GD 4HT1H 3ISWA 3G6JA 3JBG7 4BSJA 3QUMH 1OAKL 1XIWB 2P47B 2QJDA 1BOGA 4QYOB 4MXQC 4R26L 5DDHB 3HNTL 1ADQH 1MPAL 2C1PB 4OZHF 2AJSH 1NFDE 1BD2A 4H5SA 5DQJA 2ICEA 3MRGB 2XTJB 3U9PL 2I07A 1A3RH 3MYZA 5HGDA 1MFDL 1SYSA 1T5WA 3RUGE 2A6DA 3GBNH 5IHBA 4M6AA 4D9RE 4K23L 5ITBL 2FRGP 4LKXA 3ARGA 1N3NA 2KPNA 2RIKA 3RUGA 1T04A 4KUCF 3OJMB 1OCWL 4KFZC 3TNNB 5JXEC 4GAJH 5C86A 4Y4HC 1D5XB 3MV01 3SOBL 4OLVH 3WEXB 3K74B 4ELME 2J2ZA 3QNYA 4C57C 5K93A 4YHML 4MNHB 4HD9A 5KVFL 2HG5B 4K7PY 2BY3A 3FRPA 5BOPA 5L8JB 3C6LD 3D0VB 4FQXB 4JRXE 4P48A 5GZNC 4LQFL 2R2CA 1BVLB 2PTUA 4OJFH 4NWUH 3GSXB 3BPOB 4NKOA 4NO3B 4ZTOH 3CZFB 2A73A 2YD5A 4DUWA 1VEOA 5HHQA 5J11B 1A9EB 3KPNB 1JGDB 1KJVA 1RZGA 1S9XB 1DQML 4U49A 3GK8H 4U1JB 4MNGB 4CGTA 2B20A 3ARXA 3DBXA 4YHZL 3BX7C 2YD4A 4P4RA 4HUXA 2AGJL 5EBLA 3MNZA 3TT3H 4Y5VC 1J9CT 3E6HB 5CWSA 1NMCC 2XNAB 3STLB 5FOJA 5E95B 5I1AB 5J9PA 3OQ3B 1QR4A 4OZGF 4GG6A 1LO0L 3WN5B 3HR5A 4EUPA 5F70A 2ADGA 2YA1A 3SQOH 4PJDE 1QSFA 4MS8D 4TTGA 4KKCD 3UTZA 1SM3H 1S7VA 2CDFA 1RI8A 3BWUC 3P3YA 4P4KA 4X6DF 5IG7B 4X99A 1BF8A 3IB4A 3IU4L 2E6PA 3V6BR 4BZ1L 3HHRB 5C0AA 1G1CA 1JGUL 3NFNA 3INUL 1X7QB 5MI0B 1JK8A 3VRJB 5HI4D 1KIUA 4NDMB 1ZVSA 3QDJB 1I9IL 1ROWA 2R1YB 4OCRL 1P6AB 3GJFH 5E99H 4UT6H 5FIEA 4HCRH 5F88B 3AREA 3O0RH 2AW2A 3CMOL 5CJQH 5CFHA 1IAOA 2CLVB 4H20H 2BDNL 4WFFE 5C0BE 5CCKH 2V6HA 3VMOA 3WXWL 5FO7A 1OAXH 2ZUUA 5DMGD 4Y7MA 5EBWB 3QUMB 3MXVH 4XP9H 1BVZA 1KTLB 1YN7B 4K7PL 1E28B 5IB4A 1VADA 4OZFH 4TQEH 3PWPD 2FX7L 3SGDH 4M7ZB 4PB9L 4TNVF 4NNXB 1I1FA 2Q6WB 3QCTL 1T7XA 3OKOA 4I3RL 3LH2L 4QRUB 3K0WA 4XZUA 5E03A 4G6JL 1BMGA 2OI9B 3H9SE 2Q8BH 5E00A 1H9VA 4RMSA 1HIML 2QHRL 5ICZA 3OAYH 4XHQA 4WEBH 5JW5B 4PRIA 4DK6A 4OZIE 5JXAH 4YXHL 1OGAD 4UIKL 1K8IB 1MCIA 3MV8E 1S78D 2PF6A 2VDKH 4L4VD 4HUMB 1MFBH 1HSAB 3GM8A 3TF7C 4DOHB 4EOWH 2IPKA 3P9MA 3F7QA 1DN2A 3MLYL 2CQVA 4LCCC 1C16A 4Y4HB 2V5MA 2W9DH 5AEAA 4HMEA 1LNUA 1B3JA 5CBAA 3JTSA 3U9UA 1CFNA 3ULSB 3ARFB 3PDGA 3VXTB 2D3VA 5GSVB 3O4OC 2VL4A 1HI6B 1CXKA 1E0OB 1HXYA 3B6SA 4M93C 5DA4A 2M26A 2NY6D 1H0DB 4NM8L 4GW1A 2ZOLB 5HVGB 1MI5E 5D1XA 1NKRA 4FQHA 4YE4L 2E9BA 5JUEH 4OLXL 3DXAE 3NPSC 4LSRH 2H3NB 3VWJB 1NSNH 3H9HB 4Y4FC 3IDGB 4PUBL 4RISH 2XY2A 1G7PA 1OP3H 3C08L 4RMUA 3TP4A 3QXDB 4UTAH 4MA1C 4OF5A 4NRYA 1RZ7H 2RB8A 1E4WL 1FZKA 4P5TB 3QFDA 4HAGA 2ZNXA 5L8KB 2KBGA 3D2UD 3C87A 4ZFOL 1N6QH 1PG7X 4LOUD 5J57B 4PV8A 1B6UA 2EC8A 5L0QB 1R5VB 3FFCB 5GGVY 1IBGH 4XAWL 3K1DA 3HS0B 5T3ZD 4OZHB 2KZWA 3S35H 5I66B 4JM2A 1FAIH 2YN5A 4KI5F 1ZHKB 3TIDB 3QUZB 1ND0A 1KEML 4PGEB 1YY9C 3C5ZD 5EZIL 2AXFB 4R90L 4Y4FA 4E5XB 5ICXA 2DM4A 4YJZL 3AU1B 3V7AE 1JJUA 3KYMB 4RFEB 4XWGH 4NBZB 3KPMA 2R29H 5L2KE 1A47A 1KNOB 4TPRL 5D70H 4AEIL 3H3PL 5IB3B 1N4XL 3FQTB 4O51A 3D0LA 2OS7A 1S9WB 3LQAH 2RCSH 3VWKC 1PW3A 3NIFF 5DJYB 3D39B 4K94L 3VI3F 1RUKH 3SGKA 2IQAB 2O93L 5GS1C 4FQCL 1MHEB 2VDNL 5E8PA 3DTXA 2X4PA 3IF1A 1EX0A 1ZLWK 5IF0B 3WUWB 2GJZA 3HPLB 3ULUL 3ZDYE 5DYOB 3RWDA 3HC0B 2BNRD 2W9LA 2ZG3A 3CFIC 4O9HH 2AAVA 4XBGB 4B41A 4KI5E 4EVNB 3KPTA 4AMKH 1CXHA 4JANB 3IJSB 5D71L 4OZFB 1JZ3A 3Q1SH 1BAFL 4KRPC 1S9VB 3U0TA 1FORL 1OGTA 1B2WL 3O3DB 3LN4B 4EI6A 4YNYA 1ZT7B 2JB5H 3QAZC 1U95B 5AAMA 2EZ0C 2BERA 1U8NB 3F58L 4TRPL 1UA6H 1MCRA 4QWWC 3GUTB 1GGTA 1TJHL 5GPRA 2R0ZL 4PS4H 4PLKD 3WCYA 3EO1B 4Y5XC 2HRLA 1NGXA 5JA8B 3GSUB 4EIZC 2W65B 4DZ8A 1BPVA 1KLUB 1UJ3C 4RSVA 1ZVYA 4X7SH 2FECL 5GGSY 5DR5H 3BH8B 3FOLA 1K85A 4NKQB 4R7NA 3T1FA 1B0GA 4J8RA 5F6HJ 1PSKH 1SJHB 1LP9F 5LQBH 1NANH 2PTTA 3CDYA 2MQ0A 3AS3A 3VXMD 3LMJH 5JW4Q 4LCUB 5CEXA 4P2QA 4DTGL 5EZOL 1KEGH 1GXEA 1J0ZA 3HE7B 1ZLVH 4NGHH 4RFOL 4OAWA 1YJDH 1YQVH 4NC1E 4K2UH 4K71B 1ZHBB 3GMQA 3PGDA 4PG9A 1IQWL 2OTWA 5FV1L 1CICB 4QOKE 4X6FB 5SV4A 1OP3K 4OM0H 2DTML 4MLSA 1WV7T 1E6OH 4L4TB 1V8HA 1QOKA 1T7YA 5AUMB 1U8IB 3KS0J 2VIRA 3UXFA 5L9DH 5IVNA 4IS6A 3WSQL 3NIDE 2QEJA 3L7EB 5DVMA 1FYHB 4L9LC 1NJ9B 1L7TH 4PJEB 4IIQB 4QNPE 3U7YH 3MLVH 3D6GA 2F54E 4D8PB 2I27N 1SQ2N 4UTBL 1JHLL 5HHOE 3GMRB 1CLCA 3CD4A 3L1OH 4YXKH 1BZ9A 1MFAH 2OM5A 1TCRA 5HHMD 1RU9L 4XMPL 1MCOH 3QDGB 3WO4C 1DQJB 5FHBH 1OT1A 1KSRA 5FDWB 4JG1H 2AS5M 3TWCH 4WJ5A 4XC1H 4TVSa 1ORQB 3I9GH 2WIIA 2FIKA 2P8PA 2WSKA 4LSSL 3THML 1UZ6F 4QTHA 3OG4B 2CLVA 4L1HA 3FQUA 3Q6GH 1XH3A 2W91A 1ZE3C 5HDQH 3HAEH 1IGTA 5FGBA 3RWCB 1TDQA 5JNYA 1R0AH 4R96B 4XNQA 3QA3A 3SKJL 3P4OA 1QYGL 2UZXB 4LCIH 4M48L 5K9KB 2NR6C 5C07B 1OD9A 3HNSH 4ONFH 4R6UA 3SY0A 1U6AH 3ZL4L 4N8PA 4HF5L 1GJIA 5DI8A 3GSQB 4PGCB 1IGMH 1SY6A 4QHLB 2MKLC 4HQQL 5DK2B 5I73B 2J8UF 3EFFB 3RL2A 3LS5L 4KTEL 4WHYH 5LKNA 2BY0A 3TO4A 3OKMB 3OF6D 4OUOA 1F4WH 2XA3A 4N68A 4XNYL 1MCSA 1IAKB 4WUKL 1JPFA 5GS2D 2CO7B 1UZ6E 1FZJB 3WS6C 2QQKH 2W0FB 1EMTH 1MCJA 3MLRH 3HC3L 4AQ1B 3W81A 5E8DH 5DJ6A 4TUJA 3O6FB 4GQ9L 4NQSA 4Z6AT 5FUCC 3QIBB 4JPWL 1G7LA 3MACH 4CW1A 4PJXB 4JHAL 3VH8G 4F80A 1O5DT 2Z35B 3BN9C 1OLZA 4DGVH 1DANU 1LNUB 4OCLC 3ZDXF 4LPXA 1R3KB 1EEZB 3FN0L 1X9QA 3JWDL 5CBAB 4K8RL 3ARFA 5DMKB 3VFRB 4RWYL 3ROLB 4JFPA 3KG5A 2J8UE 1I3GH 4W6YB 4GW1B 3FQRB 1JWMA 4LSDA 1HINL 1P53A 5JOEA 3MUGA 2XWBB 3SDXE 1KPVB 2H3NA 3VWJA 5DK0B 3H9HA 5F7YC 4E42A 2DS4A 2QL1A 3QPXH 4OZIB 3BFOA 5F7HA 3T1WA 1IZJA 2XA8H 4JJ5B 3QEQE 1U93A 4X8JB 4GLRI 5HYJD 3DBXB 1ES0B 3RGVD 3RVTC 3TVMA 1WVZA 3FQNB 3E6HA 4UB0L 3MLWL 3IFOB 1LO2L 3DROA 2IADA 3HE6B 3QDME 2CGRH 1TQCC 3MRQB 5EOCH 5I1JL 4G6FB 3VG9C 5FO8A 4PLJC 4L3EE 4JO2L 2NTSP 3O9WB 3MV8A 4U6VL 2HT3C 4F9LA 1A14L 3MBEB 4JFED 3CUPA 5IB2A 1WBZA 3V5DA 5I15H 1HN1A 3ESUF 3BRFA 3RVTD 5H37H 2ZUVA 4DQOL 4YHOH 3OKDA 1U2HA 5D8JL 5I1HH 2FL5B 5F7LB 4P59L 1JK8B 3CPLB 4XCYA 2DI8A 1LVEA 2MHAA 3EJYC 5DJYA 4MSWB 3GRWA 2E8ZA 3V4PL 4JGMA 5I73C 4PY8I 1VFAA 5M94B 2DQUH 1N7ML 1FFRA 3QWOB 4U33A 2EYSA 3BGMB 1TZGH 5ETUB 4N8VB 2IG2H 5FCSH 2VABB 2OQJB 4JN2B 4XNXH 3WFBH 3TC9A 4HGMA 4KDTA 1XCQA 3MV7B 1UCBL 2LAGB 5IEHA 4L8CB 4CJ1A 4CN4A 1EGJL 1M05B 1IL1B 1EJOL 4JKWA 2IANA 4HIHA 4N0YH 2FNBA 3GMPA 3BSZH 4P0DA 1NLBL 2OYPA 4HUVA 3T3PF 3LKPB 4NO0A 4J23A 1A6TA 3TH4T 4LHJB 2P5EE 3L3KA 4RX4D 3IVKA 5HHPB 3VRIB 5C07E 4OQTL 3OG6B 3P0GB 1YNTA 5BRZB 2GSIA 4FQQA 4L1DA 3JV6B 1RUAL 4R4ND 3HFML 3T3MF 2V17H 4Y19D 3RTQC 5DUBB 5ESVA 1GSMA 4D3CL 1EAJA 3EDJA 2FSEB 3CCHB 1K6QH 3FCTA 3DIFA 4CMMB 4KZDH 1CGVA 4B0MM 4GKNA 1LHZA 4KTDH 3BMWA 3FO9A 1SVZA 5E9DA 3FAXA 4DVRH 4NQDE 5IEKA 1AQKL 5DZOA 4Z8FL 3FB6A 3HC4H 4YX2L 2VDOL 3VFGH 3DVGB 2XTJC 5ISZE 3BUTA 1DN0B 1A7NH 1BWMA 4DFIA 2V9TA 1TZIA 2QLVB 2ZCHL 1KTKE 4P23B 2HJKA 5I8EA 3TBSB 1O7VA 4ODUB 1WZ1L 2Z8VC 5DRXB 4Y16A 1MJ7L 2X70A 1Q94A 1W0WA 3V7MA 1J10A 4PD4K 4HWZA 2OSLB 1H3GA 4LLYA 4XBPA 1A02N 1NC2A 4LLUB 5BV7B 5E24E 2M2DA 3L3OA 5E7BA 2EIBA 2R0WL 3IDYC 2UZYB 1ZHLA 1MWAB 5B4MD 4XH2A 3RVXC 1FO0H 3S9DB 2XOTA 4DOHE 3WMSA 3BP4B 1U8JA 1HHIA 3CGTA 3E3QC 3FZUC 2CUMA 5FF6B 3IGAB 1F4XH 5IJKA 2FX8L 4DAGH 1W0VA 4PY8J 1YEDB 1HILB 5CD3B 4Q9QL 2H41A 4JY4B 4JFHD 2LAAA 3O8XD 2YPLD 1DUYA 4TOYH 2F53D 5C8JA 2R9HD 3SKNB 1V3JA 3V79C 1JNNH 5CSZB 3BPCB 4I18C 5T33L 1TITA 3MBEC 3RAJL 3HUJB 3PWPE 2HFGH 3BHBA 1DBAH 4MD5A 1QEWB 3ZKMD 3CVIH 1BD2B 1T4KA 3QHFH 3LRHA 1T0MB 32C2B 3GI9L 2EE6A 2B1AL 1SYSB 3RWCA 3QO0A 2APXA 3QA3B 2R2EA 1WCQA 1H5BC 1RVFL 2F54B 5FYLL 1RJZA 4OZGB 3MRPA 4X6BB 1S9KC 2VQUA 3OKLB 2M1KA 1QFWI 4LSUL 3P11H 1J0IA 4X9FA 5A16A 5L7XL 2ARJB 4YHYB 4HFWB 1AGCB 4DK3A 1OAUL 4XBEL 5I0ZA 3ZHDA 1HQRA 5T33H 2VLRB 2AP2A 4ZUUB 4XVTH 3D18A 1ZA3A 4PR5A 4M6ML 5CIPA 1CGYA 3T2OA 2P8LB 2WK2A 2A38A 4HPYH 4U6HA 3NIGF 4JO1L 1FIGL 3RWFB 3R4DA 1JYNA 2HMID 3N9GL 3MNWA 5IQ9A 3C60C 1I7RB 4OKVB 5E94B 1FFPB 5FUOL 1TVBA 2FX8H 5HHXH 3VE0B 3CVHB 4R3SB 3ES6B 4OM1L 4N0UA 1EEZA 1R3KA 3H9SA 1BFOA 2F53E 5EO1A 1E4XL 1NGQH 2VUYA 4UOJA 1A6WL 4F2MB 2DQFB 5IB5A 1J86A 1HK6A 1CT8B 3W9DA 1I8KB 4JM2F 4N9GA 3TN0C 2XWBA 2B0SH 4TNVK 5CGYC 3UZEA 4KK6D 4L3EA 3AGVA 5KSAD 3OPZH 4M6NH 3CFCH 4I77L 4JDVB 4C4KT 4MQXC 3OHXA 4LASH 3MTRA 4IJ3C 4PJFE 2FATH 1PG7H 2PYEE 1X5XA 1KT2B 3ZYOA 1FNHA 4OFDA 4GKSB 2PO6A 1S7SA 4OI7A 4FABL 5J13B 2VDOH 5AD0A 4H1LB 3QI9C 4LSPL 4M1CD 5L2JB 3QUYC 3BPLC 4WFED 4PLNC 2NR6D 3KYAA 4PLJD 1OQOA 4HH9B 4MA8L 1F6AA 1S7RA 4P2OB 5JW3L 1GGBL 4P4KD 4Y8AA 4JZOB 4QRTA 1D5BB 5EBMB 3ZSSA 4ETQA 4A2LA 5D6DA 1MEXH 4JJHA 1DSFH 1H5BB 5E8NB 1I3RA 4PJ9A 2F54D 1NDGA 3RGVC 3C8DA 5CMAB 1TPXC 2AJUH 3WHXB 1NCBL 4XNUL 3TVMD 5D7LD 1EJOH 5I8OL 4OF8A 1YPZA 2AQ3A 3L3HA 3AB0C 1EGJA 3EFDL 5DEGA 3FFDA 5KVEH 2X4RA 2ITDA 5DVOA 43C9A 4NRXA 4XTRC 4YDLB 3LRSA 1QSEA 1UJTA 2IG2L 5EORH 5EB9A 5C7XH 4KMLB 2YA0A 1EHLH 2IF7A 1D9KC 5JDSA 1KGCD 5L6YH 5CEYA 5EU5A 1GIGH 4M62H 5IFAL 4Z7NF 5HHOB 3UTSB 1DBBL 4GRLC 1BIHA 4L8SB 4TSAH 4P59H 4F7PA 1DQQA 5I75B 5K59F 4PJDF 3PWUA 5I1LA 3FB5A 3A6BL 5ESAB 2ADJA 1J0JA 1C08A 4MJ2A 4PRHD 4D94A 1CBVL 4W4NA 5IJVB 2Z8SA 1NAMA 1A14H 5FGCB 4KUCD 3I2CL 4JR9H 1I4FB 5E5UB 1HWGB 4HIEA 3RI5F 1NBYB 2BVQA 3H7BB 1I8IA 5D1ZB 2FEDC 4NQUA 1XR8B 3IS0X 4G6AD 5TQ0H 1BVLA 2J3SA 4UV7H 1RUQH 1JPTH 2BOCA 1WC7A 5A1AA 4NO5A 1U8QB 5D5MB 2HT2C 1MRCL 1Y6KR 3AUVA 3NIDF 5HPOA 4FQJL 2V2WB 5DMKA 1XCTA 3T4YB 3TBWA 5LJYH 4HKXA 2HT4D 5HGBA 1IQDA 3QPXL 4GQPH 2SEBA 2DJ4A 5HHNB 2ESVE 3IKCB 4OLWH 1BGXH 3SE8H 5B39B 1KUMA 4BH7B 2L4OA 5IVZB 4XXCC 4NM4L 3MJ7B 5K9QG 3SCMD 2AJXL 5ICYB 4QRPE 5DK0A 1JI2A 2NW3A 1U8MB 1RIHH 5GRXG 4XZUB 1OLLA 2FHCA 1X44A 5IROC 3G5VA 1UEYA 3NH7H 4GLRH 4C55A 1T66C 4Y5YA 4JZJC 4WO4A 4PGBB 1F5WA 3X3GH 4EI5C 1JPSH 1LO4H 1JHTA 1Q0YL 1TJGL 2PW1B 5EZLB 4G6KH 4XB8A 1RIUL 1G7HB 4QKXB 1T89A 4YQXH 1AHWA 2P7TA 2XKSA 5F89B 3WXVL 3VFNA 5BZDA 4LLDA 5JW4R 4O4YL 5F9AC 4LCWE 1KTRL 4MXVF 3WLBA 2P43B 5CINH 3FQWA 3JUZA 5IVXE 1QKZL 3HPLA 3T2QA 3GIVA 4NUGL 2VKWA 3BPCA 5HPMA 1OWRM 5GGTL 4MXWH 1JRHH 1VPOH 3MLSL 1WICA 1T1XA 4OT1H 3V52L 4MQ7B 2JKXA 1G9EA 1L7IH 1T4KB 4KROC 1BZ7B 3ARPA 1GGIH 1U6AL 1VADB 2ZOLA 2W59A 2AJXH 1VCAA 2ZKHH 4NN6B 5FEBA 3C5SA 3N0PB 4I13B 4MSWA 4XCNB 2R4RH 1QYGH 4J6RL 1CXEA 4NKOB 3RUGF 3O3UN 3DGGB 5IGXL 2PXYD 3QWOA 4OUUA 2OJEA 3QXDA 5JQHC 3RJDA 5JHLL 4IOIA 5KOMC 5BCAA 5CP3A 5SX5K 3O4LE 3ZO0A 3O6KL 4LLQB 4G8IA 4HUXB 1I8LA 3DOSA 4P3WA 5GGRA 3C60B 4JHZA 4JG1L 3C2SA 1AIFB 5C3TA 1MCHA 3BKCL 2EDHA 2DICA 1AD9B 4O58L 3B2UD 1RIVL 1NEZB 4ODVL 2VLKB 3NPZB 5DEZA 4J7RA 1UB5B 4OV6F 4YXKL 3G6JF 4JRXB 2E27H 5FDYA 2CDFB 2Z93A 2J6EL 4Y1AB 3O9WC 4RFEA 2EXYC 4DZBA 4UIMA 1Q8MA 3MR9A 3MUZ1 3M17B 3OZ9L 4ZFFA 1YEKH 4GKNB 3B8SA 4Z95L 2AEPH 3QIWC 2OLDA 4U1LB 4ZODA 3PL6C 3HB3D 4G6MH 2R1YA 4XNMA 3LRGA 4K3HA 2IQAA 4QRSA 3MUHL 2H45A 3UEZA 5I18L 1QTYT 4PJBE 1KIQB 3C2AH 1DEEA 4I4WB 1Y0LA 4HWNA 1IQWH 1IRAY 2HJKB 4WU5A 1JGEB 4DWHA 3BZ4A 5ISZD 4IRJB 1NMAH 3EFDH 3MV9E 1Z5LA 2EDBA 4N8VG 3DV6A 2F5AL 1X4ZA 3JV5A 4K9EH 3GO1H 1BFSA 5C0CB 4F7MA 1TCRB 2Q6WA 3MQIA 3GSRA 1HYSC 1ZHKA 2YPKB 3TIDA 1FZMA 5LQBL 1VGKA 4NJ9L 2Y5TA 1U92A 4L4VE 1MWAA 4HUUA 1MFNA 1MEXL 1F97A 1H3XA 2EICA 5GS2H 3VGGA 4O2EB 1K3ZA 3ZKSD 5JW5A 4G6ML 4LHUG 5E0QA 3WS3A 3U30B 2AEPL 5L8LB 4MA8H 5JW3H 5IW1A 1YEKL 5HJ3A 4RZCA 5C0IB 3V6OA 4D0BB 2ZPKH 1BJ1J 1EXUB 2CLZB 3T8XA 2ZUXA 3WJJC 2BNUB 5FYKE 3RZCB 1N8ZA 3VFVA 3ROOA 3LKNA 2DWDA 3MRJB 1CXIA 1F4YL 2E27L 4P2YA 1ZEAH 5D71H 2VDPH 3P73B 1F2QA 3FAWA 2C1OB 3GMLA 3VG9B 3BEWA 4I77H 4PRBA 3QCUL 4YDKH 2VH5H 5MENE 4LSTL 2AJZA 5IK3A 3BQUB 4O02H 4PG2C 1AGDA 1U42A 2ICWA 1RJCA 4P2RB 5IMOA 1EAPA 4LMQI 3V4UL 5JPMB 1I7TB 1GOGA 3WE6B 2WUBL 1EZVY 4AJ0A 2F54A 3F5WB 4MB3A 1INDL 3PHQA 5F1IA 5GIRB 3TO4D 3O6FA 4NQSB 2GFBB 3H3PH 1LP9A 1WWAX 4B7IA 4AEIH 3PWUB 1BLNB 5I1LB 5DC4B 3KYOB 2YUVA 2CRYA 4G7VL 3X14B 3BVNA 3FOMA 3FT4A 1ZSDB 2R4RL 4CNIA 4BA8A 3CC5A 4JDZB 4P9HH 5DO2C 1J1PL 3EUUA 3PQYD 5FAAA 4AH2B 5C0FB 2J4WH 2CJUL 1A4JB 1B90A 3CDCA 4HKJB 5DFTA 1BZ9B 4YHNA 1FAIL 2XYCA 2D7QA 3MXWH 1LWRA 1VPOL 1U8LA 1SBBA 1DQJA 4KQ3H 3C5JA 5KANI 1U3ZA 2OBGA 1QKZH 3QFJA 4NQCA 5HGAB 1EA9C 2EYRB 4IRSA 5AZEH 5B4MC 2OR8A 3VE0A 1Z9MA 3MZTA 3QFJE 5IBLD 2AK4A 4JLRB 3MRGA 2OL3L 2P1YA 2E9IA 2V2XA 4JPIB 3NCJH 5JDJA 4XX1E 5LGKA 5IT2L 2DIBA 4Y1AE 1Q0XH 1IGJB 4PUBH 3G5YB 4OCMC 1UENA 4JKMA 4LSRL 5JOFA 1TXKA 1G7MB 3U0PA 5C07A 2ICWJ 1CZ8L 1PBYA 2W9EL 1N59A 3QEUB 2G2RB 1Q38A 1RUML 4FMKA 1ZVHA 5EN2B 3G5VB 4D8PA 3L5WB 4AYFA 2V5YA 5D2LF 1YEIH 1DLHA 4WO4B 3WBDA 3ARQA 1JNNL 2CR3A 4JRXD 4FFZL 4P5KA 3V95A 5D9SB 3SE8L 5A2JH 5EOCJ 4YDLC 2PO6B 4RMVA 4XCFH 5EZLA 1U95A 1Q9OB 1QD0A 2DM3A 4RGOL 5TDNB 4V1DB 4P2OD 2W0FA 5DWUL 3E8UH 3TCLB 3RL1A 3O3EB 4M9OA 3PNWB 4Q9QH 1C7TA 4ODTH 4L8SC 3MFGB 3D39E 2VLLA 4JZOA 4PJ9C 5IQ7L 2Z35A 1E4KC 2FIKB 2P8PB 3SGJC 4RA3A 1JPTL 5TQ0L 6CGTA 3MGOB 4GXUN 1J0YA 2BK8A 1KCRL 1DTUA 3T77A 1FNFA 2VABA 2GW5A 2HRPL 1IGTB 4XXDB 1DQDL 1MHCA 2PTTB 3NCMA 1BZ7A 4XNQB 1UXWB 5A3IC 4P2QB 5T3XD 1X5JA 1PYWB 4X6CF 4OFIA 4BQ8A 5HI5D 3NZHL 3OR7B 1DBJH 4E42B 3GSQA 5J12B 4KVCH 5C0JA 3P77B 1LO3L 4H20L 4Y2OA 5CJQL 4M00A 2BMKB 1CICA 2PXYA 4POZC 43CAB 4ZOBA 3NVQA 4X9HA 3F6LA 4M62L 4HK3J 2VDLH 4FOMA 5JHDA 4QRQA 4ZSOE 2P49B 2KUTA 4L4TA 2NY2C 4YX2H 4KC3B 5KZCD 4GSDL 5EORL 4WW1B 3Q5TA 1OAYH 5TE7L 4EDWH 2CKBA 1CS6A 4TUKH 4KZDL 1MIEH 1G7LB 5KVEL 2NY5H 4WFFD 4D3CH 4YHLH 3LKQB 4GH7B 3HFMH 4NQEB 3ZKXB 3CUPB 3STBA 4MB5A 1O7SA 1J0HA 4PJ5D 2W60B 1NLBH 5EH1A 1FPTL 2C7UA 1R3LA 1RMFH 4DEPB 2HVKB 3BQUD 5FDWA 3S88L 5IR1B 1XT5A 1S3KH 1HCFX 5HXMA 4ZFZA 1GGBH 3KHQA 4MXQD 1MIEL 1H3PH 1A9BA 2GTWB 2VXQH 1I7UB 3RPIB 4LSPH 4PJEE 4MJ5A 3VGBA 5BQ7B 4GUPA 2DIJA 3VXUB 1EO7A 1MVUA 3V5HB 5AG8A 3FJTA 5TGBA 1IL1A 4LIQE 2IBZX 3P9MB 3GJEA 4KVCL 4P2CG 5KVFH 3AC0A 3EOYG 5DQ9B 1MY5A 5DJAA 3V6ZA 3V6FB 5LGJA 4KUZL 1P9MA 3MOBL 3F7RA 1G9NC 4U6VH 1EVTC 4LCCA 4C56A 4P9HC 5D7LE 1TJIL 5GSVA 4JM4L 2CDEB 3VCLB 1SJEA 4BFGA 5D1XB 5ISZA 3CPLA 2DLEA 5AYQA 3DRTB 4UB0H 3C8KB 1AGEB 3QXUA 1NGZA 2R2EB 3QEHB 4XVSL 4JQXA 3ARYA 2V9RA 3RVWD 3MGTB 4IEFB 3MJGX 5I16B 1DL7H 5HYJB 3B8YA 5HD8C 1PKQA 4LVEA 4RIRB 5DWUH 3H2WA 3OJDA 1H8OA 1IMHC 3QFDB 2OQJA 1ADQL 1AO7D 1MPAH 3CSPA 4XCFL 5DS8A 2HN7A 3HE6D 3BZEA 4WFHE 4PR5B 3KYKL 3VXQB 3UYRL 3N06B 2JJSC 4WTZG 1MLBA 1OAUH 2DKMA 1YYMH 1PY9A 1RUMH 4M61B 4Z7UF 5H35A 4FQIL 1F4HA 4V1DD 5D7IB 3P11L 5FYLD 3UTZB 5HHPA 1SEQH 3GKZA 4K8RH 3JWDH 1FYTE 4S0TD 1D3CA 1L9MA 4K3JH 3U1SL 4HKBA 1Q72L 5ESVB 4JRYB 1ZLVK 4XPFH 3SKOA 3EYUH 2FEEI 4N0UB 4XVUC 2AXJA 4R4BA 4AH2A 3SE9H 2CD0A 5BS0A 4O51B 1H15B 2A74A 5T1LD 5E8DL 5IB5B 3QHFL 3R8BB 4D9QE 5F3HB 1FL5A 2ZG1A 5IEKB 1F13A 5C0RL 3WYRA 5CEZE 5IB1B 4L5FL 4WY7L 1MHEA 1Z6JT 1QQDB 2GJZB 5E6I