1E6OH

Crystal structure of fab13b5 against hiv-1 capsid protein p24
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
219
structure length
219
Chain Sequence
EVQLQQSGAELARPGASVKMSCKASGYTFTSYTMHWVKQRPGQGLEWIGYINPSSGYSNYNQKFKDKATLTADKSSSTAYMQLSSLTSEDSAVYYCSRPVVRLGYNFDYWGQGSTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN HEAVY CHAIN
publication title Mutual Conformational Adaptations in Antigen and Antibody Upon Complex Formation between an Fab and HIV-1 Capsid Protein P24
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 45
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2000-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1e6oH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1e6oH02
4N9OB 5H8DA 4WFGD 4TUKH 5JLZB 3GSRB 4NCC1 2NXYC 4P3CH 5HYJA 3VXSD 1VACA 5I8CB 1FIEA 1T2XA 5DR5L 5FUOL 2GQHA 1IKNA 1RI8A 1TDQA 2LTQB 3T2OA 4KMTH 4MA7L 5GS0C 5A40E 3ULUF 4X4YA 5IT2L 1FNFA 3IJHB 4HGMA 4K7PL 4XP4L 1EV2E 2ATKA 3S4SA 1G7LA 2GY5A 4LIQH 3TFKD 1XF2A 4C58B 4LGPB 1CBVL 3GSUB 1A9EA 4HUXB 1NFDA 1JYNA 3O6FB 3O3AB 4PJEF 4KRPD 4WWKC 1JFQH 3HFML 2ZG2A 5CJOL 3MCKA 3IF1B 3BP6A 3QUYD 3TNNB 4WU7A 2ENSA 3V5KA 3QIUA 3VXSB 5CJBA 1F3JB 3FT2A 3PNWA 1H9VA 3WEXA 1LK2B 1VERA 1V3KA 2CDFB 4JHZA 3BHBB 4NRYB 4DVRH 2KH2B 3QHFL 4QO1A 3KPNB 5HGHA 1XIWD 1NCDL 3VXNB 4LSUH 1X5JA 1MUJB 5C0DB 1M7IA 5ACZA 1KEML 2R23B 4XCYA 4EIZC 4G6MH 4U31A 1N64L 5H35B 3TJHD 3L3OB 1IZJA 2X4PB 5ILTH 4XCEB 5EZJA 3QXAB 1TVBA 2J3SA 43CAA 5F9DC 1QHOA 1SY6H 3HCVA 4LMQE 1PG7L 3D2UD 4UI2A 4Z8FL 4CVXA 1CGTA 1F58H 3CVIH 1QSFA 3ALWA 5GPRA 1EAPB 3SDCD 2W91A 4KKCC 3QCUL 2NR6C 3IRZA 1UB5A 2AEPH 4GH7B 4KRPB 2Q6WA 5F8QC 1IGIL 5I1KH 1NGPL 2X9WA 3CMOH 5JHLL 1UCBL 1J88A 3NGBC 3QUYB 3Q3GB 4BFBD 3LEXA 1QBLL 1W0WB 3VFPA 1P1ZA 5L8LB 4ZMAT 2M1KA 1R24A 1MJ7H 1N3NB 1JGDA 4U2ZA 1XIWB 3SCMA 1HYSC 4EDWH 4U05A 4X6CF 3QQ4A 4DKDC 4LRIA 1KENH 2NY5H 3G6DL 3T0ED 2APWA 4PJBB 4YC2C 2G75B 4Z7OF 3MOBL 3GK8H 5TE4H 1JIBA 4LLWB 5L2JA 4JZOA 1JGLH 3D2UB 2VN4A 1MIMH 3FQNB 2DQFA 4IJ3C 2PCPA 3QIWA 3SDCB 2KZ1B 3VRIA 3SPVB 4DTGL 3QWRD 1X5XA 4DKFH 2AJZB 1LO5B 2YN5A 1JJUA 3CSYA 4J4PD 1U8MA 5F93C 3GZKA 3HE6D 3UZVB 1FQ9C 2Z91B 3VXRA 5EU5A 1FZKB 1P7HL 5ADPH 3CMGA 5GRUL 2DQTH 3MLUL 3DX6A 1T7XA 3IFPA 2UYLB 5LGJA 2ZNWA 3PV7A 2OR9L 4EBQH 5EWIH 3NFNB 3MRPB 1MWAL 3OR6B 2J6EA 3T0EB 2JF1A 2MQ3A 4Y8DC 5GISL 1DN2A 1F42A 5IW1B 2GI7A 1BLNB 3BP7A 4P5MA 5KSUA 2ADIA 4PJ7A 5ITFB 3OKKA 3U46A 3MLTB 3ZDZF 3O2VL 4Z5RB 4LCWE 4NPYA 2OZ4H 5E6IA 1IQWL 4Z7VB 1CGUA 1NLBL 3GBLA 1OCWL 2JCCE 3MLXH 1V3MA 2HFEB 3MCLL 4TNVF 3DURA 1BEYH 3MRKB 5IB1B 1FYTD 1D5ZA 4GBXC 2FR4A 3HE6B 1AXTH 3AREC 4W4NA 4XVSL 3QNXB 4JHBA 1XGQB 5GS1A 3UC0L 2HLFD 3QG7H 4Z95L 1GAFH 1KPUB 1RAMA 3OKYA 1NGQL 5D2LB 3ZL4H 2XOTA 2EH8L 4D0DB 1TJGH 3DX9B 3UPRA 4W6XB 5EPMB 5SX4H 4JM4L 4XNZB 5GHWH 4YXLH 4POZD 4ZUWA 3HPJA 1JPGB 4I3RH 4W4OA 3H7BA 4JPKH 3O9WA 1I9JH 2HTLD 4YDLC 3D0VA 1CE6B 2CUIA 5EDXA 4O5LH 4WW2F 2Y7QB 5HVHB 4PGBA 1RJYB 4OQTL 3KPSD 3GJFA 5F71A 5J6GA 3KYNA 1RURL 2IBZX 4YR6B 4GBXD 3E8UL 5E94A 3KXFA 1FYTB 4EUPG 1MJUH 3CNKA 3QWQB 5EBWB 2P4AB 1VFBB 5IHZA 4MCYB 3REWB 4GQ9H 4X98B 4ZNEE 4V2CB 5EORH 1G7IB 4NM8H 4R90H 5DEGB 4DCQA 5IB2A 3VFGH 4U3CA 5DD5L 2P8LA 5F7UA 4CW1A 3MODL 4UTAL 1KT2A 4JDVB 3OJVC 4FQXA 1KTLB 3HAEG 4LFHG 2LQRA 1UYWH 2PO6A 5FF6B 3PP4H 4MJIE 4NN7B 1JNNL 3S34L 3S5LG 5IFJA 1HEZB 4P5KB 3AAZB 3OKOB 4OLUL 3ULUC 2MTPA 4X5LA 3EBAA 3DX8B 4XBEH 1A3LH 4H8WC 3KPSB 4IIQC 4FP8H 5C0JA 3KPLA 3H7LA 4GBXB 4TUJA 2YC1B 2FO1A 2YPKA 1U36A 4Z76A 5I1HH 3GSQB 4X6DF 1XCTA 3RFZC 4OZIA 3ZLQC 1LMKA 3BJ91 4J12A 4RGMB 5DHXB 4YAQA 1JHKH 2IH3A 4IRSD 1DLHA 2VZSA 1DVFC 1KG0B 3HZYB 3MQIA 4TOYH 4OCNC 1FIGH 2EDBA 1UM4L 4AT6A 2ARJQ 3A6CL 4WUUE 1BQHB 4UT7H 5DJAA 3I6LD 3HS0B 4JFHE 2Z93A 3NTCH 2DYPA 4XP1H 2IWGA 2DJUA 2I9LB 4OKVA 4ZDHB 2CLRB 3KR3L 1IQDA 5EUOB 3KJ6L 4GRWB 2P47B 1Q9WA 3EJZC 3O41B 5HD8D 1K6QH 3GI8L 4HUWA 2PR4L 3G04B 3I50H 3MCG1 3P9MA 3D69A 1S5IL 1OW0A 1N6UA 3ULUL 2XG4A 4S1DD 3MJ9L 4MB4A 5FYKD 1IT9H 1WBXB 3NBNA 3LKSA 2R0ZH 1H8NA 1TZHA 4ZXBA 4IRSB 3UAJC 5CGMA 2H8PB 4F7TB 3GM8A 4KK9C 4LOUC 4LVOC 4WTZG 3VGHA 1S9VB 2D0HA 3I75B 3H6JA 3DBXA 4ODWB 1REIA 2OP4H 4JVPA 3QDAA 1I8MA 5IMMA 1MNUL 3TESA 3ZKQD 3GGWA 3QSKB 2DMBA 2EH7H 3BEWB 1IGML 4MXWH 3LEYL 3DHJA 2X4QB 3C5JA 4RMRA 1NDGA 5J8OA 4O51A 3H0TB 5E03A 4NKDB 3WHXA 3E1F1 5DGRA 1SVZA 5J12C 4UT9L 5BOZG 1A7RL 4LHJB 4J8RA 5EH1A 3O2WH 5DGQA 2D9CA 1ZOXA 1CD1B 2FHCA 4QRPE 5DYOA 1LILA 5H94A 1HIML 4L4VE 4XNUH 1U8LA 3QDHA 5CZXD 3ULSB 1SM3H 3ZT7A 4XC3L 4UQ2B 2XWTA 4J3OC 4LLDA 5HHOA 4M6AA 5C6WH 1MFDL 4GFTB 2QEJA 4MNHA 5B8CA 4U0RB 5E2UH 4JANA 3B2UC 4FFYH 1QKZH 5DMJB 4NBZB 2OTUB 3TBYB 4XVJL 1MLBA 1QO3B 2FSEB 5D5MB 4S1SH 3LB6C 4XHJD 1H5BB 4JAMA 2XXCB 4YDIL 5L0QB 4BZYA 3AS0A 3ARGC 1SYVA 5B3NA 1NFKA 3IJYA 3U6RB 3F62A 4K7PX 5KANG 3MRDB 1E6JH 4M1GL 5JIKA 2IFFH 1ZHNB 2N56A 4K94L 3GNMH 5GGUA 4ONGH 1AY1L 4ZTOH 1FO0A 4J3VA 5KSVB 2IPUK 3F6IA 1WBYB 2X2YA 3NIGF 4OGYL 2VLLA 4YHIB 2FL5A 1VEPA 3FQWB 3H9ZA 5GS2H 2MQCA 4ODHH 1WLHA 3K8MA 5TF0A 4H1LA 4AK1A 5FYLE 1V5JA 4MJ4A 1CGVA 5MEQB 3QFDB 1E4JA 1WBZA 5IFAH 3HLAB 3GSNL 1RIHH 1AFVL 4HKJA 4YBLC 3VFUA 4IRZL 3VE0B 4CGTA 4JM2D 4WVRA 5LCVH 5CFHA 5IV2B 1IEHA 1PG7X 1MSPA 3QQ9D 5FM4A 2R2EA 5GJSH 1YUHA 4WW2C 1F00I 1L6XA 4KRLB 2D7OA 4R7NB 3FO1A 1HKFA 4FNLL 4PJXE 2O61B 2X4NA 1MHHA 3VMOA 3LIZL 2AK4D 5C09E 1EFXA 5TQ2H 2H41A 4P2QA 3EOBB 1FZOB 3MRHB 5INCA 4QF1A 2I25N 5ACLA 5K59F 3RX8A 3BGAA 2DRUA 1HXMB 4WI6A 3MA9L 4NWTL 2FJHB 7FABL 2XPGB 4NQDD 1B90A 1P5UA 3H3PL 1R3JB 3S37L 3QDGA 1BBJA 3DX7A 4WV1C 1J8HA 3DI2B 1LQSR 2DM2A 4JM2B 1AGFA 2DLTA 1RU9L 2CD0A 2AQ3A 2VDKL 2E9JA 3OKLB 3ARBA 4L4TE 4QRRD 3G5XB 3JXAA 2F15A 1FNGB 4U3XA 2HH0L 1ZTXL 4L9LA 2FIKA 3TIDB 3QT2A 2IQ9H 4KI1A 5B39B 1Z0MA 3SHSA 3OTTA 5EU6A 2IAMC 4OGAC 5DVLA 2AK4B 4IDJH 2A6JA 1JGEB 5EBLA 5FUZH 4XAWH 4NZUL 1J10A 4MS8D 4X7SH 5HGDA 1AE6H 1H3UA 1IEAA 1ZLVH 3N9GH 3EJYD 3W5NA 4JFXB 2HRLA 5CP7A 5FB8A 5CBEB 1K8IB 5E99L 4BKLA 4PRPA 4JLRB 2E9WA 2EKJA 4NQDB 2XTLA 1FCCA 2EDFA 4BFGA 1S3KH 1NL0H 3G6JF 1XCQA 4KQ3H 4JY4A 2A74B 3IDXH 3DRQB 3WD5H 1INQA 3VRLE 1JPSL 4XVUD 5I19H 4QRRB 2AEWA 5J9PB 3LKNB 2EDQA 1KIRB 4HUNB 4LEXH 4OZHF 2EE2A 5CIPH 4CJ0A 5GGSY 5C0AA 3JUZA 5E2VL 5I1AB 1ZLSL 3DARA 4NO5A 5DVKA 5HHNB 4HPOL 1KN2H 5BZWB 2Y07H 1J5OL 3P9LA 3V0VB 4Q6YA 4BFIA 4CVZB 4PJGE 2WWMC 2AS5M 1R3HB 3DHMA 3D0LB 3SGDI 5L88L 4FG6D 3O11A 2E27L 1IBGH 4OCXH 2NW2B 5DQJA 4XXCA 2C3VA 4JFYB 5F6HI 4Z7NE 3GMMB 2IFGA 4FQQB 4JZNB 4GOSA 4E9LA 2NY2D 4JO4H 4U1LA 5AZ2L 4HEME 5HYJD 3DLQR 5H2BB 5HDBE 4IMKC 3KLAB 5T5FH 2ITDA 1FDLH 2VDPL 4MMZC 4OSUL 5GRXG 4N1HB 5JW3L 4P5TC 3RVUD 3VXME 3ZYJA 1UZ6E 3E2HC 2K3TA 4MAYA 5KTEL 2EXYD 4J23A 1KJ2H 1V7NH 4MD5B 4M61A 5MHSE 4JKPH 5D2NE 1V3JA 5C6TL 2CGRH 1IGJB 4L1DA 2O5YL 1OF2A 2BRQA 2VUYA 4X6EB 4UV4L 4WFFE 2FGWL 3RWCA 5DJZA 1BF2A 5CWSA 1F4WH 3UP1A 3V4VL 3RPIA 2Z8WC 3R8QA 2VWEC 3RA7H 5CINL 5KBNC 5E9DA 4O4YH 4YUEH 2NY2B 3QISA 5HYJB 1ES0A 4DAGL 1UJ3C 1VACB 2LU4A 1WTGT 3M8OH 3IVKB 1FFNA 2GTWA 2YK1H 4BQ8A 3BKYL 2DQJH 5CD3A 3K8KA 5KSAA 3FQTA 1ORQA 5IB5A 1F4XH 4OQTA 2X40A 2YEZA 4YX2H 4LHUG 1W0VA 3Q6GH 2W9EH 3MV7E 4GG8B 1LWRA 4QXGL 4U1KB 4X4YB 5CZVH 1HHGA 1IGFH 4ZQKA 1TTFA 1MHCB 1VGEL 3BPLC 2UZIL 2ATKB 1RQ5A 3S4SB 1G7LB 3CXDH 3L1OH 4WJ5A 4X6FA 1QSFD 3T2NL 1XF2B 1T6WA 5BV7B 5LBSH 1A9EB 1NFDB 4NGHL 3ZYOA 2VXTH 1RFDH 5I1GL 3SDXB 4D9RD 3MCKB 3LH2L 3BP6B 3CSBA 4WU7B 3V5KB 4O58H 2YUZA 3FT2B 4PRNB 1A7OL 2OXHA 3PNWB 4U1NA 3X13A 4DEPC 3GUTA 5D1XA 3EOTL 4MNQA 4P2RA 3DECA 3WN5A 5I8KL 4ZOEA 1KCUH 5HGHB 3SCMD 3WLBA 4C57C 1TZGL 5LAXA 4S1QL 1M7IB 3T1WA 1QFWM 2IPTL 4Y2DC 1QEWA 1O5DT 1WAAF 5EZJB 1TVBB 4QY8A 43CAB 5LG1A 1AI1H 2AXHA 4CVXB 4G7YL 5F7MC 1QSFB 5A2IH 1YEJL 3QIWD 4OI8A 2E5EA 4LAQL 1UB5B 1EHNA 1EUTA 4KKBD 4ZOBA 2WQ8A 3RU8L 2I60L 2K7QA 2Q6WB 1K2DA 3IAGC 3GJFK 4WCYL 1KGCD 3FAXA 3ZSTA 4LQFL 4OM1H 4Y89A 1GSMA 4DJMA 3LEXB 4XNXL 3VFPB 2AI0H 3VXRD 1IKFL 3LZFL 5HYSG 1P1ZB 2O26U 2DTMH 3EW3B 2BVYA 1R24B 1OD7A 1WF5A 3UTTE 4YHYC 4Y5XA 3MGOA 1IE5A 4P3CL 3SCMB 2CLZA 3WS3A 2GKIA 3FCTA 1MHEA 3QQ4B 4PY8I 5TPWL 4OUOA 2EE9A 4Z7UF 5CUSH 1JYWA 1G9EA 3RQ3A 2KL6A 5L2JB 4JZOB 4KMTL 1CGSH 1S7RA 1PKOA 5IFHL 3DGCR 2DQFB 1R3LA 2PCPB 3PL6C 3QIWB 3VG0H 3VRIB 4UV7H 3DXAE 3D9AH 1F3DH 5E6ID 4HMCA 4UINH 3CSYB 1CLYH 4LIQL 2D31A 4Y4FC 4HS6A 1U8MB 3MUY1 3IDYC 2NY3C 3VXRB 1A0QH 4OLVH 4HXAH 1DVFA 3WYRA 4NC0B 1DBBL 1LP9F 2DJ4A 1JFQL 4TN9A 3DX6B 3MGAA 2X4SB 3IFPB 1DQTA 5LGJB 4KDWA 4I3GA 2NY5C 2EICA 4UOJA 2E7BA 4DVRL 3O9WD 2Y5TA 4LSUL 1JL8A 3BP7B 5KSUB 4K9EL 3FB7B 4XB8A 3OKMA 5IVXF 4PGEA 5DF0A 2ADIB 1N5YL 2P8PA 4PJ7B 4G6ML 5INDB 3U46B 4LRNH 1OGAA 2IANA 3BT2L 1D9KA 4Y4FD 5E6IB 5I2IA 1WTLA 3UJJH 1CQYA 3VGFA 1F58L 3CVIL 3DURB 2OR7A 1T1WA 1KJVA 3KXFD 4WI9A 5D93B 3C2AL 2FR4B 3EJJX 2B20A 2AEPL 4NO0A 1FL3B 4EOWH 1RUMH 2VXUL 3CMOL 5GS1B 5I1LA 5KG9A 1CK0H 4Y5YC 4C54A 1Z9SA 5I6XB 2VLME 3U9PH 1AQKH 4CBPA 3VXUE 2ESVA 1JPTH 3UPRB 2GFBA 4HC1H 1MJ7L 1U0QA 4FQXD 4AMKH 3NH7H 4MZ2A 1QSVA 3HPJB 4ZUWB 1R6VA 2H32H 1X5ZA 3H7BB 3O9WB 3ARVA 2AP2A 1I1CA 2LE9A 3D0VB 4H20H 4K3EH 5E6YA 4EDWL 2J8UF 1T1YA 2DF3A 2NY5L 3M07A 3F58L 5JQHC 1Q9OA 4K8RD 3RTQA 2AABH 4PGBB 2XNAA 3QFJE 5EBMA 4Y4FB 1S8DA 3GJFB 5FYJL 4EUPH 5J6GB 3GK8L 2XXMB 3KYNB 5TE4L 2AVGA 3MJ6A 2BHUA 4KQ4H 3U30C 4DOHE 1JGLL 4JQIH 2WNGA 3CIQA 3GMNA 3PXJA 5E94B 2APTA 3KXFB 1ZEAH 2OM5A 3S37X 3GSNA 2QADD 5IHZB 1J1XL 4GRLC 5MERA 1GH7A 2C3GA 2H26A 3UJIH 3LVEA 3CXHJ 3I3DA 1KB5A 4DCQB 5IB2B 2P8LB 5HVWA 4CW1B 2BFVH 5ADPL 1KT2B 4FQXB 2DQTL 3VI3E 2PXYA 2DIJA 5DFWH 1NFIA 1HHIA 5FB8B 1G7PA 1KYOJ 2DLIA 5IFJB 3IDIA 4EBQL 5EWIL 1TFHA 2DYPD 4P3DB 1EH9A 2H1PH 3C6SA 3BW9A 3PWLA 2CDGA 3PE9A 1J18A 4X4ME 1JUFA 1HQ4A 5C0JB 2P8MA 4LQ1A 3KPLB 1H3PH 4JFDA 5DEFA 4A2LA 5KS9E 4TUJB 1IC4H 1AR1C 3NA9H 2YPKB 2DL2A 3KAAA 4Z76B 3HI6H 5HI3C 1XCTB 3QEQA 1R3KA 4OZIB 2QADB 4Y5YB 3KPOA 4XPBL 4YAQB 3MLXL 2CSPA 4TNWK 3RAJH 1DLHB 4QXUH 4XX1G 5KOVC 1BEYL 1LDPH 1AXTL 3V6OE 2FEDD 4AT6B 1IM9A 3QG7L 1G9NH 1GAFL 5CGYD 5DJAB 4ZS6C 5ALCH 4PJAA 5BQ7A 5ANMA 3NCFB 4LF3A 3ZL4L 1KXVC 2Z93B 1TJGL 2DYPB 4BK4A 2W59A 1BJMA 5GHWL 4OKVB 4YXLL 2AJYH 1IQDB 3ARDC 1QVOA 1Q9WB 3QNYA 1J0IA 3KHOA 4WI7A 1ZA6A 1KLUB 3QIBC 4HUWB 5MENE 2BVEA 3D69B 3FB5A 3O8XA 4O5LL 5F6IC 4QCIA 1F4AA 1EAJA 1KIQA 4MB3A 1BWMA 1NBVH 2VSCA 3LKSB 1I3GH 4XP9H 4C4KT 3K2MC 5HHOD 1URLA 4WEMB 2C1PA 4P46C 3OPZH 3FAWA 4MZ3A 4PGDA 3DBXB 3VG9C 4GQ9L 2PYEA 1D5XA 1I8MB 5IMMB 1G7HA 4OM0H 3GGWB 5EORL 4EQ3A 4NM8L 4ZFOL 2YSSA 5TF1H 3VFGL 4A6YH 1OL0A 2KZWA 4DN4H 1V3LA 3C5JB 2AQ1A 1NDGB 1OP3H 1I8LC 4O51B 4WY7H 4HS3A 3WHXB 2CO6B 4RFEA 1UYWL 3PP4L 3UDWC 1A14H 4WFHD 3GHBH 1WT5C 4ZNCD 1MCEA 5DYOB 3PWPA 5H94B 5IESH 2R15A 4XBEL 1A3LL 1U3HA 1U8LB 4FP8L 3WNKA 1Q72H 2XWTB 4LLDB 5HHOB 4MNHB 5B8CB 3N50A 4JANB 5BVPH 4OI9A 4PGCA 4M7JH 2PNDA 4PJDF 2XWJA 1MLBB 1JHKL 2DIAA 4LLYA 1NMCC 2BXYA 3LPFA 3RPKA 1AC6A 1GCFA 4JAMB 5FO8A 4TOYL 3WNLA 4LEOA 4OIIH 4CKVX 3HZMA 1FIGL 1OTUD 1SYVB 2ICWJ 1KFAH 3IJYB 1KJ3H 4JFOA 5SWZE 3WO4B 4UT7L 7CGTA 5IR1A 5E95B 1F5WA 4RFOH 3QAZC 4ODVH 4U1HA 4FS0A 5AG8A 5GGUB 2E8ZA 3UTSE 4RCAA 4KRNA 3NTCL 4XP1L 1FO0B 3BDYH 1ADQH 3UBXA 5KSBF 3QHZH 4P49A 2FL5B 2IC2A 2L0DA 3NZ8A 4RMWA 5C9JA 1UEYA 1K6QL 1VENA 1EFXD 5IQ9A 4R8WL 4P2QD 3I50L 3PQYA 4TULH 4H1LB 4XI5C 3BMVA 3IDUA 5T3XD 1FBIH 3OKEA 1ZVYA 1BD2A 1YEKH 5T5NG 1IT9L 1EBAA 4UOW1 2R0ZL 5D7JC 1WBZB 2VXQH 4E0RA 1ETZA 3HUJE 4WI8A 5AG9A 4HS8H 2NCMA 1EGJL 3VFUB 1J8HD 1NCUA 1RV6X 5I9QB 3D48R 2FB4H 2EH7L 1YEIH 4JO1H 3GSOA 3ARBD 4MXWL 4F57H 4LGRB 2R2EB 1YUHB 3CSPA 4L9DA 4R9HA 4PP1C 3FO1B 3FKUS 2UVFA 2WANA 2X4NB 1MHHB 1T5XA 3O2WL 1EFXB 4PRBA 4P2QB 5INCB 4QF1B 3QUKB 2ZCLH 4XNUL 4QNPE 3QDMA 1SM3L 1JZ3A 5C0BA 2NY1D 1VFMA 4PRPD 2NXZC 5DI8A 5FYLH 5MP6H 1FORH 2WP3T 4FFYL 1BBJB 1A5FH 1QKZL 4RBPK 3DX7B 1J8HB 4CU7A 2HJFA 1AGFB 4K7FA 4S1SL 4Q9RH 1PJ9A 4AZ8A 3ARBB 2I26N 2VITA 1TTUA 2YRLA 4P59H 5JOEA 1YJDH 4NHUA 4L9LB 2FIKB 3VJ6B 4WW1B 2QHRH 5K9KA 1E6JL 2IFFL 4YPGB 5ECJE 5C0AD 3T0VA 1DBMH 1J1PL 3GNML 1ZLWH 3ISWA 3C60A 2A6JB 5EBLB 4ZTOL 4FA8A 4WDIA 1P7QA 5HGDB 4M9OA 5CP7B 1I7ZA 3PJSA 4ODHL 4XTRD 2NY1B 4PRPB 4BKLB 4JO3H 3NIFF 1N5AA 3TNMA 4CUCA 1FG9C 2Y1VA 2A0LD 4MAUH 2D9QB 3WFHA 3WFBH 5KVGH 4HK3J 4UBDC 1XCQB 2DM4A 1Q9KA 4J3WA 4PTTB 4JHAH 4JY4B 4G6FD 5IFAL 3FN3A 4LVNC 1INQB 1RD6A 2FEEL 2VTFA 1RIHL 4Q0XH 4K2UL 3ZKMC 5C08A 4HJJH 3B9DA 3QPQD 4MAYD 5DK3A 5CEZD 3VFVA 1Q1JH 1FGVH 5C0AB 1FN4A 1MLCA 4LCCC 1MAML 2GY7B 2HFFA 4NO5B 4WU5A 5BZDA 3CZFB 4N8VA 5GJSL 4M3KB 2DJSA 3BJLA 3P9LB 3RWJA 4BFIB 3LRHA 1M05A 2JKXA 3DETD 3E6FA 3IKCB 4G43A 2ZUYA 2FECI 3O11B 5TQ2L 3ZT6A 1MCFA 5DQJB 3T4YA 2VO5A 2C3VB 4ERSL 2V2XA 4YE4L 3IKKA 4KTYA 2K9UA 3WL9A 3V6BR 3OB0H 1EX0A 1QQDA 2X1OA 4X7CC 2ARJA 4WFGE 2EZ0C 4U1LB 4G6FB 5MI0C 4KDTA 5IQ7H 3VXSE 4XNQA 2ITDB 5IEKA 5KSAD 1JNLH 4G6AC 1ZAGA 5KVEH 1T0PB 3QA3B 4R2GC 4MAYB 4HIEA 4QLRA 1LO4L 4TTDD 1YNLL 2SEBA 4KTDH 2YA1A 3U36A 2XZAH 4M61B 3O2DH 3T4AA 3PDOA 2Y72A 5EU7E 2J8OA 2YRZA 4BQ6A 1IC7L 4XMLH 2VE6A 4UIKH 2IQ9L 4AENA 4PB0H 1OF2B 3QDJA 4MQTB 3RWCB 4HQQH 1FAKT 4IDJL 5DJZB 5FUZL 4IRJC 4X7SL 1AE6L 2XZCH 4OCSH 1HH6A 2RAMA 3N9GL 3NN8A 2EZ0D 3RPIB 4EI5C 3IFLH 4UQ3A 1LO2H 1ES0B 1C5DA 4JY6A 2XT1B 5GGVY 2GTWB 3L6FA 5D1XD 5CD3B 4OF3A 1S3KL 1DQDH 2OYPA 1OAYH 1NL0L 3FQTB 4MNQD 1ORQB 4P2RD 5KSAB 1SEQH 5IB5B 1JNJA 4KQ3L 4HZLA 4MQ7A 2YEZB 4QHNA 3IDXL 3WD5L 2E9BA 3HRZA 1MI5A 2HMID 2BSRA 3KLHC 5I19L 4JKWA 1INEH 1HHGB 1TNMA 1HQRA 4ZQKB 4PJBE 3SGKC 3K2UL 1JTPA 1F90H 4M7LH 4GAJH 2EIZA 4WJ5B 3INUH 4X6FB 3VI4F 1JWMA 5L9DH 2F9BT 1KN2L 4LAJH 4WO4A 2Y07L 2F74A 3O4LE 3C8KA 5E8PA 1ZXQA 2OSLA 4DKEH 4ZAKA 5J06A 2R4RL 12E8L 1MCQA 1I9RH 1IBGL 4OCXL 2D7TH 3SGJA 5DWUH 5IF0A 1A7PH 5HI4C 4YQXH 3X13B 2MSPA 2B7DT 3FO2A 4ZO8A 5JPNA 3GUTB 5D1XB 3JSSA 4Y5VC 4MNQB 4P2RB 4JKKA 3OAZH 3WN5B 3GMLA 2XYCA 3JWOH 3WLBB 3NCJL 2APBA 4PJHA 5DMGC 3N85H 4KGLA 1ZHBA 5LAXB 2BERA 4WEBL 2VLJA 2BMKA 5T5FL 1FDLL 3LN5A 2BSSA 5EOCH 1QEWB 1LHZA 3T0EE 5FAAA 1QA9A 3VH8G 2P44B 3ARRA 5FXCH 1KJ2L 1JYXA 1OAKL 4AEHL 4ONFH 1D5IH 3QUZA 5DZLA 3B5GA 4JKPL 3WS6A 2CGRL 3CX2A 4QWWD 2VDLL 3VRJA 2BOCA 2ED9A 3MRIA 4Z7VE 1K2DB 3QXWA 1CI5A 5J3HD 2KQMA 5T1KA 1F4WL 1G7MA 4Y5XB 1D6VH 1P4LB 5DMGD 1O7VA 4O4YL 4YUEL 3MGOB 4GS7C 4PY7A 2CLZB 3WS3B 1Z5LA 4DVBA 3M8OL 3FCTB 1MHEB 2YMXH 5D2LE 2DQJL 3K4AA 3OX8A 5I75B 2F8VA 2XQYK 2UZXB 5IROC 3MUGA 4U1SA 1GGYA 4YX2L 1PEWA 1S7RB 2W9EL 4PRHA 2NY7H 1R3LB 3I9GH 1U6AH 3K7UA 3U4EB 3NACL 2ICWA 1OGAD 2IAND 1D9KD 1A21A 4WEUD 4UNUA 1U8OB 2HTKC 3CXDL 2D31B 3LRGA 4HS6B 4YHZH 3GIZL 3B9VA 5LBSL 4MHHG 1FYTE 4TNVK 4HAGA 4L1HA 4NO0D 2VXTL 1RFDL 1DFBH 1FV1B 4U1GB 4WI3A 4N8PA 2GHWB 5ISZA 4XP5H 3GMPA 2ESVD 4HULB 5F44A 3C87A 1ZANH 3PGDA 5F7EH 1TZIA 1AGEA 4M8QA 5K93A 1NBYA 1KCUL 1WAAA 2WWKO 2Y5TB 1FYHB 5IMKA 4PGEB 5JMRA 3OKMB 1D6EA 5EULV 1AIFA 1J0ZA 5JIHA 3THMH 3RTQD 2BNQA 3TPUA 1Y18A 4CMMA 1OGAB 2IANB 1D9KB 5I2IB 1AI1L 1XH3A 3KPSE 1RZ7H 3PHSA 3Q5TA 1A3RL 4BQBA 1T1WB 1T2QH 4EN3C 1RUKH 3CVHH 3OKNB 2YWZA 3OR7A 2EXWD 5CAYB 1YDPB 1EVUA 1YECH 4NO0B 4F7PA 3QULB 1SJEA 5KG9B 5I1LB 2FX8L 2CK0L 2MQ0A 3MLWH 4APQC 4OM1L 1X5KA 2VMFA 2AI0L 3BGFB 4IMLA 5IMOA 5IUSA 5D1QC 2BZDA 2ESVB 2GFBB 3SKMA 4JQVA 4MJ5A 2PXYD 4Z7UA 4AL8H 5FIEA 2YKLH 3P30H 2VN7A 4BFEA 1CICA 1T1YB 1YPZE 1Q9OB 1PY9A 3RTQB 2C3WA 3BIAX 2XNAB 3PIQA 5EBMB 4M48L 4URTB 1S8DB 1ORSA 4JFDD 2A38A 4AM0B 1WEJH 5EUOE 4GRWE 1CGSL 3RGVA 1SJHA 4P0DA 3TBSA 5HBBA 3DO7A 3QEQD 4NRZA 2ENYA 2FO4A 1PDKA 5DEZA 3D9AL 4AG4L 1EGJA 4UINL 5D72H 5MERB 2H26B 1F45A 3VFRA 5TGBA 3ABZA 4CVUA 1KB5B 4OZFG 5HHXH 1A0QL 4OLVL 4HXAL 3D39A 2OI9B 1ZA3A 3WCYA 2R2CA 2V5TA 2PXYB 1K85A 3RBSA 1NFIB 1HHIB 3EFDH 1G7PB 4OLZH 5I74B 1D5MA 3IDIB 1A22B 4FTVA 4JFZL 3L3KA 3I6LE 1KN4H 1NC4A 3WJLA 3LQAH 3C6SB 1NEZA 3BW9B 3PWLB 1FNEA 2CDGB 1JUFB 1HQ4B 3GJEA 2P8MB 1GGIH 4JFDB 1DQQA 3A0OA 3BP5B 4MLSA 5DEFB 5I30L 1CFVL 3UZEA 3ZE1F 1IAOB 3S35H 1QTYT 1SVCP 3O8XD 3QEQB 2QV2A 1R3KB 1BFSA 4R6UA 4LRNL 2VISA 4PYGA 1MFCH 1PLGH 1T2JA 3KPOB 3UJJL 1JGUL 1OP5H 3T0XA 3RZCC 2A9NH 2AJVL 2VDNH 3GBML 4F15C 2AK1H 4KUCF 5TE7L 5FFLA 1QFWI 1YY9C 1A7NL 4YHNA 3RIAF 3SY0A 1WQVT 4MA8H 4EOWL 3N1FC 1RUML 5J0BA 3WHE1 3JV4A 4HH8A 3V7AG 5D5ME 1KXQE 5DQ9A 2FBJH 1N6VA 1LO0H 2GITA 4PJAB 4NQSA 3H9HA 5BQ7B 5C0EA 1C5BL 5ANMB 1AQKL 2E7LC 5DUPH 4LF3B 2CRYA 4HC1L 2GEEA 4LDOB 5FGSA 4AMKL 2DKUA 3VGAC 2B2XH 1QVOB 4XPFH 3QNYB 1S7VB 1ZA6B 4H20L 4K3EL 3RWHA 5F72S 3FB5B 2M2DA 3O8XB 3PWPD 2QJDA 4PJXF 2H2SD 2WIIA 4QCIB 2AABL 1KIQB 3WXVH 5KVFH 2V5YA 1Q0YH 3DSNA 4P9MH 4KQ4L 2VDOL 2DL9A 1EPFA 4POUB 4JQIL 2C1PB 1I8KA 1BFTA 1ZEAL 3MLRH 5DJYA 4PGDB 1MREH 4RISH 1G9NC 2OL3L 1G7HB 1PZ5A 2VKXA 2AJSL 3UJIL 2E3VA 2YSSB 1T83C 2XN9A 2DLFH 4HJGA 1CT8A 2HRPH 4Z6AT 2BFVL 2P45B 3FHQA 4HS3B 4NHCH 3TT3H 4RFEB 5C3LD 3C6LC 1RK0A 1F2QA 1F13A 2EECA 2CMRL 2EKSA 1XEDA 5JQ6H 3PHOB 2GJZA 3PWPB 5DSCA 2H1PL 3MPCA 1NUNB 1H3PL 3V4UH 5HHPA 2EE6A 1U93B 3B4NA 1IC4L 3NA9L 3PQYD 2WV3A 3BWAA 3HI6L 4G9DA 2AEIT 2R0LH 4PGCB 1BD2D 1ZKAA 2XWJB 3MV01 2BDNH 3O45B 4LLYB 2BNRA 3R1GH 2FX7H 3RAJL 4QXUL 2YD3A 5T1DH 1LDPL 3UPAA 1YMHA 5FO8B 4LEOB 3HZMB 3IGAA 4JFOB 4O9HL 3VRLF 1ZGLP 4ETQA 5IR1B 4HBCL 1G9NL 4UIMA 4PLNC 5I16B 1FJ1A 4U1HB 5ALCL 2QQKH 1QPPA 1HHHA 5EOTA 2Y06L 3MBXL 5CEXA 5CSZA 3UBXB 3ALXA 5AEAA 2AJYL 1KLFA 3TVMC 1CXEA 5IGXL 3NZ8B 5IVNA 5JIPA 3AMLA 5IQ9B 3P0GB 1AHWC 3PQYB 4PJGF 4HK3N 1S78D 3EYVA 3OKEB 1BD2B 2WW8A 3DMMA 1NBVL 3QDMD 1CDBA 1I3GL 1KTRL 2ADJA 4XP9L 5C0BD 3ULVE 5E56A 4E0RB 1ETZB 3TA3A 3WFEH 3IXTA 2D4DA 3NMEA 1A4JA 4NQDE 3OPZL 5JO5A 3QJHA 2GW5A 4L3EA 4G80A 1KTDA 2CIKB 3CCHA 4U1MA 5HDBF 5DUMH 4OM0L 1T89A 1OLLA 2Y6SC 3MTRA 4M1CC 5TF1L 5GRJH 3GSOB 4A6YL 5JZ7D 1YNTA 1FVDA 3QI9A 4DN4L 2XQYG 1UZ6F 4QRRE 2P5EA 1N6QH 4TSBH 4WY7L 1VFUA 1VSCA 2YPLA 2A6IB 1A14L 3GHBL 4HKXA 1T5XB 3CDGA 3CXHK 3C60D 4HIHA 4PRBB 1CFSA 4KJPC 1P7QD 4LPWA 4XBPA 2OCFD 1Z9MA 1OWRM 1QLFA 3W11D 1KACB 1MF2H 5D96C 3QDMB 1A6TA 1Q72L 1DE4A 4I77H 5C0BB 1I75A 1CF8H 5DI8B 5DD1H 1KYOK 4LCIH 4U6YA 4M7JL 2HYMA 1MCRA 1T80A 1JRHH 2BVQA 2HT2C 1TITA 3JUYA 4R0LA 4X5WA 5GRWA 3TIEB 3ESUF 3HC4H 3UMTA 3PWVA 4K7FB 4HLZH 1TVHA 4MXQD 1G1YA 1CQKA 1PVHA 1X5IA 2VITB 3C09B 2VZ3A 1BMGA 4HGWA 4NHUB 1KFAL 4G8GA 4H25A 5C08D 2WUCH 1KJ3L 5K9KB 1AR2A 4HWBA 4XPAH 4Q97A 3GHEH 1IGYA 3VFOA 4RFOL 2HFGL 4ODVL 3SGKA 3FONA 4LU5H 4X83A 3C60B 4PG2C 3EYQD 5TFSH 1A6WH 2H6PA 4ACPA 4WDIB 1P7QB 3QHTC 3BDYL 1CXKA 4R26L 3QHZL 4H5SA 4GLRI 4QRSA 4NRXA 3KJ4C 1EZVX 1I7ZB 2LAAA 3PJSB 4GKSA 5CCKL 1BHGA 4Y4HC 1S7QA 3CLEH 1N5AB 1X4YA 3RL1A 3TNMB 1A02N 4UUJB 1FBIL 2BY1A 3VXPA 1WIOA 3WFHB 1XZ0A 1YEKL 3MNVA 1CL7H 1Q9KB 5JORA 2VXQL 4N90D 3IFNH 5HYJE 3JVGC 1YJDC 3E6HB 3L5HA 4PD4J 3MRQA 1OSZA 4Q58C 2X89D 2CUMA 4NCDA 5C08B 1HHKA 4C83A 5KVDH 2FB4L 3M17A 5D9SA 3VFVB 2ZUSA 1YEIL 1WWAX 2YXFA 1FN4B 3MBEC 1MLCB 4F2MA 8CGTA 4GKZA 2HFFB 4F57L 4WU5B 5BZDB 1UZ8B 4N8VB 4RIRA 3RY6A 4LPXA 4F80A 4P23C 3RWJB 4FMFA 5B22A 4WRLA 4MX7A 4PJ9C 3QDJD 4G43B 1QZ1A 1MFBH 5J11C 2ADGA 2KKQA 3T4YB 1JE6A 1H15A 4LLVA 4B5EA 1NFDE 2V2XB 5GRVL 3SBWA 2ZCLL 2NZ9C 2X4OA 4MCZA 4H0IA 3WL9B 4RWYL 4EI6A 1QQDB 5I1DA 2ARJB 2W0FA 2WBKA 5FYLL 4KUZH 4XNQB 4YBQC 3AU1A 1K5NB 4KTEH 5IEKB 4BSVA 3TZVC 1GHFH 4PRIA 1BVZA 3VD9A 1O0VA 4TTGA 3UTZA 2ZOLA 2XA8L 5FYJD 4P9HH 5A2KH 3K0WA 1EEYA 4Q9RL 5GGTH 1MI5D 2SEBB 4Y8AA 3U36B 3T4AB 3PDOB 5C09D 5I1EH 2OTWA 4P59L 1YJDL 5JOFA 1PYWB 4EVNA 2VE6B 3RIFF 2QHRL 3ROOA 1EVTC 1T03H 3H2WA 4AENB 1TLKA 3QDJB 1DBML 1KELL 4RGOH 1I1AC 4XMKH 4LVEA 2G5BB 1QSFE 4WO4D 1DL7L 2Q3ZA 4N5ED 1HH6B 1N0XH 3NN8B 2QSQA 1X5YA 2ICEA 1R5IA 5IBUG 1BOGA 2P49B 4ZAKD 1I7TA 4V1DA 2FCBA 1ACYH 4JFQA 4HW6A 1TTGA 4D9RE 1C5DB 1E4WH 4JO3L 4JY6B 2QQQA 2ZG3A 5BMFH 3X3FH 3LMJH 5FUCE 5LXGH 2EYTA 3M1BA 4MAUL 4UMGA 3WFBL 5KVGL 3JTSA 4ENED 2V6HA 1RSFA 5FKAA 4HZLB 4QHNB 2EYRA 3GKZA 3P9WB 3HRZB 1MI5B 3KPTA 4G8EA 2VZOA 4Q0XL 5SX4I 5C09B 5K9QI 3V6ZA 1HQRB 1JPFA 4OCWH 1NAKH 1I1AD 4HJJL 3EOAA 2PW2A 1Q1JL 1FGVL 4KKLC 2EIZB 3B9KA 5E08H 1P4IH 3MC0A 1GRWA 2R69H 4KY1L 3WNNA 1UKSA 1KF9B 3QUZD 4WO4B 3QG6B 2IADA 2BY2A 2F74B 3C8KB 2OSLB 1KBGL 3EYOA 3EDFA 4ZAKB 4YDKL 4M93C 4F9LC 3HNTL 4BSWA 3BESR 1KGCE 2ICWI 3FMGH 5IF0B 5T1KD 1EERB 1CGWA 3VXRE 3FO2B 3FRPG 3U7YL 1P84J 5JPNB 1J7VR 1NCCL 5D1QA 2PKDA 3QEUA 1YEDA 3GMLB 3MRJA 4BH7A 3QQNA 1C5CH 4PJHB 1W72B 2X1QA 4HJ0D 5IQ7L 1BVKA 2BMKB 3GFUA 3LEVH 1PG7W 3LN5B 1DSFH 1HNGA 4XCCH 2BSSB 1MEXH 1JNLL 1QA9B 1BOYA 1I1AB 2B1HH 5HHMD 3KPPA 4I9WD 4HG4J 6CGTA 3BH9B 5D2NC 4PRHD 5HGBA 4KTDL 1XGUA 3O2DL 2DN7A 4PJ7E 3QUZB 4LKXA 1YNKL 4XMLL 4UIKL 5L8JB 3VRJB 2BOCB 3MRIB 3QEGH 4JG1H 4PB0L 4HQQL 4NFDA 5T1KB 1CFQA 2B5IB 2XZCL 5IKCA 1G7MB 1NUGA 3FB8A 3IFLL 3ZTNH 3JWOC 3GI9H 1YC8A 1UEMA 3ARYA 1JZ8A 1U3JA 4JY5L 4PY7B 1OTSC 2N7BA 4DVBB 1VFOA 4NUJA 3RHWF 1M6OA 4FFVC 3BYTA 3B6SA 1DQDL 1OAYL 4DUXA 3OX8B 4R7DA 3LD8B 3MUGB 4U1SB 4EUPA 2K7PA 5HHMB 4PRHB 4YNYA 2LU7A 3MXWH 5AZEH 1O7SA 3UYRL 2EDHA 4Z0BH 3GO1H 2BNQD 5KS9F 2ICWB 5C2BL 1SHMA 2DTSA 4KK6C 1W8OA 1F90L 2W0KA 2MHAB 1JGVH 1QBBA 2OL3A 3INUL 4GAJL 5A16B 2AV7A 1HI6A 5L9DL 3LS4H 3B5TA 3KXFE 5CJQH 1FG2A 3HAEA 3S5LA 1YMMA 3RUGB 4DKEL 1E28A 4M7ZB 4KI5F 3MV11 4NFBA 1A6VH 5IBLC 1I9RL 5DWUL 1YEEH 3GMPB 1A7PL 5EO1A 1UT9A 3MJ7A 3MV7D 1OOAA 3PGDB 1TPXC 1TZIB 3VGBA 1AGEB 4M8QB 2O5XH 1NBYB 5FHAH 3V9FA 3JWOL 1RUPH 3RVWD 2F5AH 5IMKB 3N85L 3RWGA 1T3FA 1D6EB 3U7AA 1CLOH 1CICD 4K3DL 1AIFB 1AO7A 4YIQB 5EOCL 5AUMA 1AJ7H 2BNQB 1CDIA 5GSVA 1QRNA 3TPUB 5D1ZA 3S3SA 1Y18B 4CMMB 1OLZA 3F7PC 2Z4QA 1XH3B 2A1WH 1B4RA 2R1XB 3U0WH 2JJWA 3MO1A 1D5IL 3RGVD 1U8KA 3MROA 4X7EC 5ESVA 4OZIE 4F7PB 1GOHA 1RUAH 1SJEB 3F7VA 1WFNA 2R2BA 3VWKC 5I71B 3WDJA 1RJZA 4I2XA 1TCMA 4IMLB 1FL6A 3MREA 3FT3A 3D39D 2Y4SA 3MV7B 3SKMB 2F53A 1G84A 3EFFA 4MJ5B 4BELD 1D6VL 2EC9T 4NZTH 4Z7UB 2YZ8A 3OJ2C 4GAGH 1AC0A 5C2UB 4FTVD 3WNOA 2YMXL 4XB7A 1NC4D 1CICB 5H37H 5C0CA 2DQHH 3C8DA 5EFIA 3PIQB 4WTZA 1MIEH 1ORSB 1EK3A 4RDQG 4U6VH 2NY7L 3MRGA 3RGVB 3PABA 1SJHB 5TH2A 3TBSB 5KW9H 3S9DB 2BJMH 2BXZA 3DO7B 3I9GL 4NRZB 1U6AL 2FO4B 5LJYH 1IRAY 4N1EA 2HT3C 1FE8H 5EOCJ 4FQHA 3BRDA 1LE5A 3RY4A 3L5JA 3VFRB 3TN0C 2UWEA 4YHZL 5JR1L 2XZQL 1TPXB 3O3EA 3D39B 1U92A 5L7XL 1JTOA 5EC2A 1ZA3B 5SWQA 1DFBL 2WBJA 1T6VN 2YBRA 4P4KA 4U1JA 5KJRL 2FEEI 2P48B 1P6FA 1D5MB 1WISA 4XP5L 4FTVB 3L3KB 5TDPA 2DQDH 5JXEC 3L7EA 1NC4B 1F8TH 2FDBP 1ZANL 5F7EL 1FNEB 5LGHL 3DWTA 2DWDB 1NLDH 3BZEA 3DXAD 3GJEB 3OF6A 4RMSA 1DQQB 3B3IA 4I4WA 4LDEB 1BM3H 4YWGH 3AM8C 1EEZA 1KJMA 1PEZA 3LCYA 2AAVA 2J5LB 1C16A 2VISB 3CJJA 2R1WA 3TN0D 4GRWH 4NWUH 1ZLVK 1RZ7L 2EE3A 3CSGA 3WIFA 2K1MA 2QQNH 1T2QL 4NNYA 5HHOE 4KVCH 1RUKL 1A64A 3CVHL 4YHNB 3SY0B 1RZIA 1YECL 4KAQL 3ARFC 1CXLA 2XFXB 2FGZA 3JV4B 3MLWL 5DQ9B 3G08A 5DQDL 5ETUA 1ZGLM 3OZ9L 4JDZA 3EO9L 1MCHA 2XN9D 3H9HB 3LQAC 4FQIH 4NQSB 4XPTH 5DHYB 5J1TC 2FIRT 4P3WA 4MWFA 3QUMA 3VWJC 1KCSH 4AL8L 1UWEH 3DXAB 4DGVH 2RB8A 4M8VA 1EBPA 2YKLL 3P30L 2P7TA 1I85C 4WFHE 3RWHB 4H8WH 2Q20A 3T8XA 2WIIB 4C55A 4YZFE 2EDNA 4RMUA 4UZGA 1I3RA 3WLWC 3TN0B 1F97A 2Q76A 1WEJL 4ETYA 1RZJH 4OFDA 1M1SA 5C0ND 5DVNA 5FEBA 4XMPL 5HI5D 2IQAA 1I8KB 1EIBA 1HKLH 4CDGC 2APXA 4QNPF 5DJYB 3CH1A 5FDWA 4NN6C 3BKJH 4XWOC 5FYKH 2BNRD 1PZ5B 2B39A 2NY4D 4P57A 4L8DA 3RNQA 2KPNA 2XN9B 2YA0A 3NIDE 5HHXL 4HJGB 1MCJA 1CT8B 1CLCA 2BSED 4J2XA 3O3UN 1F3RB 2VZTA 1RK0B 3EFDL 4O02H 3QUXA 4OLZL 4PLKC 2GIYA 3DNKA 2EKSB 1KN4L 2NX5A 4JFEA 1RVFH 4L5FH 2GJZB 3LQAL 1CTNA 5DSCB 5JW5A 2DOCA 4PG2A 2NMSA 2X41A 2QQLH 1GGIL 4MLIA 5HHPB 4MMXC 4WFED 1QLEH 3BSZH 4XPHL 2F58L 3S35L 3BWAB 4G9DB 4P2QE 2EO1A 4ZFFA 5IOPA 5IM7A 1MFCL 3RVTC 3WIHL 1PLGL 2RIKA 3DMMD 5T3XE 4LSDA 3K1KC 2A9NL 2VDNL 2BNRB 3Q5YA 1NCNA 2AK1L 3V6OC 1BVLA 2NY4B 3TA3D 5GGQH 5E5MA 1YMHB 4B0MM 3QDGE 3W5MA 3L9RB 3IGAB 4MA8L 3KPRA 1NAMA 1J8HE 1WFTA 1QBAA 4J1UA 1KXTB 3SQBA 1YEGH 3BISA 4ETQB 4UIMB 3BD3A 2FBJL 2JJSC 1DEEB 1U8IA 4HF5H 3TT1H 3GBNH 3QI9D 1DANT 3C5ZA 1HHHB 2ZCKL 5EOTB 4KK8D 5E4EC 4JQXC 1T4KA 2P5ED 5CEXB 3ZE2E 1NCBH 3I2CL 2YPLD 1PKQA 2H2PC 2I9TA 3JV6A 3D1MC 4XPFL 4BQ9A 5EU6E 3SDDA 1H8SA 2C7UB 5ITBH 4OJFH 3EYVB 3BPOB 1UH2A 5FCUH 3WXVL 1XR8A 1NGXA 1FLRH 3DMMB 2IPKA 1QD0A 1J05A 1XGRA 4PRPE 1RZFH 3TA3B 3IXTB 4FFZH 2W60A 1A4JB 3MLRL 5JO5B 3T09A 5IK3A 3QJHB 1MREL 3HE7C 4RISL 4U1MB 4G80B 3OMZA 1PQZA 2AXJA 5GZND 3WJJA 1YNTB 5J57B 1FVDB 3QI9B 2HRPL 1J1OH 2P5EB 32C2A 3MLZH 2PUQT 4G8GD 1YEHH 3SGEH 4DW2L 4PLJC 1MCWW 4NN5B 4Y19A 3V79C 4NHCL 2YPLB 1L7IH 1P9MC 5B4MC 4HKXB 4HUMB 4RSVA 1HYRC 3CDGB 5C0AE 2V9TA 4JR9H 1A47A 4HIHB 5IWLC 1CFSB 4XBPB 3NA4A 1A6TB 1DE4B 3VW3L 3VFTA 1CDCA 3CFJA 4KVNL 1ZHLA 3NAAL 1DJSA 4JGMA 4B7IA 2R0LL 4GAFB 2D7NA 2BC4A 4U6YB 1HOCA 2BVQB 1B0GA 4R0LB 2VB5A 3LV3A 5FA3A 1RZ8A 4X5WB 4NC2B 2BDNL 3R1GL 2FX7L 3PWVB 3DSFH 1MOEA 3SE3A 3TO4A 5KVMC 4BUGA 1FC2D 1KCRH 1MCDA 1TVHB 1JF5A 4FMKA 1DR9A 3BP4A 4QHMA 4HGWB 4G8GB 4H25B 2PN5A 2V9RA 3BZFA 3TJEH 3VFOB 1IGYB 4QYOA 4M6NH 3SKJL 4AEIH 5CEZE 3FONB 5CD5C 3M45A 2Z92A 2H6PB 1VKXA 5CSBA 1IGTB 3RKPA 1RPQA 5I17B 4H5SB 4QRSB 4NRXB 1T7VA 2Y23A 4U49A 3DYPA 1S7QB 4NJ9H 4AIOA 3RL1B 1NBZA 1SMOA 3VXPB 4DFHA 4UDTA 2GJ6A 4LHUA 4XC1H 3MNVB 3SDAA 5DMKA 5E9DE 4C4KO 3P0YH 5JORB 1NGWA 2D3VA 1IFHH 3GRWH 3WFEL 1K4CA 3MRQB 4PUBH 4XVTL 3V5DA 1B0RA 3KS0J 2DIBA 4PRID 3OSKA 1HHKB 4C83B 5DUML 3DTXA 2PETA 3IJSA 3M17B 5GRJL 4F2MB 1J0HA 4GKZB 1T66C 3VGEA 1I7RA 4RFNC 5FYJU 4HCRA 1B6DA 2UUDH 2VDRL 1N6QL 4RIRB 4TSBL 4NUGH 2VABA 4R4FH 4MX7B 3CFKA 43C9A 1EO7A 1G7QA 4I18A 4P2OA 3BKCH 3MV9A 3REVA 2ADGB 2F19H 1AXIB 2A6KA 4AQOA 1H15B 4Z7VF 4LLVB 1T21A 3N06B 1LK3H 4ODSH 2XWBA 3UX9B 3MMEA 4MCZB 2X4OB 3OWEA 3ESVF 4V1DD 5I1DB 2R9HD 2CRMA 2ZJSH 2W0FB 3EYSH 3V4PH 5I76A 4Y0GA 2DQGL 5DD1L 4CU8A 1EA9C 5CJXA 3AU1B 4WTWA 1HE7A 1JRHL 4BSVB 3IXAA 4PRIB 4LASH 4P2CG 4MNQE 1T0MA 4P2RE 3HC4L 3LKRA 1NANI 3UTZB 5D2LF 1I9IH 1EEYB 1S9XA 4R3SA 2RFXA 3TYGH 2OTWB 1ZGLA 5CP3A 1NUDA 3U79A 5JOFB 4FFWC 4KJQD 2WUCL 4EVNB 4ZYKA 3ROOB 1EJOH 3OKDA 5HDQL 5HYSA 3SDYH 2XTJD 3B9KD 1N8ZB 4MSWA 4LU5L 5F1NA 3SGDH 4NOBA 4JPVH 5TFSL 3MZGB 3MYJB 1ZLUH 5DDHA 4Y16C 3PHQA 2ICEB 1R5IB 4NKIH 1BOGB 5TDNA 4KZDL 4XWGH 1I7TB 4V1DB 4JFQB 3G6AA 4IHOA 1IZKA 3IS1X 5BV7H 3MR9A 3CLEL 4FQJH 1Z9LA 2EYTB 3G9AB 3W2DH 3QRFM 3M1BB 3EGSA 3BPCB 1K4DA 3JTSB 4MVBD 1CL7L 4P9HC 4ZOAA 5FKAB 4CMHB 2EYRB 1QLRA 3IFNL 4HUKB 4F58H 4G8EB 3ZKNC 2LTQC 1GL4B 4NYLA 1MAKA 3V6ZB 1RIVH 1JPFB 1FRGH 5KVDL 3MRNA 4TQEH 3EOAB 4GW4A 2PW2B 4K3JH 2XTJB 3B9KB 2ATPA 2NY0D 2XG5A 5J89A 3T2PA 3BQUA 2YN3A 2IADB 2QSVA 1BGXH 2DI9A 3EYOB 4PRDA 4FN0A 2Z9TA 4BSWB 1LDSA 4LP5A 3VFNA 3O6FC 3Q5OA 3ARXA 4BZ2H 5GIRA 4LSSL 3T3PE 3MA7B 3CFBA 5DJDA 4NQTA 5KN5A 4HIJA 2NW3B 1IM3A 2MKLC 3QEUB 1YEDB 3SKOA 4BH7B 4KUZL 2C1OA 1TJIH 1PFCA 1BZQK 1BVKB 1NGYA 4Q7DA 4OF8A 2OMBA 4KTEL 5D7SH 1LGVA 5DXWA 1IAIH 3OAUH 1P7KA 2ZUQB 5IJKC 3T04D 5EU7C 3V6FA 4P9HL 5BO1H 5GGTL 5HGBB 2NY0B 1XGUB 5I1EL 4U0QB 5BJTA 4LKXB 1JHLH 5EUOF 4GRWF 3E0GA 3HZVA 1KIPB 1WJ3A 1T03L 1OGAE 2IANE 2AV1A 3TFKC 3B5HA 5DFVD 4RGOL 4XMKL 3CX5J 3CK0L 4KRPC 4WHTA 1CFQB 4FQLL 3X14A 4LFHD 1T7YA 4JRYA 2E6PA 1T7ZA 1YMMD 4QOKA 4YO0A 5CSGA 2EDLA 5D7LA 5IKCB 1A3QA 3FB8B 3EDKA 3QUYC 4NQVA 5JDSA 4U33A 5FOJA 1ACYL 1RHHA 4TPRH 1IC1A 1E4WL 3K80A 3HB3D 4OTXL 1IVLA 4NJAL 5BMFL 3X3FL 5LXGL 1M6OB 2ESVE 1WUNT 1XIWC 3I85A 4R7DB 5DA0B 4M5YH 1FL5A 4M7KH 5JOPD 2V5SA 4YNYB 3SJVA 3TJHC 1OSPH 4NP4H 1AO7D 3S35X 4HWZA 1QRND 4LPYA 5D1ZD 3F6LA 4OCWL 1NAKL 5F3BA 4X4XA 2OL3B 3SDCC 5E08L 1P4IL 2R69L 2AV7B 1HI6B 4H88H 3W0WA 2XICA 3STZA 1G0XA 4PD4K 3GSVA 2JJVA 3R06A 2DQEH 5L8KB 1FG2B 3HAEB 3S5LB 1YMMB 4TSAH 5E8DH 1E28B 1VGKA 2EDRA 4FHBD 2VZVA 3SQOH 1QG3A 3FMGL 5CJ5A 5EO1B 4J3TA 3MJ7B 3EO0A 3AXLA 2F53D 1EHAA 1ED3A 4PJFA 3MRRA 4YFEA 3BH8A 3W9EA 2ZUWA 1J11A 3T0EC 3RWGB 1T3FB 3KGRA 3JZ7A 4QHKJ 5IIEA 1DN0A 1JWSA 4KK5D 3HMWL 3LEVL 1AO7B 1DSFL 5C0CD 4XCCL 2R2HA 1MEXL 4I0CC 5AUMB 3TCLA 5LVEA 1QRNB 5D1ZB 5GS0L 3O4LD 4UT6L 4XCFH 2XY2A 3WIHA 2Z4QB 3MUJA 4QTIH 2HVKA 3K74B 4JFDE 4LSQH 3MSPA 3MO1B 1U8KB 3MROB 1E4KA 2Z31A 3L95A 4RNRA 3QEQE 4JFFA 3AB0B 5ESVB 3U82B 4J4PC 3GJFH 4YK4B 3QEGL 4JG1L 3F7VB 2R2BB 3MV8A 3HE6C 4P4RA 3EAKA 4BJLA 5LWYH 1RJZB 4I2XB 4XXDA 1FL6B 3MREB 5B3JE 3FT3B 2PTTA 4Z7WA 4OZ4A 5DK0A 3BXNA 2F53B 2WBJD 2F8OA 3EFFB 3GI9L 1A2YA 2IBZY 1NKRA 1IGCH 4P4KD 4XRCB 5ICYA 3GKWH 5T3ZL 5KANI 4XNZC 4PJAE 3MYZA 5ANME 4JB9H 2HN7A 3H3KA 2VDMH 1PSKH 2CRIA 3OV6A 5C0CB 5EFIB 1D5BA 3O4LB 3OF6D 3S97C 1F02I 5GRYA 1OQOA 3MRGB 5HVHC 4U7MA 3PABB 5EZIL 5AZEL 5TH2B 5J7CC 1ITBB 4Z0BL 3SE9H 3GO1L 1RHFA 5ESQA 3VXQA 4K8RH 1BIHA 4HBQA 5GRVK 1LE5B 5D70H 3LKPA 1JGVL 1WICA 3LS4L 4LCYA 2UWEB 5C0IA 3RKDD 4RA3A 5DO2D 3LQZA 4AH2A 1AP2A 3O3EB 3FRUA 3MLVL 3BPNB 1U92B 1FSKB 2HLFC 5E8OA 2WBJB 1AGDA 2EC9U 3RIAK 3CLFL 4P4KB 4U1JB 1LE9A 3P77A 2DLGA 1YEEL 5TDPB 2AEQL 3L7EB 1A7QH 4POZC 5E8NA 5A3ID 4DQOL 1FZJB 4NN7C 2H3NA 2HTLC 1BF8A 3BZEB 2ZKHH 4YHKH 5FHAL 3BKMH 1RUPL 3B3IB 2F5AL 4I4WB 4W6YB 2VSDA 5FO9A 1LO3L 1SEBA 1CLOL 4OZGA 3RVXD 1I3VA 3PWNA 1ZLWK 1EEZB 4YHPA 1AJ7L 4YPJA 1KJMB 1L4IA 5EO9A 3PWPE 3RJDA 1C16B 1P84K 2R1WB 2FWOA 2A1WL 5C7XH 1AQDA 3WIFB 3I3BA 3U0WL 2HA1A 3LS5H 5T1LA 1QSZA 1W8NA 4NNYB 1CFTA 4RGMC 1OTTD 2A83A 3B9AA 1EXUA 4FXGA 1RUAL 3PDDA 4WHDA 1A6UH 1UB6A 3G08B 5ETUB 4HG4K 5AD0A 4JDZB 3E3QE 3WUWG 1S9WB 5I0ZA 4NNXA 1UM5H 4NZRH 2X5PA 3O6LH 4N1CA 2D7PA 3RVVD 4MWFB 3QUMB 3QYCA 4NZTL 1EDQA 3HI5H 1DUYA 4YJZL 3QUXD 4GAGL 4FQ2H 2XKNA 3W39A 2P7TB 3OG4B 3X3GH 2NX5D 1Q94A 3UCRA 4ODBD 1MFEH 3UYOD 5J13B 5DMIL 1MIEL 2Q76B 1G6RB 1KV3A 4U6VL 3HMXL 2ZCHH 3CFIC 4JPWL 5KW9L 3FB6A 2I5YH 2D0GA 3PQYE 5B38G 4KUCD 5GGRY 2VAJA 2VXVH 2BCKA 3CH1B 5FDWB 1Z0NA 3O3DA 35C8L 4ELMA 4IRSC 1A7BA 1FE8L 1BD2E 5D6CA 1V7MH 3L3IA 4NBYB 1DLFH 4LVHB 5ELIA 4P57B 1BECA 4L8DB 3RNQB 4L8SA 2R39A 2ZUXA 5JW4M 4OKDA 4ZODA 5I66A 1HZHH 3WMSA 3KPRD 5A2LH 2XKUA 4MXVF 2ARWA 3QUXB 5DHVB 3FQUA 2R4SH 4YH6A 3C5ZD 4HZAA 2NX5B 1UWXH 3HC0B 4Q9CA 5JW5B 4WIQA 1RZJC 5HD8C 1NLDL 4EJ1C 3PUCA 5K9OA 1X3DA 2Q8AH 4DZ8A 4I0PA 1BM3L 3SDDD 1UG9A 3S98A 3KWWA 1FO0H 4JZJA 4S1DC 2OJEB 5HHVH 2D7QA 4ZFFB 5IOPB 1P6AB 5IM7B 4HK0A 4GJTB 3A67H 1OGTA 4KROD 4NWUL 3TGXA 4OT1L 4PIRF 3QDME 4U0RC 2QQNL 5C0BE 1BVLB 4U1IA 3UBXG 4H1LH 5A2JH 1C1EH 3F12A 5D71H 2X7LA 3TBTA 3FFCA 4RQQA 3KPRB 1NAMB 1YPZB 4J1UB 4M62H 1H5BC 1L9MA 2MKWA 5L0QC 3EKCA 1U8IB 4K23H 4XPTL 3C5ZB 1T4KB 2MFNA 3C5SA 5AYUL 1A6ZA 2ZPKH 1KCSL 4Y19D 1PKQB 2I9TB 1UWEL 3OXSA 4DGVL 3JV6B 4F7CA 5JIIA 3L3GA 5J56B 3NIGE 3VFSA 3SDDB 2BSTA 4M7LT 4XHQA 4H8WL 1CBVH 3NCMA 5CZXC 4NC1E 1YY8B 2FATL 1Y0LB 1XR8B 3TYFA 4PLOB 4KZEH 1NGXB 1X4ZA 4KROB 2IPKB 5CLWA 1RZJL 4XPGH 1DUZA 2OJZH 1J05B 1NFDF 1XGRB 2OQJA 1J87A 2LVCA 3C2SA 4OBSA 1HKLL 1C12A 2W60B 5GXBB 2N4IA 4LSVH 5T3XH 2JJTC 3SDXF 2WM0A 4S0SD 1JMZA 4POYA 5FYKL 3LOWA 1U8JB 4XHJC 4U2YA 1PQZB 1NCDH 2VUOA 3OAZK 1U91B 3NCBB 1BJ1J 1YA5A 1HCFX 1DANU 1P53A 3SO3B 1AXSA 32C2B 1N64H 3P4OA 1FNAA 1Q0XH 4JEGB 4F3FA 4Y19B 5C08E 3ZE0F 4Q6IA 4L8BA 3K4DA 2OLDA 2I24N 3OHXA 1FGNL 5F9WB 1U41A 1X5AA 4L5FL 4F9PC 5FGRA 1I8IB 1OARL 4JN2A 2QQLL 5F7LB 1E6OH 4DUVA 4PJ8A 5JHLH 3CFJB 1ZHLB 1QLEL 5E2TH 3KVQA 2NYYD 1FVCA 2Z8RA 3HN3A 1HXYA 1CLZH 2BC4B 4IOFD 3SDAD 1HOCB 3QCTL 1B0GB 5FA3B 1RZ8B 2WZPD 3RDTA 3CUPA 2ZSWA 3EHBD 5GGRA 1OM3H 5GGQL 4N90E 3FFDA 2UZYB 1UADC 3BP4B 4JM2C 3WHE0 4QHMB 3BZFB 1YEGL 3QQ9C 3BE1H 4QYOB 5T1MA 1Z3GL 4MD4B 3TT1L 3GBNL 1JHTA 4YEFA 2Z92B 3U4BL 3VD3A 4L8CB 4ZUSA 4MA3B 1VKXB 1XGYH 4ZOCA 4L29B 1J12A 4WTXA 3QJFA 1TQCB 2E6QA 4P2OD 3MV9D 3QDJE 2I27N 4RGND 5ITBL 2AERT 4Y4KA 1NBZB 1VFAA 1CDGA 4UDTB 3SDAB 1FLRL 2YZ1A 5DMKB 2Z8VC 1WV7T 1HHJA 5IVZA 4MQXD 4G6JH 1NGWB 1CU4H 2P46B 1RZFL 4FFZL 2QBWA 3L3DA 1U2CA 5I8OH 3V5DB 1B0RB 5FGBC 1BQUA 4CAGA 2X9XA 3IAQA 5GISH 3DTXB 3IJSB 5FYJE 4ALAH 3S6CA 1MI5E 1I7RB 1J1OL 4BM7A 5H35A 1YEHL 2UY7A 2X4PA 3L3OA 3IDJA 5CEZH 3CFKB 43C9B 1L7IL 4PJ7F 1G7QB 4I18B 4ZUUA 4P2OB 1JF6A 3MV9B 4MS8C 3REVB 3SE4C 3RIFK 3ULVD 4RGNB 3RWFA 4PV8A 3EJYC 1P5VA 2A6KB 3AY4C 1XF5A 4X9GA 1IL1A 5BVJA 3RJQB 1T21B 1NJ9A 2XWBB 3MMEB 4XVSH 5EB9A 5MEPA 2G5RA 1TQBC 5I76B 4LARH 4RBPH 3VH8A 3WO3B 1NGQH 3QRGH 4HFUL 5C0FA 3IXAB 1HK6A 1T0MB 3HZKA 5CZKA 4XVUC 1I3UA 3K3QA 2W0PA 1S9XB 5IP4A 4PJHE 2ED7A 1KCRL 4R3SB 2RFXB 4IOIA 3GB7A 1ZGLB 4GG6F 5BXFA 3Q1SH 4R4BA 4ZYKB 4OQTH 5JPMA 4PJCA 3TJEL 2FD6H 3OKDB 4CN4A 4AEIL 5HYSB 4MSWB 5F1NB 5IB4A 1A6PA 3BQUD 3H42H 4WWKA 4XNYH 5LKNA 5DRNA 3PHQB 4FG6C 4Q9QH 5TDNB 2FNBA 5J1AA 2F5BH 1MHPH 3CH8A 3G6AB 5DZOA 3MR9B 3LPGA 4NJ9L 4W68A 3EGSB 2NY2C 3G5ZA 2DQCH 1GOFA 1K4DB 2VRAA 1WWWX 1C08B 5JW4R 3P0YL 4U7KA 1QLRB 5EO0A 1IFHL 2D0FA 5EOQL 4L3AA 5EC1B 3MNZA 4RDQF 2CKBB 4PUBL 3RVUC 1IKNC 4NYLB 5ENWA 2EXYC 2VLKA 5JHDD 4PJIF 3MRNB 1LVEA 4GW4B 4GXVL 1U3ZA 5HHME 4I9WE 3U1SH 2ATPB 4PRHE 5I15H 3BQUB 1LEIA 4YHLH 4NUGL 3V0AC 4R4FL 1TQBB 3QWRA 4Z7VA 1MWAA 5BV7C 3VFNB 3SO5A 4KHTL 4OZIF 2F19L 4L4JA 3FOLA 4TVPL 5GIRB 4JRYD 1MCWM 3CFBB 4QOKD 3F7RA 5DJDB 4ODSL 5D7LD 3S3JA 5KN5B 4HIJB 3RUGE 1IM3B 1UM4H 2DICA 2ZJSL 3P4MA 3SKOB 3EYSL 3V4PL 1MVUA 1T5WA 2VC2H 2C1OB 4UU9A 1NGYB 4D0DA 1MRFL 3DUSA 5EPMA 2UY6A 4LASL 1P7KB 2EDWA 5JHDB 3RHWK 4Y2OA 3V6FB 1I9IL 1WAAE 2AJXH 3SJVD 3X11B 4M1DH 4JCLA 5SWSA 3TYGL 3WXWH 5FM8A 5DA4A 2BNQE 3HZVB 4EZMA 2P1YA 3R0NA 2NY6D 5IB3A 3HNSH 3SDYL 4MA1B 3ZKSD 1BIIA 3DGGA 2YD1A 1A6AA 4WHTB 3X14B 3QIUD 4JGUA 1M4KA 4JRYB 4QOKB 5D7LB 4TRPL 5GRZA 4NKIL 4NQVB 5BRZA 4XWGL 5JDSB 1MNUH 5F1IA 5FUCC 5BV7L 2X1WL 2A73A 4FQJL 3EOYG 1CFNA 4GMSL 3SCMC 1FL5B 2BVUA 4Z7UE 3BVNA 3V95A 3SJVB 4F58L 3HMXA 1FNSL 4LPUA 1JF1A 4HWZB 1G0DA 4XT1C 1RIVL 1FRGL 2W0LA 3NCYS 5F3BB 1JN6A 4OZFA 4TQEL 3KPSA 5D7IA 5IEHA 2NY6B 3QIWC 4GBXA 2MCG1 2XKSA 4KKBC 2Z31D 3STZB 3AREA 3GSQA 3GSVB 3RI5F 3R06B 4JFFD 3QIUB 1OAZH 3UYPA 3ZTJH 1VGKB 3WEXB 1NMAH 4D0CA 3U4AA 1NSNL 2YD9A 2O5ZL 3K8LA 5C3TA 4BZ2L 3EO0B 3AXLB 5J6HA 3D39E 5ACZB 2IGFH 4XCYB 3NCEB 1ED3B 4PJFB 3MRRB 3ZSSA 3W9EB 3O4OB 4JN1L 3ME0A 4PS4H 3SOBH 1TJIL 3NCCB 3R0MA 4FTVE 4OD2A 3H3BC 3HCVB 1DN0B 1JWSB 5CLTA 3VGDA 2R2HB 5BW7C 1SJVA 2YS4A 5D7SL 5HYFA 1IAIL 2I9LA 3LN4A 3OAUL 5F9OL 3LKOA 1S5HA 5EIIA 3OQ3B 2HVKB 3O41A 5BO1L 2CDEA 4R97B 4RWHA 1FPTL 1MJ8H 5E70A 3HNVL 2Z31B 5E6IC 3L95B 4JO2H 1JHLL 4MGXA 4RNRB 4HH9A 4JFFB 4ZD3H 3BD4A 2R56H 4QRUA 5GSRA 2X9YA 3RY5A 5D93C 1YEFH 4P4RB 4K71B 1YYMH 3H9YA 4TUKL 4EKXA 4KI5D 1JGDB 4XXDB 3ARUA 1GXEA 3FZUD 4LPCA 1S9VA 3DO3A 5DC4B 2PTTB 5DK0B 4OZ4B 4Z7WB 5GS1C 3BXNB 3G9VA 4M43H 5I6XC 1A2YB 1QOKA 3NIDF 4TPRL 5ICYB 1KB5H 2FH8A 5GZOD 3MJ9A 3V2AR 2RJMA 2HN7B 2VL5A 4W4OC 3LAFA 4IIQA 3O9WC 5E1HB 3OAYH 1D5BB 2W9DH 4M7KL 1YN6A 3LIZH 4LL9A 4PJEA 4NP4L 4MJ6A 5ESQB 3VXQB 3O3BA 3BGMA 1EFQA 5EU5B 5E5RB 4KJWC 3LKPB 4HAFA 5T1LD 3NPSB 3F5WA 1D3CA 4H88L 1VEOA 3LQZB 1AP2B 5FM5O 3FRUB 1Q8MA 5E8DL 5E8OB 2UV3A 2YUWA 1AGDB 4RAHA 2FSEA 3D25A 4NM4H 1LE9B 3P77B 3SQOL 2PTVA 2VDKH 3FTGA 4FQXC 2XN9E 4P5MB 3MZTA 5E8NB 1FZMA 4ZFGH 5DVOA 1U3YA 3OKKB 3ARTA 5ILTL 1U2HA 2ERJB 4NPYB 1FAIH 5FO9B 3ZE2F 5DJ0A 1SY6L 1SEBB 4K8RC 1H0DA 4OZGB 2GT9A 5BS0A 1L6ZA 3PWNB 5KSVA 4YHPB 5EO9B 2B0SH 4KJWD 3AS2A 2X70A 1D5ZB 4NQCA 1K8DA 4XCFL 1AQDB 3HR5A 4QTIL 4LSQL 3G5VA 3KDMA 5T1LB 4OFPA 5I1KL 2QADC 1CFTB 3K4ZA 4DKAA 2A83B 1EXUB 4FXGB 4RZCA 2HT4D 1BZ9A 4X6CA 2BNRE 1UB6B 1KNOA 5LWYL 5AD0B 3D5OF 2PO6D 5I73B 3LDBB 4NQXA 3QZWG 1T0NA 4NNXB 2FZ3A 5HJ3A 5JMOC 1KENL 4UAOB 2BHYA 2VLRA 1DBKH 1DUYB 3GKWL 4PBVC 2XKNB 2LV4A 3CX5K 4JB9L 1Q94B 2VDML 4QHLA 1MIML 1PSKL 4FXKA 1AD0A 4PY8J 4EIGB 4F9PA 1J0KA 2F54A 4I0PD 3TH3T 1OW0C 4DKFL 2E27H 2KBGA 4WFEE 3PP3K 3FB6B 1ZVHA 4K8RL 2BCKB 1QFWH 3O3DB 2DBLH 3HC3H 4CN1A 4ELMB 5D6CB 5J1SC 3ZT5A 5D70L 3L3IB 3J8F7 2FJHA 1OY3B 2VJXA 4L8SB 3ARGA 2FEDC 4KV5E 2PO6B 1R3JA 3ECBA 3FFCD 4JREB 5CGYC 4L3EE 1XGPA 4XNMA 1VHPA 2FJGA 3S96A 1B6UA 3FQUB 3ELAT 3EO1A 3D87B 2BHZA 2MMXA 1CDJA 2P5EE 4P2YA 1UFUA 1U9KA 2O5YH 5K9OB 1QFPA 3K1DA 2YPLE 3HPLA 3LQMA 4DZ8B 4I0PB 2OZ4L 2AK4A 2FGWH 3KWWB 2IH3B 3MACH 4JZJB 4RAUA 4ZXBD 2D4FA 1EO5A 2ORBH 2YUXA 1T20A 1XFPA 1YQVH 4HK0B 1OGTB 5C7XL 3KYMA 5B8CC 1JI1A 1K8IA 1R0AH 2XI9A 5FO7A 4PFEA 1PD6A 3F12B 3T3MF 2X7LB 4QRTA 3TBTB 3C9NA 1M7DA 3ARSA 1BBDH 3TF7C 3V52H 3FFCB 1BFVH 4RQQB 1CE1H 4R4ND 1MCKA 2E6JA 2VR5A 2W07A 4I3RL 4WW2A 4OLXH 4JPKL 1MCIA 1QR1A 3WO4C 1I9JL 3C5SB 4QTHA 1KULA 1UM5L 4NZRL 5CS7A 3O6LL 2V5MA 4HDIA 1A6ZB 3P9MB 1KB9J 4G8GE 1VGEH 2UZIH 3KNBA 4F7CB 3MLYH 3L3GB 3VFSB 2L4OA 2AXFA 3X3GL 2BSTB 4PBWD 1TZHB 4OIAA 4ZXBB 3T0DA 4MDJA 1QNZH 4RA0C 2X4TA 3V0VA 5KZCD 2E7CA 3TYFB 1MJUL 4PJ8D 2A2QT 4D8PA 2OQJB 2Y5EA 2ZCHL 1VPOH 2P5WA 1C12B 4WV1A 4R90L 4HWEH 2VXVL 3QB7C 3GSWA 4IOSD 3HG1A 3RDTD 4JZNA 5F7FA 1C8PA 2WUBH 4QHKI 4CN6A 5I8KH 2GTZA 2AJ3A 3CD4A 3QXVA 1TZGH 2LABA 4DFIA 1OTUC 4NSKA 4Z0XA 5I9QC 4J8RB 1HZHL 3P4OB 1U8PA 3BN9D 4OD1H 4PJ5A 4F3FB 4LLMA 2QSCH 3QXTA 1LEGA 1YYLH 2IAMA 4Q6IB 4L8BB 5IJVA 4AQ1B 2V2TA 1FFPA 2BK8A 3OHXB 4X6DA 4OB5H 4G7YH 2G9HA 4AEFA 3PWJA 2IALA 1U95A 4ZO6A 4QHUA 1YEJH 1U58A 1F11A 1WZKA 4J6RH 4LAQH 5I1HL 2X09A 4IS6A 3VXOA 5KZCB 4JN2B 1XF1A 2I60H 3ARZA 2EDXA 4PJ8B 3ALPA 4LLUA 2C9AA 1HH9A 2EIBA 4X9BA 4G9FA 1FO0L 4Y4KD 1FVCB 5FCSH 5HHVL 1J0JA 1IKFH 3LZFH 1HXYB 4YFLI 1F4HA 1K9TA 3A67L 4F33A 4OI7A 4NO2A 3RDTB 3CUPB 2ZSWB 1N26A 3JWDH 4RAVA 5GGRB 4JFPA 3ET9F 3A6OA 1OP9A 3FFDB 1C1EL 3B8YA 5D71L 3IVKA 5TPWH 4KKAD 1U8HA 5MEOA 4QEGA 1GIGH 3P2TA 1Y6MR 4PRIE 5BOPA 4M62L 3ARBC 1CR9H 1B2WH 5T1MB 4LHQB 2VLLB 5IFHH 4K23L 1JHTB 4GG8A 4L9LC 4U1KA 1GC1H 4ZUSB 1I7UA 2X1PA 2ZPKL 1MRCH 3QJFB 1MHCA 5FHBH 2DQUH 4HXBH 4KU1A 1ZHKA 3U7WH 4Y4KB 1JK8A 4O2FA 1VFAB 1YN7A 3B2VH 1DBBH 3NIFE 2NY1C 3QDGD 4KZEL 2NXYD 4JG0H 4HKJB 3SDXA 4IMKA 4XPGL 1HHJB 2OJZL 2OX5A 2WK2A 2YWYA 4V1DE 2OP4L 5IVZB 3T3PF 4PRNA 3BDBA 3L3DB 3ZKXB 4LSVL 4P5TA 5T3XL 4G3YH 2N1KA 4PB9H 3FL7A 3FN9A 5GS0D 4N5UA 3OBAA 1H8OA 4P99A 2LU3A 4ZFZA 3IETA 4K9EH 1N5YH 2Q3AA 1MCSA 4LBEA 1S7SA 5EU6D 4YBHA 1Q0XL 2QKIA 2HP4A 3IDJB 3BT2H 1NKOA 5IW6A 4ZUUB 1RMFH 1SBBA 4GLRH 3FRPA 2RCSH 2XTJE 3RWFB 4PV8B 3C2AH 4WWKD 1XF5B 2HWZH 1IL1B 3PDGA 5BVJB 1NJ9B 3FN0H 4MHHI 5E2UL 3UO1H 4XTRC 3QDGB 2NXYB 1E6OL 5MEPB 1UJ3A 4XXCC 2VXUH 4NKOA 4OLYH 4OF7A 1DQJA 3EDJA 4WHYH 5E2TL 2A0LC 4MQSB 5T3ZD 3VH8B 4L3CA 5FM5M 15C8H 1CLZL 5C0FB 2F8XC 5JDJA 1AGCA 5DT1H 3HZKB 2V7HA 1OM3L 2R0KH 4HLZG 4E5XA 2XRAH 4IOIB 1T04A 3GB7B 5EU6B 3F58H 3QPQC 4MAYC 5BXFB 1BZ7A 4ZSOA 2VLKD 4ONGL 4R4BB 5JPMB 4PJCB 5FYJH 1IEAB 3BE1L 4YGAB 4I48A 4KKCD 5IB4B 2NR6D 1NCTA 1XGYL 4WWKB 5DRNB 3GMOA 3DETC 2ZUUA 3UZQA 2GCYA 4EXKA 4UILH 4OCRH 1J1XH 5J1AB 1CYGA 2AKRA 1IMHC 3ZDYE 1X9QA 3O81A 3H9SA 3TM6A 1DQLH 4X6BA 3G5ZB 5EUKA 3L3HA 2ZZUT 3KG5A 1L0YA 2X4SA 4QGYA 2C26A 1HYSD 4G6JL 1CU4L 5EO0B 3N0PB 1OAXH 5LCVL 3MNZB 5KSAC 4Y2DA 4KRMB 5I8OL 4E41A 4QT5A 5ENWB 4O2EA 2VLKB 1GGBH 4TTDC 5EU3A 2YUVA 2W1NA 5BW7A 5F7NC 1CD9B 1W72H 5CHNA 4ALAL 3FB7A 4HX1A 5SWSD 4XP6H 1MY5A 1LEIB 5INDA 3PV6A 3VI4E 5FV1L 2OTPA 4ODUA 5CEZL 1OT1A 3NGBB 4XPBH 1MWAB 4XZUA 1WCQA 2VR9A 3VXTA 5E9DD 4FQPA 2YD8A 3CPLA 3FOLB 5DZNA 4D3CH 1IAMA 1YMME 5BRZD 1FL3A 2HJKA 5DRWA 1U8QA 1TNNA 3P4MB 4JKLA 5HVGB 4Q2ZA 1MVUB 1D7FA 1T5WB 5B3JF 4LARL 1CDUA 3MUZ1 2BOBA 5D1XC 5D4QA 3C8HA 5HTSA 4UU9B 3QRGL 4HGKC 3F7YA 1TENA 5IBTH 1CG9A 1SY6A 4YC2B 5F96H 3VD5A 3DUSB 3WN5C 2NPLX 3ARPA 4GG6A 4PJAF 2HMIC 1S7XA 1IEBA 4IJ3B 5JOPE 3PL6A 2CK2A 4PGJA 3F65A 2ADFH 5SWSB 3VA6A 3LY6A 1AO7E 3Q1SL 4X80H 1QRNE 4XAWL 5CWSB 3WE6A 4Y4FA 2GYSA 2FD6L 1FVEA 3U9UA 5IB3B 4WNQA 1OB1A 5E9DB 1BIIB 1C7TA 2FECL 3DGGB 3ARED 1A6AB 3EDDA 3F7QA 3H42L 3G6JA 4XNYL 4D9QD 1PZUB 2YD4A 4Q9QL 1FFNB 1OPGH 5BRZB 5F1IB 1LEKA 2F5BL 1MHPL 1TETH 2BP3A 2A73B 4I2XE 1DZBA 4Y5XC 1CFNB 1G9MH 1W0VB 4OZHA 2DQCL 2F53E 3BVNB 1LD9A 3P0VH 2CRZA 3FO9A 4PJIA 4LEXL 1PGRB 5I75C 1JF1B 4P3DA 4JE4B 4N0RA 5C0CE 4OF5A 5GGVH 1JN6B 4OZFB 2VZUA 2B4CH 2AQ2A 5D7IB 1Z6JT 4F37F 2JCCF 5DC0A 5IEHB 4PP2A 2D03H 1PX3A 3U1SL 5I15L 4QWWC 3AREB 3T2QA 3MRBA 3TH2T 4YHLL 1TIUA 4U1NB 4Y5YA 4FZ8H 5J3HC 1F4YH 4D0CB 2UWEE 4JO4L 5E2JA 4KXZH 4MNGA 4D9LH 4U1GC 5C0RH 1S7TA 4HKZA 4F7MA 4Z78A 5J6HB 1GZQA 4Y88A 3MFFA 4YDLB 3ULUD 2VC2L 4QY8B 3DIFA 2FX9H 2YR3A 2OZ4A 4OD2B 5DRZA 1V7NL 1IJ9A 5C6PB 2DLHA 3LKQA 1LNUA 3LN4B 4CU6A 8FABA 4C56A 3LKOB 1S5HB 5EIIB 5KAQF 2AJXL 2CDEB 3B9EA 3TBVA 4NCC2 1KLUA 4R8WH 3IFOA 4M1DL 3WV0A 3WXWL 1E4XH 1D9KC 4YGVA 2DMKA 4HH9B 5SX5H 4GRLA 5GSRB 4QRUB 1MCPH 3T0WA 1DVFD 1I1RA 4JRXA 3HNSL 3DYMA 3RA7L 2IEPA 3WFCH 4UNVA 4RRPG 2ILLA 3NPZB 1EGJH 3AVEA 5EA0H 4S10A 2YK1L 5ID0A 4OFVA 3QH3A 2B8OT 4K94C 3BGFC 1RZGA 2J4WH 1F4XL 5FA4A 4FABH 1WZ1H 1FCGA 3Q6GL 5DLMH 3MJ8A 2VL5B 4HIIA 4IIQB 1VB9A 3EJZD 5CZVL 4OCMC 1IGFL 4MD0A 2IMNA 1YN6B 4G8IA 3RTQC 2G60H 4PJEB 5BS0D 4MJ6B 3L1OL 1R3IH 1QFUH 4ZFOA 4NQCD 3O3BB 3BGMB 3UAJD 4LOUD 4KK9D 1CFBA 1TCRA 1DVFB 3F5WB 4NIKB 2EXWC 5LQBH 3UTPD 1L9NA 2APFA 4O58L 1OAZL 4N0UA 2ZOKA 3KYOA 1WCBA 1X44A 5HGAA 1NMAL 3D25B 2IJ0C 2OI9C 3FTGB 2PXYC 1FZMB 2OR8A 4HIXH 2P8PB 3ARDA 1ZVSA 2IGFL 5I74C 1HSBA 2VLRD 1GYAA 3QIBA 3QEHA 1CGYA 4PS4L 4BZ1H 1J1PH 3SOBL 5DJ0B 1JMXA 2YD2A 1H0DB 4ZUVA 2GT9B 5BS0B 2NX5E 3SGEI 4JFEE 4X9IA 3ZE1E 1KJVB 3DV4A 2X70B 4NQCB 3WDHA 4NNPH 1K8DB 3GM0A 4S11A 4LVOB 2F54D 3HR5B 4P46A 5T33H 2ZWLT 3G5VB 3KDMB 3B2UD 1MJ8L 3GEWB 3TH4T 1DBAH 2YD6A 4JO2L 3KPMA 2CIIA 5EG6C