1E6OH

Crystal structure of fab13b5 against hiv-1 capsid protein p24
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
219
structure length
219
Chain Sequence
EVQLQQSGAELARPGASVKMSCKASGYTFTSYTMHWVKQRPGQGLEWIGYINPSSGYSNYNQKFKDKATLTADKSSSTAYMQLSSLTSEDSAVYYCSRPVVRLGYNFDYWGQGSTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutual Conformational Adaptations in Antigen and Antibody Upon Complex Formation between an Fab and HIV-1 Capsid Protein P24
pubmed doi rcsb
molecule tags Immunoglobulin
molecule keywords IMMUNOGLOBULIN HEAVY CHAIN
total genus 45
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2000-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1e6oH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1e6oH02
1G6RB 5CSZA 4LOUD 2BCKA 4E0RB 4WNQA 3LPFA 3INUL 4WW2F 4DGVL 1RHHB 5IJKA 2XZCH 4R0LC 4PJAA 1T22B 4J1UA 4MDJA 1CFVH 1FZOA 4KI5D 1UB5A 4H20L 4OCWH 4JO3H 3P73A 2HT2D 4P2CG 2QR0B 5C0BA 3UX9B 2JJVA 4U1LB 3U0PB 1RIVH 1JGEA 1AY1H 2YXMA 4LDEB 1X5XA 3VXRD 4OZFB 3WFBH 5I1DA 1GGCL 3RGVC 4JY6B 5E2TL 3AS2A 1MRDL 1QLEH 1X5KA 1ZSDA 4DJMA 4WFFE 4JPWH 5MI0B 1FNHA 4OCRH 3W81A 4ZFFB 2QADB 4HXAH 2DTML 5CGYD 1JZ8A 1GZPB 4ODSH 1KGCE 4U1SA 3T77A 1Y18A 3C2AH 5IEKA 1HHJB 4E41A 4G7YL 3LKQA 4KAQH 4LSPL 3DBXB 1CK0H 1FZJB 2IGFH 3L7EA 3PV7A 4XCEB 1S7QB 2BXYA 4HG4K 3FONA 1NFIB 3H7BB 4ZUTB 3LAFA 4JFYB 4Y5VA 3UPCA 4G9FD 5TDPB 4JKMA 2D9CA 5IVXA 4MXVF 3W9EA 5J13B 3QIBD 3IU4H 5J9PB 5F6IB 3H42L 1JZ6A 2B1HL 2BVQA 2MHAB 2CMRL 2HFEB 5D7KE 3EJZD 2ZOKA 5D7LA 2EKJA 1I1AC 3ISWA 4UQ2B 2VITB 5L2JB 4DGYL 2X1WL 1D5ZA 2F54E 1F6FB 5HYSB 1KLGB 4M7KH 5AG8A 4AJ0A 4L3EB 4RFOH 2F58L 4LU5L 1SVZA 2VWEC 3F7YB 4ZPVA 1U8KB 4MB4A 4JZJA 1CGXA 4JLRB 4O2CA 3G5YA 3HNTL 4OB5L 3TO4B 2XWJB 5FHBL 1T0PB 2BSTB 3MBXH 3RX8A 1R24A 3D39E 3CFCH 1Q0XH 2XKNB 4GAYB 2VAJA 5GS1C 4GW4A 4G8EB 5FUOH 4DQOL 5DUML 1XGPA 2OQJA 5KVEL 4ZUVA 1PG7X 3CVIL 4PIRF 1EDQA 3UC0H 5EZLA 1X6NA 1R5WB 3TN0B 2AS5M 3BGAA 2NY5H 1CFNA 2CIIA 4B50A 4J1UB 3A6CL 3F65A 3WN5A 2JTDA 3RIAF 1U8PB 3IJYA 1HQRA 3BSZH 5H94A 3MJ8A 1T04A 1TZGH 5I8CA 5T5NF 4P2RE 4HUXA 3EYUL 3KPOB 3P9WB 1EUUA 2J4WH 4ZDHB 3QFJA 2CRZA 1JGEB 2DM2A 1S3KL 2LU4A 1NBZB 1V7ML 1QRNE 4MNHA 3EYQC 2FD6H 1LK2A 1BEYL 2ATKA 4FQXB 1AXTH 2VH5L 3BP6A 4YXKH 3FTGB 2FJHB 4JE4B 3VXRB 4GKSB 5F89B 4OM0L 2R2HB 2JE8A 3RTQC 5EORH 3HCVB 4XVTH 4OD3L 1T1YB 1EHXA 5DQDH 1A1OA 1FL6A 4I0CC 4BZ1L 4NQSB 4K3DL 5IMKB 1AQKH 3SPVB 1UYWL 1VGKB 2R2EB 4NO2B 3DMMB 4Y5XC 4IM8A 1PYWB 2IG2L 1G84A 3MOQA 5ALBH 5HGAB 4UI2A 1QLRB 4GH7B 3RL2A 5T5NG 5BS0B 1OAKL 2OP4L 4ZFZB 1JMZA 1UJ3C 2P8LB 2F54A 2PW2A 3PV6B 4K3HA 2K1MA 4X7SH 4Z0BH 2V2XA 3SDCC 2A2QT 1LP9A 1MAML 5K59E 1XIWA 4D0BA 1A9EA 4IOSD 1K8IB 4HV8B 2YD2A 3QEGL 4OCXL 3RWJB 3QUZD 3BKJH 3N1MC 4MMXC 4C54A 1FSKC 3AC0A 3EYFB 1T2JA 2CXKA 3UMTA 4PJ5E 4XCNA 1G9NH 4LHUG 1YN7B 1BM3L 5DK0B 1G9MH 2FX8H 1MIEL 4O51B 4WI2A 1U8JB 5JXED 3EYSH 5D70H 3FQXB 3TO4D 4WV1A 1E6OH 1EBAA 2H9GA 3W0WD 4HJGA 4BQBA 1HWGB 2MWCA 2CGRH 3KPRE 4AQ1B 4L4JA 4OT1L 3WEXB 2D9QB 4ELME 3VFPB 5BRZE 4PJ7A 4LGSB 4EN3B 2DDQL 3WS3A 1BQSA 3TN0D 3Q6FA 5FDWA 5FYJD 2BSSA 2PCPB 1OAQH 4KTEL 2R0ZL 3I9GL 4QHKJ 2NX5A 5FKPA 3NCBB 4X4YA 5JHDA 1RK1B 3L3HA 2QHLA 1FFPA 3I85A 3QIUC 3KWWB 5CZXD 3O2VH 4HX1B 4I9WE 1DSFL 2HA1A 1MCKA 4HMDA 3BKMH 1OM3H 4MSWB 3L5WB 1FORL 5DD0H 1GRWA 5HDBE 4GKSA 3I2CH 3TA3A 5D2LA 1YUHB 4P2YA 1JNJA 4XWGH 4FQXD 4U6XA 1GZQA 3LH2H 1JGUL 1A1OB 1FL6B 5CIPH 3T0ED 3U9PL 4TNVF 2FECI 4I5BB 3CXHK 3G04A 3QUXC 2WUCL 3DLQR 3SDAA 2Y06L 5D1QD 3MJ8B 3LEYL 1RZKH 4URTB 3D85A 4ESKA 2R15A 4H88L 1XGUA 2Q20A 2CR3A 4HIEB 1T0NB 2XWBB 4N90D 3RY5A 2H2PC 4U6HA 2BVEA 3ET9F 4M5YL 3HNSL 1BREA 1FC2D 2I24N 4IRZL 4NUJB 5EBMA 3SDDC 5DA4A 4Y2DB 5CWSA 3S98A 3CUPB 5CEZL 3WUWB 5DMYA 1T66C 5F9OH 4D9QE 4OZHF 3VD5A 4Q9RL 5AZ2L 2Y72A 1PFCA 1A6UL 3ARBC 4RAUB 1S7XA 1S8DB 5DDHA 5GPRA 5IV2A 4GW5B 3F12A 2VXVH 1JPSH 4IS6B 3C6SB 4NQEA 4DN4L 2W65A 4U1JA 4NQXA 3QUZB 5C0RL 1DCLA 5IESH 4NM8L 3X12B 3GMMB 3SKNB 4AIZA 5KS9E 1R5IB 3R8BB 3ARWA 4WO4A 4L9LB 5IVZB 4UU9B 4ELKA 1JMXA 1XT5A 1R3HB 2DIAA 4KKBD 1ZT4A 3G08A 1I7ZA 2VTFA 4X6DE 4K7FB 4GW1A 2GTZB 4HWZA 2QJDA 2PW2B 2VLJB 1Q1JL 4LIQL 3WXWH 4PJ9D 2CUHA 2DRUA 4OLWH 3DSFH 5HYJD 4JM4H 3VD4A 1JTPA 3W0WB 3V4PL 3VJ6A 4GMTH 5EIIB 2KZ1B 2F74A 5GS0D 3MODH 1HHKA 3STLA 3JWNC 5F7YC 1T66D 1I7RA 4WWKC 4PJBF 4G43A 2DJSA 3RWCB 4OZFA 1YEKH 2Z4QA 3IF1B 3MRRA 4HWEL 4HC1A 5EC2A 5J12C 1JFQH 2YA1A 3QUKA 1CFVL 4OV5B 5DEGA 3VG0L 1FIEA 1H3GA 2YHGA 4G8FA 4MDIB 3O3AA 4NO3B 1BZ7B 1B0RA 1HYRC 1EAJA 2W0LA 1I7UA 4AQOA 1XIWC 1YEDB 1TDQA 4YXHL 2BNQA 3QXUA 5GS2H 1XEDA 2XV6B 4UOW1 4P2OD 1KLFA 2FLBT 3S5LB 1WWCA 2I07B 1YC7A 2GIYA 4LSQH 3RDTD 3SDXA 1UB5B 4PJCE 5T1MA 3G04B 5BV7C 5B3JF 1EHLL 3GIVB 1GC1H 1U0QA 2Z31A 4JB9H 1QFWI 1JI2A 4Z7UF 4ODSL 2V7NA 3RPIA 1RUKH 5CEZE 1AE6L 5D1QB 5E8DL 3V5KB 1Q94B 4QNPE 4LPYA 4GG6A 4BQCA 3L5WA 2EIBA 3BZ4B 5DFVD 5IT2L 5IHUL 2Z35A 3S36X 2O5YH 5D72L 4OD1H 3T8XA 4NYLA 3QRGL 4PJHE 5L2KB 4UNUA 5CJQL 4F37K 2A6KA 3SE8L 3HI1B 2C3GA 2EE3A 5DQJA 5L7XH 4Y2DD 2FO4A 5DVOA 3V5HA 4GAGL 3AB0C 4Y1AA 2DL9A 4ZD3L 3DRTA 2ZP0T 5T1KA 4XC1L 1N3NB 4MCZA 2BSTA 4Y4FC 4YR6A 5I66A 3BKYL 5F9WC 3OAYH 4RFOL 5LKNA 4WHYG 4ZOCA 1MCCA 2Q7YB 5FF6A 3GIZL 4JEGB 8FABA 4ZUVB 4U33A 4EI5C 5BMFL 4ZYKB 4R2GD 1ADQL 4UINH 2L4OA 1A3RL 1UM5L 5E4EB 3DURA 5JMRA 4JHWH 3O3EA 4JQIL 3P0GB 1TNNA 3DX9A 2VDQH 2DAVA 1OB1A 1U8HA 2YPLA 3FONB 7CGTA 5GS1A 2E7CA 2BHYA 3PWPA 3K0WA 2OCFD 2UWEE 4K8RD 4XP4H 3H9SD 2EDFA 4RFNB 2JCCA 3BJLA 3S36H 3O6LL 1RJYB 4R90L 2V5YA 1IGCL 1LEGA 1NH6A 1D5ZB 2H6PA 4OZFH 4S10A 4UU9A 3TBVB 5IOPB 2EEDA 2EIZB 2XY1A 1UCBH 5K9JH 5F1SA 3FT4A 2X2YA 3WDIA 4PRNB 5IMKA 4K7PH 2FD6L 1U6AH 3HB3D 5DUPH 1QQDB 3JSSA 5C0AD 3KLHD 2VH5H 3IJHB 4P2OB 4G9DB 4ZMAT 4I2XE 4P4KD 4FABL 1FFOB 5B39B 3MOAL 4MAUH 4IIQC 2W9DH 2JCCF 5KTEH 5HI5C 1UEMA 1WFOA 3QPQC 2XN9E 4K3DH 1RZGA 1YPZE 3ES6A 4EDXB 1QHPA 3CX5J 2GQHA 4GG6B 5DSCB 3AREA 3SCMD 1CLYL 4QRUA 2Z35B 2R2HA 4RRPG 4PJXB 1S9WA 3PL6A 4ODHH 3V2AR 4TSCL 1IMHC 1R3KB 3ARXA 4G6JL 4FZEL 4RMWA 2I07A 5EOTB 1BD2E 3ARFD 5SWZE 4TVPE 3G5ZA 4UV7H 3SDXB 1LDPL 2HN7A 1EAPA 4H5SA 2OTWB 1JN6B 4WDIB 4NSKB 5CILH 3O3DB 5JQHC 4Y4HA 3WXVH 2WAHA 1YJDH 2L7JA 1IL1A 1OAXL 3VXTA 1TTGA 2FBOJ 3CMGA 4B5EA 4OKDA 2ICWJ 4U6TA 3NGBC 4M6NH 4OGXL 5K9QI 3C09B 4XCYB 1KN2L 1JNHA 4GT7A 4GAJL 3VFPA 4NZTL 2NY0C 4V2BA 5D70L 3B6SA 3QI9B 4PJDE 1IE5A 2BSSB 3PF2A 3RNQA 3KPTA 4P99A 3SGKC 2YWYA 2EDWA 4U1GB 4WFHD 5KJRL 4IBLT 1P4LB 3S37X 2VKXA 5IM7A 4PY7B 4OT1H 1RJYA 4NOBA 1HN1A 2ZUQB 3B8YA 4O51A 3PHQB 4QHLA 3N9GL 4M61A 5F8RC 1INEH 3T2NH 3H9SB 2GY5A 3SGJC 1LP9F 5J6HA 3FT3B 4X5WB 3WFEH 3MBEC 4HEME 1F3RB 3V0VB 4P2QA 1HHIA 4TSBH 4YAQB 2X7LA 3D25A 5FUCE 3JWDH 4NQDB 4Q74A 3FL7A 5F7EL 3MRLB 3P0VH 2XRAL 3QG6B 2WUBL 3LH2L 4GSDH 4KU1A 2ZG1A 3CX5K 2IBBA 3S8WA 1X4YA 1CGYA 5INDA 4BZYA 1ZLUK 5DI8A 1SVCP 4JM2C 1RIHH 2A74A 4NFCA 4JPKH 1QSED 1VFBB 4L8SB 3OJMB 5HI4C 3O6FA 4I4WB 1MQKL 3HAEH 1JRHL 4MDJB 2WSKA 5K9KA 5IMMA 4TOYL 4TVPH 3E2HC 1G7QB 3PWLB 1IGMH 3UP1A 5CEZH 2W0FA 1KXQE 4TN9A 1AO7E 2DQUH 5FCUH 4DKDC 1X7QB 4L5FH 3GMOA 4ENEC 1XGUB 3W9DA 4XWOD 3KPRA 4GRWH 5T33L 2WLZA 3QCUL 4L8BA 4APQC 2QBWA 5ADOH 5DGQA 5ISZA 4N5ED 1AFVL 4QRSA 3MUJA 1WEJH 2D0FA 5D96C 5D5MF 3O0RL 3MLRH 3ULUD 4PRDA 3TESA 5BXFA 1W8OA 3IFOA 3SJVD 3PG2A 4CVWA 4PP1C 3LQMA 5GIRB 3ZE1E 1C1EH 3IF1A 3ABZA 3QUKB 2BHZA 2XKSA 2R1XA 4X8XA 2WBWB 3M8OL 5JA9A 5DJZB 4XMPH 1HYSC 3E0GA 4NNXA 4KV5E 4YBQC 2IAMC 2XTJB 3MRDA 5SWZD 1ZT4B 4Y8DC 2OS7A 3CVHB 2VKWA 2Z92B 5I76B 4P2QB 4XH2B 5D5MB 3PIQA 4RISL 1PDKA 4QXWA 3F7QA 2C4XA 2EDBA 3KGRA 1UH4A 4U1JB 4UQ3B 4AEEA 5E0QA 2Y4SA 4CMHB 4Q9QL 1KTKE 1BZ9A 4HUWB 3KHQA 1J0HA 3NOIA 2RCSH 4D9LL 4G7YH 1NEZB 3WL9A 2HFEA 2D7OA 2NY1C 4X4XB 4ZTOH 2JIXA 5IFAL 3RWGA 3NBNA 3PDOA 5E8EA 4Z7QE 1OAZH 1G7IA 2HVKA 1VA9A 4POZC 2DWDB 4XNMB 1DEEB 1VB9A 5DJYA 3G5XB 1AJ7L 4FMFA 5DQJB 3RA7L 2Q6WB 4TTDD 4PLKC 4BJLA 4F7EA 4XHJD 3BX7C 4MXWH 4UV4L 5T3XH 2R2EA 4NO2A 3L5HA 3O2DA 1HH6B 1MSPA 4XBEL 3M1BA 3V6ZB 9CGTA 3HNTH 3KVQA 4OB5H 4PV9A 2FX7L 2R4SH 3UTTB 1RK0B 3AXLA 1AHWB 1OAYL 2EECA 2IPUK 5I30L 1JGDA 4NKMB 2ATKB 1FPTL 4FQXA 5DWUH 3BKYH 3MRMB 4LKXB 4L8SA 5I19L 4LCCB 1MJUH 1TJGH 1FGVL 3DVGB 4FFYH 1QLFB 3BHBA 1IQWH 4MWFA 1NGQL 4LNRB 1KEML 2OZ4L 3HI5H 4PRHD 5C0ND 5DRXA 5BMFH 1YJDC 1N8ZB 4Z95L 4KVCL 3RPIB 3BSZL 2P5WB 1FFNB 5EBWA 4MD5B 3CFDB 2YN5A 2XPGA 3KPMA 3VXUB 1QSEA 2IH3B 3WIHA 4NN7B 1M7DB 3SJVB 2EDXA 2LU3A 3X14B 3P11L 2ITDA 4W81A 2ESVE 5A3ID 1BX2A 2JKXA 2OR9H 3ULVE 4JO4H 2M26A 4XPBH 1P4IH 5SWZB 1UM4L 4OM0H 2PO6A 2UZYB 5L8JB 1UWEH 4QYOB 4Z0XB 1ORQA 3WS3B 2E3VA 4WWID 4QOKB 2NR6D 3ZDYE 5DUBA 4P2QD 32C2A 2X89A 3B5HA 4D0CB 2ICEB 1MFBL 3SGKA 4MAYB 4I1NB 1HEZA 4GXUM 3TYGH 4X4XA 3B9VA 4HWBL 4LBEB 3LY6A 1MH5B 3P9LB 1RAMA 4A2MA 1IARB 1MEXL 3QIUA 3AROA 1OAKH 2OP4H 5D2LE 1A9EB 4MAUL 2FO1A 1NLDH 2X4TA 2FEDC 2WIIA 3HC4L 2YPLB 5I1JL 3H3PL 1NCCL 4HS3B 4R6UA 4X7EC 5BVPH 4U1IA 5HSFA 1NCDH 4KDWA 2FYYB 2O5XH 3IFLH 3HPJA 1YEGH 1BBDL 1IRAY 2Q1EA 2H3NA 1KIRB 3MUGA 5AG9A 3VA6A 1C16A 4I18B 4YUEH 3NPSB 4BSVB 5I1DB 2NZ9C 4MLIA 2C5DC 4MD4A 4KRPB 3C5ZA 3U4BL 2OK0L 2VWEE 3UTTD 1NUDA 1OP3K 3D69A 5EA0H 1I9JH 3DUUB 4QRRA 5ITFB 4KI5C 2LU7A 1WCBB 5C08B 4XB8A 5IVOA 1FL5B 5B22A 3B3IB 3C6LA 1DQML 1TCRB 4XBGB 4Z7NF 1J87A 2R4RL 2VDOH 3FOLA 2DDQH 3IDYC 3SGEH 5CJBA 3PNWB 1BLNA 4N0UE 4QHMA 2MQCA 2DQHH 4H8WC 5F7MC 3JWOH 1YYLL 1TQCB 3MLPA 3JBG7 4PJFE 3TF7C 2EKSB 1YYMH 1YUHA 5SV4A 4AYFA 2K7QA 2BSRA 1GZQB 4HGMA 2Q76B 1YQ2A 4LLYA 1I1YB 2KH2B 3HE6C 2WLYA 3MREB 4QHUB 1ORSB 1O7VA 3L1OH 5DTFA 3VE0A 1MFEL 1QFWH 2X70B 3CDCA 5E6ID 1JWUA 3G5YB 3ECBB 4X6BB 3FQNA 3S37L 1JPTH 3GO1H 2FSEA 2A1WH 2WV3A 2ZPKH 3ULUL 3NFPB 2IEPA 2EH7L 1IAOA 5GRUH 3VFRA 4YDLC 4YHNB 4QOKD 4JRXE 4MNQD 3UJIL 4WJ5A 5CHNB 1EJOH 2FHCA 4XP9L 2M1KA 3U0WL 3CU1A 1AI1L 1JNLL 1EIBA 2B2XH 3UPRB 3HNSH 2IAMA 4K7FA 4HHAB 1L0XA 4X5WA 1NGZA 2ZNWA 4JZJB 1XGRB 4NNPL 1ZA3A 2ZUSA 3F6IA 4AT6A 4IEFB 5F9OL 1P9MC 3C8DA 3DBXA 4JFFA 4TSAL 1FNAA 4FFZL 1EFXB 4GAFB 2YPLD 1NBQA 3OZ9H 4WEBL 4S1SH 3K2MC 3QULA 5J56B 4FTVB 1EX0A 2C4FU 3LQAH 4XNUL 1XR9B 4RGNB 1CXFA 4TVPL 4C56E 1RJLA 1HSBB 3MLYL 3LOWA 1JHTB 5C09A 2K3TA 1I3RA 3L5XL 1DBMH 1P7QD 4IOIB 1T1YA 3OSKA 1F4AA 5ACZA 4MXVE 1L0QA 2YS4A 1XGTB 3GSRA 1NAMB 4XTRD 3AMKA 1NGYB 1PYWA 3UO1H 3CCHA 1C12B 3SOBL 5CEXB 1MFDH 5FGBA 2IPTH 1X7QA 5HGAA 2YA2A 3CSYA 3BP6B 2BZDA 3FTGA 2V2TB 3BW9A 3GBML 1RV6X 1F11B 2EKSA 4XP6L 4XZUB 4LHUD 4QRQB 3L7FB 2XXMB 4G80A 2QHRL 3PHOA 4U6VL 5TGBA 1RURL 5DMIH 4AZ8A 1PX3A 4L3EE 1D6EB 3ZYZA 3NN8A 3VDBA 3RVVD 3U2SB 3IDJB 3JV4A 4PJEB 4ZNEE 4LSQL 1MRCH 1RZJC 2PYED 1G7MA 3LRSA 2X9XA 3QNYA 4A6YH 3C9NA 5JORB 1NAKL 3FN9A 2VR9A 2ATPB 5HJ3B 4DTGL 4ZSOB 1D7FA 1TZHB 2EYSA 1MHEA 2CLVA 1NGWB 4DGIH 2CLRB 1BQHA 5ILTH 1CL7L 3O3UN 3QUMH 2RCSL 2DOCA 4KGLA 3DVNB 5ESQA 3LEVL 4FFWC 1BWWA 1HH9B 4QTIL 4KQ3H 1Y6MR 1KCSH 3KPQB 1IZKA 4WFGD 1EMTL 2CO7B 3VU2A 2GAZB 2X1QA 4OZGA 1JE6A 3UZQA 4N68A 1QRKA 5DK0A 3WE6A 2F5BH 4GRLB 2GITB 4M6MH 1CFSA 3UEZA 3FQXA 4FQLL 1X9QA 1YNKH 2JCCB 5H35A 5FOBA 4LSDA 2W60B 5HYSG 1XF3A 3ARGD 2EYRA 4KJYB 5T1DL 3VXRE 2PW1A 3GIZH 3H3BC 3RRQA 4KMTL 3UTSB 3KG5A 2HLFD 4RQQB 5LBSL 4YHOH 4UINL 4LMQI 3MRQB 4P5TC 4WI8A 4JFPA 1E4KA 1JF1A 4QWWC 4ZOAA 4NT6B 1I3GH 1Z5LB 4IMKC 3IAPA 1I3UA 4NSKA 1EO7A 4IRJC 2QL1A 2XZCL 3U6RA 4RIRA 5BS0E 1U8OB 2GJJA 5L8LB 4Z76A 4HPOH 2HT2C 3G6JE 3QZWG 3D5OF 2ITDB 4EOWH 2ADIA 3OAUL 2FHFA 4JRYE 3QUYC 4R90H 5F3HA 3BMVA 4MNGB 3VFMB 5E9DA 5IJKC 2LVCA 4XVSL 4LLDA 1KNOA 1JIBA 1ERNA 4QXGH 1S9WB 3PL6B 2ENSA 2OL3B 4LHUB 4GOSA 5JO5A 1C5DB 3C5JB 3KPSB 5BW7A 4Y19A 1ZS8A 1I9RH 3REWB 5EO0B 2YSSB 3PWVB 4KKLC 4HIEA 3TBTA 5CSBA 4ZPTB 3CCHB 1TLKA 3ARED 3SCMA 5BVJB 2DD8L 3BQUC 2OX5A 2QSTA 4M48H 4QRPA 1SYSA 4F8TA 3QCVH 3MOAH 4KC3B 2PYEB 5EO9B 1A1NA 2CDEA 1BJ1H 1MI5A 5D7JA 3RVWC 3RWDB 5ID1B 2V2TA 1XGYL 3BISA 4NUGL 3L7FA 2HJFA 1CK0L 1XF4A 1MFBH 3ZYJA 1HOCB 3O3BB 3LMJH 1CE1L 4CU6A 2D31B 1CLYH 3U82B 3SKOA 5E00B 2Y07H 3W0WA 4MVBD 1U95A 2FYYA 2FR4B 4PJIE 4FQIH 3SY0B 1J8HD 3ARDC 2BC4A 5F71A 1HHKB 5T5FH 3LRGA 4RWYH 1NLDL 2M2DA 4M8QA 1DN0A 3TO4A 5ECJE 1LDPH 4BSWA 4DKEL 5MEPA 3VFVA 3VFTB 1I7ZB 3CC5A 3HMWL 4GRLD 4UQ2A 2C1PB 3PHQA 3K8LA 2Q8BH 5FM8A 1MJ8H 5D8JL 2YPVL 4WUUA 5FYJL 4Z6AT 1FN4B 1A1MB 2C1OB 2WK2A 5FHBH 4FXLA 4RQQA 2D2OA 5IFHL 2CKNA 3ARGB 1Z0MA 3H3KA 2VAAB 4P46D 4JLRA 3RNQB 2OXGA 4GW5A 3GKWL 1OD7A 3TNMB 2IANA 1KPUB 2FGWH 4MAYA 4FQ2L 3EW3B 5C0FB 4GRLA 1QA9B 3X12A 3LB6C 4OIAA 1GL4B 1S7VB 4HH8A 5L88L 4G8GA 3QIUB 4NZDA 3FFDA 2WBJA 1DQMH 5I1LA 3KS0J 3LKSB 4JRYA 3RVXD 2R4RH 4YGVA 2W9LA 3O4OC 1PZ5B 4XRCB 1YECL 2H1PL 5CINH 1MCIA 3EOAA 2IPKA 1NDGA 4LAQL 4QHUA 3JWOL 1LNUB 1NMBL 3HG1B 2Y6SD 2YD9A 3WFEL 5KSUB 3QUXB 2GFBB 4F15C 5KS9A 4XT1C 3IFOB 3KYNA 2X1XR 3WS6C 3CFIC 5GZOD 3CNKA 4PJ5D 2LAAA 4P3DA 2DQDH 1N4XH 5F7LB 1NQBA 2QQNH 3VWKA 3W9DB 4X0KB 2I5YL 3ZZ1A 2LABA 3IKCA 1OP9A 3MRPA 1L7IL 3EZ8A 1F97A 3GMRB 4NQUA 3PDGA 2IG2H 1NKRA 2BNRE 3S5LA 5ISZE 3WD5H 5BZWA 5GGTH 1P6AB 1T2QH 3N1QC 5KN5B 2XZZA 3LQZB 3W0WE 1IGFL 5JO5B 1WZ1H 3U0WH 3WO4C 3VGFA 1M05A 1NAMH 1KTLA 1MJJB 3GSXB 1CDGA 3WUWG 3K4AA 2VIRB 5E7BA 3BN3B 3I6GB 4UIKL 4QY8B 5F7WC 4LOUC 4YHLH 3IAGC 4L5FL 1NC2D 4Y5YB 4L9LC 3HMXA 4ZUSA 1JWMB 2C7UB 4OV6F 5GRYA 2Z93B 4XNMA 3UZEA 1T89C 4YFDB 4NDMA 4NKOA 4ONFH 2EXYC 4HC1H 4XH2A 5D5MA 3NACH 1B9ZA 3V79C 2P8MB 3EO9H 2A0LC 4ODTL 4BQ9A 1WEJL 4XPHH 4NN6C 3C08H 4IRJA 4JG0H 4BFIA 3BYTA 3QPXL 5DRWA 1F4WL 1JL8A 1C5BH 3AAZB 1H3PL 4S1DC 2N56A 4HHAA 4MS8D 4PP1D 2O93L 2FATL 2VJXA 4Z5RA 2LFGA 1PG7W 1ETZA 3CVHH 2HKHL 1M1SA 4KTEH 4LLAA 1TZIA 3AU1B 2VDLL 1SJHB 3DX9B 4JFFB 4KK6C 3PXHA 3U30C 4KKAD 4PLOB 4X6CA 4LEOA 5E4IA 3W82A 2BP3A 3RWEB 3CK0H 4HKZB 4ONGH 1TJHH 1EVTC 3LRSB 5EO1A 3GJEA 3ALXA 4H20H 4U1MA 4GS7B 4PY8J 1KJ3L 4JY6A 3FQUA 5CBAA 1MIML 5E9DE 1RI8A 1PW3A 1MPAH 2XPGB 3BDYL 3VXUA 2EXYD 3CSGA 1RIVL 3QUXD 3IVKA 3SJVA 3QA3A 4U6HB 4HIJA 1MREL 3VFSA 4G80B 4F7MA 4A6YL 2Z8RA 1YDPB 3K3QA 4Z7WF 4JPVL 3WIHL 3PWPE 2HN7B 5I0ZA 2MMXA 3DVGA 5C0BB 1PEWA 4EIZC 1IC1A 5MEQB 1N8ZA 4TUOB 4P23D 2YN3A 3KJ4B 5D1XC 3TJHC 4ZAKA 4PJBB 4XI5C 3QUMA 2ZSWB 4XZUA 3OB8A 4GBXC 4QRQA 2FX9L 4NKMA 3L9RB 1GH7A 3MV9E 5ALCH 1KXVC 3BGMA 1JRHI 2FX7H 1A4JA 2DQJL 2R4SL 3BZDA 5JOEA 5GSVB 2CMRH 2HRLA 2IADB 2AXGA 2BRRH 2F19H 4N8CL 1XGQA 1KB5H 3RY4A 4HCRH 2DQGH 2E8ZA 3B9AA 5ICXB 1OGAB 1NC2B 1BF8A 3KPSE 1G7HB 1T21B 2XACC 2WBKA 1KOAA 1Z9SA 1R24B 1CD0A 1UACH 4OF8A 2AERT 4S1QH 4Z8FH 2MKLC 1MCWM 3QG7L 3MPCA 5IWLC 1JPFB 3MUGB 5D2NA 4G8EA 3JV6B 1NANH 4KVCH 1QZ1A 1JTTA 1QYGH 2VR4A 5IB2B 5EN2A 4P2RD 4AH2B 5B8CB 3S5LG 4NGHL 3EIFA 3MC0A 2RAMA 2J5LB 1CXLA 5CEZD 4O00A 1RD6A 4XNZC 4JFZL 3IU3A 1GPOL 4ZXBC 5JUEH 4ZPVB 2LV4A 5TDNB 3SDXE 4F7CB 5ID0B 1CLZL 1CU4H 5FK9A 5J57B 2LTQC 4IOFC 3WFCH 1YEJL 5CJ5A 5CMAA 2JJTC 4JFFD 4QXTA 3K2UH 1RULH 4Z7UA 2A77H 3UCRA 3RIAK 1PQZA 1MH5A 1CGVA 3SQBA 1KB5A 3BWUC 4OZFG 1DUYB 2FIKA 1FVCB 1INQA 4PJXF 4MJIB 2YEZA 4R2GC 1E4XL 3DSNA 1DUZB 2H2SC 4UT9H 3ROOA 2H32A 1SM3H 1UJTA 3SKOB 4ALAH 1T83A 1AE6H 4N0CC 4OD3H 4PGDA 4BZ1H 2X42A 1NCCH 3QQ4B 3ZTJG 1J05B 1SEBA 1IAIL 4MLSA 2PTTA 4KWUA 4JFXB 5DRZB 4RGMB 2A6JA 4P23B 3RWIA 4B53A 4K94L 5DC9B 3OKEA 4XVUD 5FO9B 3QZWB 5DD6B 1WAAE 2BFVH 3C6LB 2X09A 2BVPB 4X98B 5D7IA 2OK0H 3PGCB 4HLJA 1I9JL 1YDPA 4P5MB 5E9DD 4UT7H 4Q6YA 4ZUWB 4KK9C 1A14L 3QI9C 4J23A 3QQ3B 4TNWF 4HFUL 3D87B 2DIJA 2W0FB 1OGAD 1J0KA 5LXGH 5IB4A 3GI9L 1I75A 1ADQH 2UWEA 1WITA 5IFHH 2P48B 4PS4L 1T80A 2FCBA 1BM3H 3CFJA 4YNYB 1E4XI 3RWHB 1BBJA 2DI7A 1KSRA 2EH8H 3MZTA 2OMNA 3VFUA 4RZCA 5C0AA 3H7LA 3WIIL 1QR1A 4EN3A 4KPHH 1EZVY 4ODWA 5EOCL 1WFNA 4Z77A 3ZYIA 2PCPA 2XA8L 2VMFA 2FZ3B 3W11D 1FBIH 1LO0L 2Y7QA 2OSLB 4WW1B 1WV7T 3O4LA 5HGBA 4LAQH 1Y6NR 4PJ8A 1WWBX 2KPNA 3QDMA 4I0PC 4KK9D 3TGXA 1FN4A 5EN2B 5LGJA 1P5VA 3WNOA 3ARBD 4S1RH 2R69L 1XGRA 4PLKD 2EZ0C 5CP7A 4YDVB 5F9AC 1OF2B 1WK0A 4FXGA 1VENA 3OKOA 4D3CL 3MOBL 2AABL 5M7QA 1AIFB 1JZ3A 3L3OA 4JKLA 5I74B 4RAVA 4HGKC 4TSAH 4NO5B 4L8DA 1PY4A 4G6JH 1KLUB 5AZEH 1OWRM 3FJTA 2VQ1A 2VLKD 1FNEB 3C60A 3MGOB 1MHEB 1KIPB 3CIQA 5MI0C 4M5YH 5KOVC 4ISVA 2BXZA 3D18B 1KJ2H 3R06A 5E94B 3O6KH 1RQ5A 3GSNB 2BVPA 4X98A 3BPNB 4U0RB 5DR5H 3NABH 5CEYA 1GGBH 4Q9RH 5DD3H 2JELH 3B2VH 3B9EA 1F8TH 5D1ZB 1QBMH 2EZ0D 4P3DB 4V1DA 3RDTA 4OZIA 1JPSL 2HLAA 2VXQH 3W2DL 4JPIA 3L95A 3K80A 5E56A 4S0SD 5J13C 4L4TE 5F7DB 1T2XA 3GMRA 3OXRA 2OJEA 3KYOA 1QFWM 4RMSA 4TQEL 5DLML 4XP6H 4IRSC 1D5XB 5TF1H 5FO8B 2GK0B 3VMNA 5IW3A 3VJ6B 4X6DB 1HIML 1CXEA 3OGCB 1C5BL 1QNZL 3UJJL 3A6BH 3DSFL 4LFHG 1FCGA 3U7WH 2VQUA 4K23H 1JGLL 4G43B 3RWCA 3CVHL 5HHOE 2XKNA 4GAYA 2WZPD 1BVLB 1DQLL 2YRPA 5IB1B 5F7KC 1D3CA 1SBSH 4KROD 4LK4A 4WI3A 1T6VN 4WO4B 4PLNC 5I1CL 2JLLA 4I18A 3TV3L 4DVRL 2GW5A 5BRZD 3WSQL 6FABL 3CK0L 4AK1A 2VE6B 3LHPH 1WT5C 1U8IB 3RX5A 3M07A 2WIIB 3RI5K 1OGAE 4Z5RB 1NL0H 2F15A 3VGAB 3QSKB 5DD1L 1YZZA 5ILTL 2VB5A 1IGJA 3OKKB 4G9FA 4GSDL 1M4KA 2AJ3A 3C8KA 2GITA 5CZXC 2IGFL 1KYOK 5EU6A 4LKCA 2X4PA 4R7NA 1J86A 5IF0A 5TQ0H 4N8VG 1MCJA 3GI8H 3S34H 4JB9L 5E5MB 4G42B 2D7PA 3GKZA 4X8JA 2OR7A 4QGYA 5IK3A 3V4VL 1N2RA 3VRLE 2NY7L 1ES0A 2P4AB 4WENB 4UAOB 1OQOA 1U8QA 2APFA 2FO4B 2Q76A 3MRFA 3OF6D 4PJDB 3L3IB 3SE8H 4G6FD 4YHOL 4P48A 3DMMC 5L2KE 4ODBD 5J11B 4PJGE 5JHDE 1F90L 2P7TA 3SDDD 2CD0A 3QFDA 2QEJA 3AUVA 3TBTB 2GJZB 5DGRA 4PLJC 2AXFB 2OJZL 1RZ8B 1OTUC 1X5JA 4LQFH 3L9RA 3VFMA 1JF6A 3C60B 4NBXB 3D69B 3SDCB 1IEBA 4EDWH 2V7HB 3N1GC 1ZXQA 4CADA 1FAKT 4YBLB 4EUPA 5EO0A 2J8HA 3P73B 3FOLB 3SDYH 3X3FL 5KSBB 4PB0H 3CFKA 3D2UA 2WM0A 1KTDB 4PG2C 4E9LA 1HCVA 3ESVF 4R26H 5C0AE 1FFRA 4ZAKC 4XP4L 1NCBL 1RUAL 1A5FH 5EULV 5IBTH 4NWUL 5D7JC 4RISH 2R1WA 1DUYA 2FIKB 4MCYB 4M9PA 2F53B 4UT6H 1AD0A 2QKIB 5B38A 3MRBA 4Y1AE 5KG9A 1NCWL 2ZNXA 1AGDA 1JPST 4JG1H 3GHEH 4OCMC 3Q6FB 4YE4L 4Y4FA 4EN3C 2VAAA 5J3HD 2MPAL 3MTRA 5C9KA 1PKQA 1JZ7A 1U93B 2BY0A 2DICA 5IB3B 4N0UB 5IB2A 1UA6H 3BP4A 2C1PA 1W0VA 1XIWD 4TVPD 2HJLA 1DVFA 3ARDD 4HBQA 4DKEH 4U4BA 3TCLB 4BUHA 1HCFX 5C0CD 1UXWA 4AM0B 3P77A 1UKSA 1P53A 4GRMB 3GMNB 5IMLA 3K1KC 5KSAB 1REIA 3Q3GB 4DWHA 3DIFB 4JVWA 4DOHB 2YMXH 4X6FB 2JK5A 5IB5B 4DZ8A 1U92B 3RL1A 5LQBL 4LFHD 4EXKA 2RR3A 4R3SB 4UDUB 4HIXL 3QIWB 3GSXA 4UV7L 3MA9L 4XAWH 2C3HA 1AC6A 4BKLA 2YD6A 4G6FB 2X4RB 5GRVL 1QFOA 3RWHA 4MA7H 1LO5B 4MD5A 5F3BA 1WT5A 4HJJL 3RWIB 3SDDB 5L88H 1M71B 4YZFE 4O58L 4MJ6B 4YHZH 3IDJA 3MRGB 3IJYB 1UB6A 1YECH 1A7PH 3PWUB 5E5RB 3SDCD 4GAJH 2EYTB 1IJ9A 3CMOL 1J05A 4OKVA 2IPUG 2HTKC 3QFJB 4JFXA 3ZKXB 1IAII 4Y0GA 3K1DA 1F3DJ 4H26A 2AEPH 3KR3H 3IKCB 3ZTNH 2GJZA 2EO1A 3HPLB 1UWEL 2HT3C 1FBIL 1LO0H 3OQ3B 4RGNE 4ZO7A 4JFEA 1IM9A 2JJSC 3TO2A 1Z9LA 1J9CT 1I8LA 3MJGX 3KLAA 3PWNA 2VRAA 2GT9B 1EO5A 5JHDD 1PAMA 1A3LH 1W72A 4KRMB 4XCCL 1Z2KA 4EVNA 1P7KA 3GNMH 3LEYH 1CICC 1I7RB 4GJTB 4Z7WE 3MXVL 1A6AA 2MNUA 4WWKB 2Z4QB 3VFNA 3WYRA 3VD9A 1CE6A 2H45A 5F7EH 4MDIA 1G7PB 2MCG1 5LWYL 2PW1B 3H9SA 2HMIC 4ORGB 2XG5A 4Q0XL 1GIGL 5J6HB 4L3EA 3UTSA 1JI1A 1K6QL 5LGJB 1P1ZB 4F80A 2O5XL 3PABA 1XIWB 2OYPA 4N0FB 1F4XH 5IHZB 5GS2D 4M62L 3EDJA 3RWJA 5AZEL 4P2RA 5IEHA 3BIKB 1QSFE 1VEMA 3UJTH 4PD4K 3DX7B 5GGQL 3ZHDA 4Z18A 5KSAD 5LG1A 3NACL 2AK1H 1SJEB 5DS8A 1I1AD 3S35H 3B2UD 5HPMA 4F9PC 2XIDA 5DR5L 1D5BA 3VXUE 1RZIB 4JG0L 1OOAA 5D1XA 3SJVE 1KBGL 5F7FA 5ID1A 3IDXL 3AY4C 4E41D 4M7ZB 3HE7A 5I18L 2VXQL 1FH5H 3O45B 2BSRB 2VNCA 2NLJB 4PV8A 1FO0L 3UBXB 2FIRT 2VXUH 2CRIA 3NVQA 5F9WB 5FGBC 4JPIB 4DN3L 2FJHA 3VXRA 4HZLA 1QO3B 1Z3GH 1MCHA 1RUML 5F7DA 1C1EL 1CDJA 3GJFK 2FJFA 3UJJH 3BEVB 5L0QB 5F3HB 1BF2A 1FO0A 3WNMA 1RJZB 4AEHH 3M8OH 1MWAL 3VA2C 4AEFA 4PJ5A 4U6XB 3V0AC 1N0XH 2ZPKL 2OL3A 4LHUA 3TVMC 3ULUH 2VISB 1S9XA 3MLWH 2X05A 3WNPA 1ZS8B 4F58H 3AMLA 4ORZC 1BECA 3EDKA 2VDKL 5JHDB 4XPGH 5FA4B 1CFTA 1AI1H 4ZQKB 5EZJB 2V6HA 3THML 4Z7UE 5DD1H 4G8IB 4WHTA 1PQZB 3P4LA 4PPTA 3QAZB 1CIUA 2EC8A 5D6CA 1AGCA 3VXMD 5DVLA 2H9GB 2DWDA 4JRYB 5IOPA 4HJGB 2FX9H 4U3HA 5D72H 5SWSA 3D3VE 3MACH 1AP2B 1G6VK 3TNNA 2FWOA 3LSOB 1BOYA 3EFFB 3DXAD 1HZHH 8CGTA 1J0ZA 2F19L 1KB5L 3ZKMC 3TPUB 1MWAB 4LRIA 2N1KA 1FNGB 1Q9LB 5FK9B 4GQPH 5IF0B 3MNVA 1YEIH 4M1CC 4P3CH 4WWKA 3O9WA 1IGYA 3CC5B 2P45B 1MFCL 3MNWA 4Z7VE 4ELKB 1NLBL 3GUTB 4DKFL 2W0KA 2G75B 35C8L 1H3WM 2GTZA 4HWZB 1NDMA 3CDGB 2ADGB 3O2DH 3CXDH 4O2FA 3ZDXE 5I30H 2IANE 5C07A 4AY0A 1IFHH 4XX1E 4ZO6A 5I9QB 3QNZA 1HKFA 3PL6C 4YHKH 3SHSA 4LQFL 2VLLB 4E41B 4O5LH 4P5TA 4X6DF 4JFZH 4YIQB 1MELA 2YK1L 5DRNA 3D2UB 2EDNA 5CBEB 2FH8A 1QBLH 3D85B 3QR2A 4YHYB 4EDWL 4JVUA 2QHRH 2AI0L 5GRVK 4POYA 2XWBA 3IDGB 1F58H 5F93C 3MRPB 3SKJH 3U83A 1KJ2B 2R0LL 1R6VA 4TTGA 12E8L 1GGCH 2YD3A 1T20A 2J1KA 1OLZA 4XP5L 3NN8B 2NY0B 3NAAL 2XYCA 4ODUA 4V1DD 1R3LB 5B4MD 5EU3A 6CGTA 3LDBC 3QBTB 2X5PA 3QQ4A 4X5XB 2HT4D 1X3DA 4QEGA 3RUGE 3WLBA 1HYSD 5KTEL 1KACB 5TE4H 3C5ZD 1UJ3B 5HDQL 4CVZB 43C9B 1Q94A 2AK4D 1B0RB 3LN4B 4WHDA 3DV4A 4NOFA 1EMTH 4HUVB 5CKGA 1MCWW 3MXWH 1IGTA 5CJOH 1R5WA 3IU4L 4XMKL 3TN0A 4EJ1C 1OGTB 1UG9A 3JTSA 2F5BL 4R4BA 4BSJA 4PJGA 2P24B 1A6WL 1U36A 5EU4B 1NGXA 4JRYD 4HULB 2JK5B 1FG9C 5IB5A 4DCQB 5HDBF 4WUKH 3TBWB 1IVLA 3HC4H 2Q87A 3QEQA 4J3SA 2D3VA 4JFPB 1S7TB 1FL3B 3P4OA 4QT5B 5IB3A 4PBVC 5H35B 1WZLA 5DEGB 4LCWA 2YMXL 3CSBA 4PREA 4PS4H 1AD9B 1G9NC 2HFGL 3OX8A 1L9MA 5MEOB 3TCLA 3KDMA 2WINA 7FABL 1WBYB 5C07E 4ELMF 2VABA 3C5ZC 2EH8L 1XFPA 2F74B 4DQOH 3RKDD 5KVFH 5F72S 5JXEA 1RMFL 2M8XA 3KXFD 3BZFA 2NCMA 5GZND 1ZMYA 4O58H 4YHZL 2G60H 1FNGA 1Q9LA 4F7TA 3B4NA 3QYCA 4Z7VF 4OFDA 1JV5A 1Y0LA 3UTQA 3TBYA 5C0GB 5MENB 1F5WA 1TZGL 2AJZB 3L5JA 2E7BA 2UVEA 3W11C 2CJUL 2UZIH 5HHVL 4D9RE 3T0XA 3GMPA 1BVZA 1U9KA 5DURB 4YC2C 4OLZH 4PY8I 4R0LA 4JFHE 2YUZA 4MNQE 1T7YA 1AGEA 4LGPB 1J8HA 4U1HB 4YXKL 5GJTL 5F8QC 1G7HA 1T21A 3V5HB 3QCVL 4W4OA 3CSPA 1R3LA 4AMKH 4Y4HD 1DE4A 4U1LA 1XGYH 3FHQA 2FR4A 4I3RH 4NHUB 5HYIA 2AABH 4QRPB 4V1DB 4NWTH 4B7IA 2VN7A 2BK8A 1JPTL 3GO1L 4G8GE 4XCCH 4UUJB 1CR9H 5EO9A 4RDQF 3ES6B 5GSVA 4GMSL 3K46A 1ND0A 4RNRB 3AM8A 5GRJL 4FQIL 1EJOL 2PETA 1G6RH 3LEXB 3S88H 4PTUB 5JW3L 1VEPA 2UV3A 3DGGB 2CRYA 3QQ9D 1E4WL 5LGHH 1LQSR 4CGTA 4HWBA 4TUKH 5IVNA 5EZIH 3BPCB 2DQCL 1IAKA 5SWSE 5C2BL 3M17B 2Q8BL 4HUNB 3KNBA 4ZO8A 3QH3A 5E5UB 1A7OL 2IF7A 3GBLA 4OI9A 4P4KA 1GSMA 1A2YB 2BNUA 5CGMA 3RZCC 3PP3K 3N0PB 5C0EA 1G7IB 2ADFH 2W38A 3TBVA 4CL7A 5I71C 2BOCB 2E9JA 4JRWA 1TVDA 2W0PA 3EYSL 1QSVA 1VEOA 2AQ1A 3DRQA 5ESAB 5GHWL 1W2KT 2EIZA 3ZDYF 4N0FA 5IHZA 3S35L 2VDRH 3BUYB 4F7CA 5ID0A 5DLMH 5HD8C 2X4QB 4G6KH 4K3EH 5CMAB 3MV7B 4BZ2H 3QHZL 4KXZI 1JYNA 2DLGA 1HIMH 3C8KB 2P1YA 3FB5A 4WHYH 4Z7UB 3WNNA 1U8JA 2B7DT 3K81A 1JUFB 5HGGS 1S7VA 3KXFB 2ZJSL 2Q8AL 4LKCB 1H3UA 3CLEH 4FQJH 3UO1L 4M61B 4J6RH 3L3JB 3GSWA 4O02L 1DQLH 3BAEH 1U8IA 1Q38A 3QIBA 3OG4B 1BOGA 1TQBB 5MEOA 2Y5TA 5E1HB 3HS0A 1MAKA 3LS4L 3FOMA 4L4TA 2G9HA 3A6OA 5EZOH 4XPFL 5DJ2A 3MLUH 4D8PB 2J88H 4RAUA 5DF0A 4CU8A 4HLZG 1RURH 4BK4A 1BIHA 1Z0NA 3DTXA 4NQEB 1GGUA 2J8UB 1VFUA 4WIQA 1QEWA 4TNVK 5A43C 4BQ6A 4MX7A 3KPMB 1HNFA 4XAKE 2FB4L 4Y4HB 1CZ8L 1OP5H 1QTYT 1IKNA 5JPNB 4GBXB 5C09E 2R1WB 4UMGA 3S34L 1IGFH 5I73C 1H0DA 4DEPB 4ODVH 5DA0B 1FAIL 3PHOB 1P7HL 1CXKA 5D7IB 3BESR 5DZLA 4IRZH 4POZD 3AB0B 2E7HA 1K85A 4P59H 3U2SA 4IRSA 4JRXD 1KULA 4X6CE 3PP3H 3QP3A 1K3ZA 1M05B 5HDOA 1NUFA 1G7QA 1KCSL 3RQ3A 3OKNB 5FOJA 3MA7B 4HZLB 4J3WA 2K9UA 1U58A 1UM6H 1HZHL 3BVNB 2VL5A 4AIOA 3HE7D 5JIKA 4L1HA 4HUKB 4ZUUB 4HKJB 2E7LA 4G9FE 1Q9KB 4ODTH 2XQBH 4ZNCD 1T4KA 3QEQE 3BGFB 1QACA 2J5LC 2AJSH 5CJXA 3UYPA 5KVMC 5E8OB 3OJVC 1H5BC 3VXSD 1TZIB 1A4KB 1LP9E 3QPXH 4OF6A 4W68A 1MCLA 4G8GD 2IFFL 1F4WH 2OZ4H 3HI5L 35C8H 5E2UH 4DZ8B 2OL3H 3KS0H 5JA8B 1YN7A 3MRLA 4LHJB 4OI7A 2Y36H 4JREC 2VDPL 1PKQB 5EO1B 3MV7D 2X10A 1WQVT 2R2BB 1TIUA 4PRPD 2YK1H 2VLJA 5EU7C 3VCLB 2ADGA 3AU1A 4OCRL 5AYQA 4KKCD 3VG0H 2R8SH 4EOWL 5JW5B 1T03H 3FFCE 4KUZH 3PIQB 4P5KA 4I3GA 4LPXA 1L9NA 5AUMA 4P2OC 4LCWD 5I8KH 1JJUA 1QSZA 2HYMA 4PJ7E 4YDIH 1MLBA 1A6PA 4BH7A 1OTTC 1I9RL 2XOTA 2LQRA 4N9OB 2FJGA 3TYGL 1BMGA 4NQED 4R8WH 4HWBH 5BZDA 1J8HE 2DD8H 4M48L 5D71H 1I8IB 3DJ9A 2F54B 4P57B 1IGTB 1YN6B 4DGYH 1OGTA 1UWXK 4J3VA 1NMAL 5IW6B 3RWFA 1A7RL 4WEUD 3C6LC 2F58H 2YD5A 1SMAA 3O4LE 5ALCL 1YC8A 3VGGA 1WC7A 3H6JA 4X5XA 5HVWA 2V7NB 2X40A 1X5IA 4X4MA 1A6WH 3F7VB 4YUEL 2F5AH 2IALB 5T5FL 4C57C 4QHKI 1KB9J 1GGIH 1ZHKA 3NGBB 1WLHA 5I8OH 2YKLL 5JHLH 4F9LC 4M3KB 3MLTA 3CVIH 4POUB 1TITA 2YBRB 3VWKD 3MYJB 2DF3A 1E28B 4PJ7F 3ZMRA 1BAFL 5JLZB 1A6VH 4F7EB 4A2LA 3P3YA 1TVHA 4RGOH 3MLXL 4K07A 3LIZH 1EGJA 4P9HL 3IJHA 2GSIB 4OAWB 7FABH 4QRPE 2SEBA 3BT2L 3GM0A 1RK1A 3L3HB 4G8GB 1S3KH 4MHHI 5JIHA 1XR9A 3G6DH 1BEYH 1U91A 5ERWB 5TH2B 3O6LH 3TCXA 3MBEB 4GW1B 3WEXA 3VCLA 5GRWA 5TPWL 4UIMA 3GRWA 1EHAA 5LAXB 3ULUC 2KQNA 1BD2A 5I17A 2AJ3B 3D39B 4YHPA 2BX5A 1MCSA 1SYVA 1RULL 5AUMB 5DQDL 4XGZB 2CJUH 5HHVH 3PWPB 1AQKL 1A3LL 1UCBL 3QISA 3P4OB 4MA1C 3RI5F 2BVOA 1V3KA 3VFNB 2ICEA 2FLRT 2GJ6B 1QA9A 3HG1E 4LCWB 1FDLH 5ALBL 2Y1VA 5AYUL 3P4MA 1G7PA 5GJSL 5C70A 4I3SL 1LO3L 1B4JL 4Z7QF 1AD9A 5GJTH 3OAYK 5AAWA 1DZBA 2BY2A 4AG4H 3H9HA 3HZYA 1WBYA 1G0YR 2QQNL 2VLRE 2X9YA 2C9AA 2I5YH 1OPGL 2G2RA 4XXDA 5TE7L 4UOW0 1CF8H 4QF1B 1OCWL 3IRPX 3S4SA 2X4OB 4JN1H 1K4CB 2F54D 2FEEI 3MV7E 4OCXH 1IC5L 4PJEA 5IG7A 3E3QE 1QRNB 3GSUA 3ULVL 1EEYB 2PO6D 5BW7C 3F12B 4PRPE 1HHGB 2NY6D 3RGVB 3WUZA 1B0GB 4G8IA 4AEIL 1HXMA 3CFDA 1RVFL 1WWWX 4HBCL 5J8OA 1E6OL 3OKEB 4OM1H 3VWJC 3OR7B 2BVTA 3ROLA 2KL6A 1VPOL 3WXVL 5KSVB 1QLFA 4QGTA 2CGRL 4KKAC 5DURD 2HVJA 4Z7WA 4ELMB 1FL5A 5KN5A 3IDXH 1P2CB 1JCKA 4NQEE 3UBXA 4XBGA 2P5WA 4N9GA 3U4AA 3BFOA 1KN2H 1N6UA 2P5ED 5DJXA 1D6VL 2WMPA 4H8WH 4L9DA 3WHE0 2P43B 2P7TB 3OAZK 5BV7H 3ILPA 4I48B 1HI6B 5BO1L 2FJFB 3O2VL 2E7MA 1AKJA 2Q7NA 4H0HB 3EGSB 4WO4C 5FB8A 3QHZH 2DWEB 3HAEA 4GRWB 1ZVSA 1FNSH 3WJLC 4W70A 4R96B 1EPFA 4PRAB 2FATH 4AEHL 4X6CB 4OFPA 3MBED 5KSAA 4RRPA 4AL8H 4P5TB 5K93A 3SBWC 5D1XD 3TJHD 1JF1B 2DLEA 5GS1B 1LVEA 4XI5D 4IDJL 4O9HH 1J12A 1DN2A 1QEWB 1U2CA 4OIIH 1PVHA 5IBLC 5EU7E 1ZANL 3MNVB 5I0DA 3BOVA 1NANI 4HSQA 4OF7A 4NNYA 3P77B 3O11A 5LVEA 1CL7H 3QIBB 3V6FA 5L9DL 1AP2A 3LKRB 3ZE0F 3MRBB 2J2ZA 2OR8A 4YAQA 4KQ3L 3ZE1F 5LAXA 2BMKA 2VDML 1NFDA 1IQDB 1CZ8H 3PGDA 4CDGC 3GJFA 3I75A 4KJPC 3FB5B 1RIHL 3ARPA 1VERA 3QWQB 3BWAB 2DLTA 3VFRB 5I66B 4ONHA 3DUSB 5E8NB 5IESL 1KGCD 1N59A 1SY6H 2NY6B 4I2XA 4HQQH 5DJZA 4JJ5A 3O9WC 5FCUL 3D6GA 3V95A 5DVMA 4MB3A 2OJEB 2A6KB 3C60C 1OGAA 1JHLH 1GGTA 4LCCC 2HWZL 4KRLB 4Y1AB 4Y5XB 2FEEL 1A4KA 3QCUH 1VGKA 1YNLL 1P2CA 1ZLSL 3PWLA 1S5IH 1G0XA 5JR1H 2H26B 3KPRD 3SY0A 1L0YA 4YDKL 1OSPH 1D9KD 4OZIB 2XQBL 2HLAB 3I3BA 1W0YT 1BFOA 1WF5A 5TE6L 3FT2B 5JIIA 4QWWD 1UACL 4S2SA 4I48A 1YEKL 2ZUYA 3DARA 3MROA 4HAGA 3BXNA 1X5YA 2P5EB 3NH7H 4KJPD 43C9A 1LD9B 2PUQT 5TQ2H 3G6AB 5GGRY 1T20B 2R29H 5FGSA 4XC3H 3DYPA 5HDLA 3D1MC 3RP1A 4XMPL 5H37G 1I8LC 4LLVA 1FJ1B 4KGJA 3P0YH 2HVJB 5C0DB 4FQCL 3ARGC 3BZEB 4DFHA 4DOHE 3JVGA 3HUJB 2FHBA 4NJAL 1NAMA 3J7HA 3SCMC 1OTSD 3DMMD 2HMID 2Z9TA 3EOTL 1NUNB 4P5TD 5GGVL 4JQXC 1YEJH 1CDIA 5I2IA 4KFZC 2B4CC 1B6DA 4P3WA 3ARFC 5CKAA 1A6TB 2OQJB 4LSRL 2HT4C 3GMPB 1RJLB 1CT8A 3EUUA 3FT3A 2F9BT 4PRNA 4OD1L 3OKKA 1EFXA 2A38A 2MKWA 5C6TH 1B2WH 4NFBA 3U7YL 4U3XA 4D9QD 3SE3C 4PRIA 3BE1H 1ZKAA 4MJIE 2DBLH 2D4FA 4PGBB 5HGDA 4RDQG 1QBAA 5SWQB 4U2YA 3NPSC 2EE2A 3JV0A 4WUUD 43CAA 3A0OA 1A7RH 2AV1A 1AO7A 3QIWC 1YPZA 1P4BL 3RZWA 3QJFB 3GBNL 3N85H 3EYQD 3LV3B 3KDMB 4K9EC 4ZFFA 1VACB 2YPVH 4JDZB 4PJCB 4F7PB 4M8VA 4C83B 1BX2B 1J88A 4U1SB 2X89D 5DJCB 4APQA 1Y18B 5IEKB 1D5MA 2UUDK 2A9NL 3NFNB 5ANMA 4LL9A 3RVWD 2OTWA 1GGIL 1X5FA 5EIVA 2RBLA 3ZE0E 2J8UF 2VZVA 2DLIA 4UNTA 3DMMA 5JDSA 5KVFL 4Y1AD 2UWEB 2KBGA 1UH2A 4BELD 5A2LH 2H8PB 5GS0H 2EDEA 5CZKA 4MXQD 5KSBA 2GCYB 3PQYA 1HINL 5HI3D 5EZJA 5F7NC 3STZB 3BXNB 3JWDC 1D9KB 1BBJB 3LIZL 1YQVH 5TGBB 5INCB 3WKNA 3MRMA 1IEBB 4UOJA 4C4KT 2VL4A 4HT1L 1FIGL 5FO9A 5D9SA 5FV2A 4CADB 4HJ0D 4QRSB 3JV4B 1A21A 2VDNL 1PX4A 3PWJA 1HSAB 3GB7B 5GSRA 4OCYL 4LNRA 3KPLA 4R26L 2YC1B 3FQRA 4XBPB 3WIIH 1G7JB 4HW6A 1NCBH 5FYKL 4EI5D 4NWUH 5FO7A 2B8OT 3T0EB 1NC4B 1S7WB 1W0WA 4JM2D 4NN6B 1MUJA 3OV6A 4OCSL 2DQDL 4Y4KA 2XZQL 3E8UH 1QO3A 3CZJA 1X5HA 1EEZA 1K9TA 4NWTL 4X99B 2WNGA 1K8DA 1OF2A 3SO3C 3O6MH 3V6OA 2G2RB 1HXYA 1B4RA 1U8PA 4TSCH 3ZTJH 5DK2B 5GRJH 2ZCHH 1MEXH 1FHGA 5LCVH 4NO0A 3QNZB 1OARL 2FEDD 3GSUB 3STLB 2EIEA 3RWEA 3KJ6L 1N6QH 1QUNA 3Q3GA 1XF2A 5JW4Q 4YIQA 1A0QH 2X4NB 4KTYA 3RBGA 1OPGH 3MLZH 2GJ6A 4OTXH 1NEZA 3WL9B 3H9ZA 1W0VB 3QO0A 3U36B 2EYRB 2G75A 4KJYA 1NCDL 4ACPA 4DK3A 2JIXB 4GRWE 1LK3H 1LO4H 3HR5A 1S7SB 3V5DB 4RAHA 4CBPA 5EU5B 3ETBF 3IXTB 1S78C 4LASH 4XGZA 2HKFL 4OGXH 5CJ8A 5CS7A 5HHME 3IDMA 3OKMA 4OD2B 1ZTXH 4L4VA 5E6ZA 3GGWB 5GGRA 4PJ9B 3TP4A 4YGAB 3V9FA 2EC9T 5HYJB 1RU9L 1I1FB 4HS6B 2UWEF 1QLRA 4HJJH 3OB0H 3HRPA 3NCJL 4PB9L 3VFTA 5C6PB 4R4FL 1EGJL 5JQ6L 2VLMD 4WW2C 3MRDB 2DQHL 1B6UA 2H32H 1XF4B 4Q6IB 1YYLH 3TO2B 4YK4C 5E8OA 2D31A 2YUXA 3J8F7 3TVMB 2EYTA 2YD1A 4PP2A 4MWFB 1Z6JT 3U0PA 5D7KD 4GLRI 1TJHL 4XPFH 2D0HA 2G5BA 1AKJD 5D1ZA 1H5BA 1SYSB 3MRKA 1W0WB 3WFDL 3RDTB 1QNZH 4HKBA 2PYEA 2GHWB 1KPVA 1QFWL 4N1CA 1JGLH 1MPAL 4EI5B 4LCIH 1U42A 2WUBH 3ZL4H 4LLWA 3OR7A 1HNGA 3ROLB 1NC4D 5BQ7B 1H0DB 4WTZG 4DW2H 3NIDF 1S7UB 5GRUL 3TV3H 4DVRH 5HYQA 3EOAB 3U46B 5I16A 3MXVH 1I3RB 3BH9A 4JPKL 3DNKA 3LHPL 1GOHA 4JN2B 3BH8B 1DDHA 4PJIA 4Z9KB 5SX4I 1IC4L 1P9MA 2P46B 3VXOB 3KPNB 2HG5A 4OZIE 2B4CH 3IT8D 4TOYH 3HN3A 2DQIH 3Q0HA 3Q6GL 3E6HB 3F5WB 2XZAH 2BNQD 1NCAH 1EXUB 4P4RA 4F7TB 2P49B 1N59B 4I2XB 1SJEA 2Z31C 4X9GA 3TIDA 1KB5B 3ZSSA 3OZ9L 4WEBH 2DQJH 4G5ZL 3S96B 1N2RB 1WBXB 3A67H 3TA3C 1XZ0A 3PABB 2BRRL 5DHVH 3FT4B 2JIXD 4TULL 4LSSH 1U8KA 1AFVH 4R2GB 1IGJB 3MRIA 1SY6L 2BMKB 3BIKA 3MLYH 3GGWA 3PGDB 4IIQB 2GY7B 1S7TA 4S1QL 3B8SA 2JB6A 1A6ZB 2KUTA 4IRJB 1QVOA 1U3HA 4Z8FL 3DHMA 2V5RA 5E2UL 2XWTA 2OL3L 4JZNB 4YHYC 2R23B 5SX4H 1ZLSH 3QUYB 3P2TA 1S5IL 5JR1L 4PREB 3GSQA 4PRID 5ANME 1OSPL 5A2IH 4BFEA 2NX5E 2J8OA 3TWCL 3GBMH 3T77B 5C0DA 4L8CB 3HI1A 4IS6A 1CWVA 3R0NA 1DTUA 2IFGA 1F3DH 3QQ3A 5T1KB 1V7NL 2JJTA 1Z3GL 3WKML 2B5IC 3WFCL 4J4PA 5IB4B 3BPCA 3DXAE 1KCRL 3PHSA 1MJJA 1J11A 1YMHB 3TVMD 2A77L 4QHMB 4OGYL 1CFTB 2BY3A 3FZUC 4M02A 1AY1L 5DK3A 3WJJC 2DMCA 3NIGF 3MJ9H 4S2SB 4P4KB 4YDIL 5EUOA 1C5CL 3DO3A 4BUGA 3ULSB 3T2OA 5FYJU 2JB5L 3G6JA 2ZUWA 5CZVH 3SDCA 1OAZL 5IBTL 3RVTC 3LQZA 4XPGL 1NMCC 2V7HA 4UT9L 3HFMH 5EPMB 1SM3L 1T83C 2AAVA 5HHOD 5DJAB 3T3PE 2VLJE 4MXWL 1LHZA 4JAMA 4W6WB 1BFOB 4HH9B 3VG9B 1AXSB 1H15A 5J7CC 4XBEH 2N4IA 5CSGA 4JQXA 4NHUA 4TUJA 3GSNH 5T3ZL 1G9EA 4GG8B 3DV6B 4GO6B 1I7TB 4NCC2 1BVKB 3QJHB 5ICYB 1EJ6A 3T65A 2ICWB 3GMLB 4J4PD 2H6PB 2BNQB 3B5GA 4Q7DA 2BOBA 5ENWB 2NZIA 4RMVA 4OI8A 5DWUL 1T1XB 1A64A 4M7KL 5AWNH 3RNKB 4ERSL 3MRNB 4NP4L 4XMLL 1U92A 1ED3A 5DJ2B 2HLFC 4JCMA 2EDQA 3D48R 1IQWL 2ERJB 2NY3C 2MQ3A 1A7BA 4JGUA 3KLHC 5DRWB 1A6ZA 4NCC1 1ACYL 2PN5A 4Z95H 3RUGA 1ZHBB 4P46A 3GHBL 3TT3L 5GS3A 3IETB 2A9NH 4LPTA 1OAUH 1I8KB 3GUTA 3K4ZA 4ZS6C 4XNXL 3O4OB 4DVBB 4FNLH 1XF5A 4KHTH 4NKDA 4J2XA 1XZ0B 1YA5A 2NXYC 4U0QB 3TBSA 2AK4E 3QUYD 3MZGB 5GGVY 2AGJH 2Q3ZA 5BRZA 4PRIB 4XPBL 4JFQB 3OAUH 3MRIB 3MV7A 3UTTE 1KENH 5HVGB 1IZJA 3HMXL 3VXMA 5HYFA 4XVUC 5MERA 4K3JH 2XICA 4GKZA 1A7PL 1X5AA 1JBJA 1OTUD 3TIEB 3RUGF 1DBBH 1U3JA 5MEPB 1P5UA 5T1KD 5TDPA 4NQDD 4I77H 1V7MH 1IM3B 1KEGL 5CIPB 1EEZB 4CVXA 1FDLL 5D6DC 2NY4D 4X99A 4WU5B 1LO3H 1I1YA 1Q9KA 5EORL 2YOCA 1D5XA 2WWKO 3NIFE 4FQQB 4PJGF 3L5IA 2VZOA 4IRSB 4KZDH 2A73B 2APWA 5HHNB 4ODUB 2WIMA 3N1PC 1XAUA 3PWUA 2YSSA 4NUGH 3N50A 4KJQD 4R7DA 1AXSA 4PJBA 4CMMB 2D0GA 4ZPTA 1A8JH 3P4NB 2N7BA 3B2UC 5BVJA 3WLBB 3IB4A 2DKMA 4JO2H 1IC5H 1D9KA 2VL5B 3V52L 3DX8A 4M43L 4R97C 1A4JB 1UADC 2A6JB 1OARH 2PYFB 5EUOB 5CSZB 2KZWA 3BP7B 5D9SB 2XY2A 2WQRA 1XGPB 2E6QA 4WY7H 5KSVA 2F8XC 5IR1A 3OF6A 3EOYG 5C08E 4ELMA 4L3CB 3FO1A 3HMWH 4CMHC 4MQ7A 1FV1B 1MJ8L 4HDIA 5D8JH 3GSVA 3FRPA 1NSNL 1BFSA 5A40E 4HXBL 4LRNL 3BKJL 4LEXL 5DD3L 1FFOA 5B39A 1FZMB 2JELL 3B2VL 3NCCB 2DS4A 3D0LA 2W91A 4R4NC 3QUXA 2VDOL 1UT9A 4NQDA 3BWAA 5I1KH 5ITBL 2HRPL 3QDJA 3GKWH 5GGQH 5I8EA 1QSEE 4F2MA 1RZIA 1MIEH 3MRJB 4MQSB 1D6VH 3EZJB 3PDOB 1ZTXL 5E5MA 5E8EB 3CD4A 1CGTA 4UDTB 4OLVH 3TBYB 4ZO9A 3RVVC 5L2JA 2DB8A 5BV7L 1YEEH 3IU3B 4NKDB 2RJMA 1YYML 1E0OB 4NIKB 4LSUL 3MFFA 3TJEH 1PLGL 1TQBC 2G60L 2XTJD 3F7YA 1GHFH 4R4FH 2Z8VC 2B0SH 5IEHB 1KPUA 3QXDA 5I18H 3A6BL 4QCIA 1MLBB 1CD1B 4KUCF 2Y6SC 4WW1A 4JFYA 4Y5VB 3DI2B 3U36A 4OZIF 1CVSC 3IDNB 4AL8L 2APXA 4PJAE 1KELL 1V8HA 3RUGB 5IQ9B 4LHQB 2VSCA 1U41A 3IETA 1XCQA 2FGZA 2P5WE 3WSQH 1FRGH 1BFTA 3LKRA 3DXAA 4QXUH 1TZHA 4NO0D 3PV6A 3CFBA 1NL0L 3L3KB 5DJ6A 5IBLD 4DEPC 1NGPH 3B9KC 3GK8L 2NY4B 3ZSTA 1CDHA 1JNNH 2HH0H 3DX6A 5IV2B 4JJHA 3V7MA 1L7IH 4YBLC 4ZNEA 4YJZL 2UY6A 5FA4A 5GXBB 2X4UB 3I6LD 4LVHB 3C9NB 3WD5L 5KS9F 1FFNA 4JHAL 3OPZL 4S1SL 5DXWA 3FCTA 2IH3A 1NGWA 4L1DA 4F57H 2BDNL 4LLWB 3QQNA 1NAML 1ZE3C 5LGHL 1MI5B 5D7JB 3RWDA 3V4VH 2E6JA 3G6AA 3NIFF 4PTUA 1T7XA 1V05A 4HQQL 3T04D 5IR1B 4BQ8A 1T89A 5HI5D 3VW3L 3TEUA 2BVYA 1HWHB 1S9XB 1CICD 1JHLL 4JFOA 1D5IH 1H5BB 3MRKB 4MAYC 5DD5L 5HY9A 1KPVB 4DN4H 5F96L 1UQSA 2ADFL 2D7MA 3WFHA 1NBZA 1Z5LA 4WFGE 4PRHB 5EC2B 4NRZA 1FFPB 4HEPG 5B8CC 3DX8B 3V4UL 3MYZA 3EO9L 5IKCA 4BA8A 1FNEA 1BZ7A 3IVKB 5ICZA 3QA3B 3KLDA 3SGDH 1FQ9C 1LE5B 4X6EA 1QSFD 1VFBA 5F1OB 5E94A 4DKFH 1CL7I 2X4TB 1Q1JH 4O2CB 1DEEA 1BOGB 4OUUB 3WMSA 3DIFA 1WTLA 4K3GA 3NFNA 1IBGH 4PJEF 4G7VL 3V4PH 1IFHL 1FLRH 1YNTB 2IANB 4H1LH 3O4LB 5HGBB 3QXVA 4PB0L 3LKOB 3U79A 1KIRA 3KXFA 3F8UB 2N7AA 5C0FA 3DTXB 3G5VB 3EJYC 3VMOA 4KQ4L 1MCOL 4OGZA 3H9HB 3HZYB 3MNWB 3GSWB 5EZOL 4O4YH 1AO7B 1NAKH 1RPQA 3HTLX 4MAYD 1BD2D 3EOTH 5GGVH 2ED9A 4UIMB 4UT6L 3WO3B 3QUML 4M7LL 5B39G 3D39A 4LSRH 4J8RA 3AM8C 3NMEA 1UWGH 1A9BA 4W4NA 5F44A 4Y16B 3ORJA 3KPPB 1S7XB 1S8DA 3U48A 2E27L 4YR6B 5IMOB 2BHUA 4RBPH 3EHBC 2APTA 4Z7VA 2ZSVA 2CR6A 3QDHA 1KG0A 3ZKND 4WFED 4OJFH 4BM7A 2P8PA 4PGCA 3UYRL 3X14A 4KXZH 3ARZA 1RUPH 2DWEA 2EO9A 3HAEB 4R4BB 4M5ZH 4LLYB 3KLAB 4NN5B 4K71B 5F1NB 1NGXB 1MI5D 5D7JD 1U95B 1U3YA 3MXWL 5CJOL 5DMGC 4XMKH 5E8PB 1M7XA 1DL7H 2VSDA 4FOMA 1EAPB 3EDEA 1Q0XL 3OKNA 2AEWA 1UQSB 2OM5A 4ZSOE 1CICB 3QUMB 3S7GA 4WUKL 3STZA 5FUOL 4EI6A 1LO2H 3OXRB 3ULSA 2PXYC 3QJHA 1RIUH 3MGAA 4FQPA 2AXFA 3G6JB 3IAQA 1T1WB 2OTUA 4HPOL 3S9DB 3VXNB 4O2EB 5AAMA 1I7UB 1PZ5A 2B39A 5ADPL 3WJLA 4YFEA 1QYGL 3ROOB 1LEIB 5HGHA 1NDGB 3BPOB 3FFCA 3SDXF 1QFUH 2NNAB 4K9EH 5E1AA 1U8LA 4KHXL 1A7QL 1GGYA 2GEEA 4OCYH 5F9DC 1GPOH 1MHCB 5EU6B 5JUEL 1N6VA 3QULB 4B7LA 1A7NL 3TH3T 1CN4A 4WV1B 5DS8B 1J5OH 4JKPL 3FFDB 5E6IB 1AR1D 3MMEA 4PGZA 4RGNC 1D5BB 4YGVB 4KUZL 1IGCH 1HSBA 2ZUUA 3AAZA 3DUHA 4M1GH 1JHTA 5C09B 3S6CA 5MENE 2UZIL 1OTTD 2VABB 5F6HJ 1UYWH 4M7ZC 3ALWA 4RA0C 3I75B 5FYKD 1FGNL 3O6ML 1DVFD 1U6AL 5DUPL 3U1SH 2X4NA 1LMKA 3IGAA 5I74C 5CLTA 2ZCHL 5J89A 4CKVX 3WNLA 3QO0B 4ALAL 1NFKA 2CSPA 4CVUA 3HZVA 4Y16D 3G5VA 5JW4M 4HUUB 5DQ9A 5FF6B 3MLZL 5JMOC 2A0LD 3E6FB 4ZYKA 2AJVH 1GXEA 1YEFH 4XCYA 1MCNA 1UXSB 2FL5B 3FO1B 2YUVA 4U0RC 1LO4L 5M95B 3VH8G 5HD8D 2OXHA 2V5MA 1N7MH 3T4YB 1G6RL 2AXJA 3FQWB 5JW3H 5KVGL 2EC9U 2HKFH 5DTFB 3VE0B 3VXOA 3RJQB 3QNYB 2O26U 2W9EL 2YKLH 4RFEB 4ZFGH 4FS0A 4HFUH 3NFSL 1CFQA 3SO5A 3WUWA 4DUXA 1T1WA 1YJDL 4PB9H 4RGOL 4LP4A 3ZYOA 5BQ7A 1IAIM 4EIGB 3MSPA 3ARYA 4NYLB 2HRPH 3MYJA 4C4KO 1S7UA 4MQTB 4Y5XA 4RCAA 1KYOJ 4ZOBA 4PP2B 2NPLX 1OAQL 3RY6A 1YEHL 3MCG1 3P4NA 3FN0L 1J0JA 1JGVH 2AW2A 3L3OB 4IJ3C 1QFHA 1PEZA 4KPHL 1DQTA 3FT2A 4G6KL 3BKML 2WW8A 4I0KA 1IEHA 3CU7A 3FQUB 2IQ9H 5IHLB 3VGDA 1KJMB 4MD4B 1TJIH 1MI5E 3O6FD 5E2VL 1DLHB 2ZJSH 2Q8AH 1A47A 1ZHLA 5J3HC 3KXFE 4HMCA 4XWGL 3VFGH 3HS0B 4MJ6A 4NKQB 3NA9L 4G3YL 4MQXC 3D18A 4M4PA 2G9HB 4O02H 5JXAH 4RX4D 3MRQA 4DW2L 2HFTA 2E6PA 4LEOB 5C09D 1D5MB 3V6BR 1AR2A 4FN0A 5I9QC 4CRPA 1QPXA 2DLFL 4QF1A 3ARSA 3MLUL 5CBEA 4KVNH 3THMH 1DR9A 4OFYA 4QXTB 1DVFB 5KAQF 3FO2A 1QVOB 1U3HB 5EUKB 2J8UE 2P5EE 4BK5A 5HYEA 1XCQB 1FVEA 4E5XB 3AS1A 3V6OC 3QUYA 5EBGA 4UAOC 4FG6D 4JHAH 3RTQA 2PYEE 2ZCKL 2DKSA 3H0TB 1E4KC 4QCIB 3P9MA 4KMLB 2BRQA 1FAIH 4IMKA 4ZTPL 3IJSA 3UTSD 1KJ2L 5BXFB 3DROA 4NM8H 4ODXA 1R0AH 3NFPA 5KBNC 4OM1L 5K9OB 1IGML 4XPHL 5A16A 5FYLH 1GGBL 3OWEA 1KT2A 2MSPA 4IMLB 1NLBH 3JV6A 1D5IL 5FUZL 1QBML 3WXWL 3WLWC 2D7TL 3CUPA 1ZA6A 3S97C 3QQ9C 4ZFOA 2CLRA 1HSAA 3GB7A 5GSRB 4H8WL 2P24A 4GMTL 5DT1L 2HKHH 3MV9D 2VDLH 5MP6H 3JXAA 5DRXB 3V8CA 2WQ8A 3T0EA 2ICWI 1ZVYA 5FDYA 3PL6D 5HY9B 1QBLL 1T3FA 4EQ3A 1KIQB 3KPSD 2AVGA 4QLRA 3I50H 3PQYB 3DGCR 3EYVB 5JPMA 3FB6B 1ZLUH 4MSWA 1IBGL 1KCRH 3BDYH 2MOVA 4G7VH 5DSCA 1CFQB 4NM4H 3AREB 2VDPH 4N0CD 1IEAB 1NJ9A 1OSZA 3T0VA 4PJXA 2A6IB 1SBSL 1WAAF 4XXCA 2VLRB 4U2ZA 1FZKA 1RZFL 4PV8B 4FP8L 1U8MA 4KJWD 3M1BB 1KV3A 3L3IA 3OR6B 3NPZB 4I4WA 4OZGF 1T03L 2VZ1A 5CCKL 3WFZA 5E8DH 2GSGA 5TE4L 4KDTC 2ZSVB 1Y0LB 5MENA 2IQAA 2QSVA 5D4QA 5T3ZH 1U8OA 5IHUH 5IFAH 4P57A 4JFFE 3VGBA 2E27H 2V17L 1TMCB 1U3HD 5A2KH 1DUZA 3RIFF 2J12B 5D7SH 1G1CA 5JW5A 3HLAA 1PBYA 4ZD3H 2CKBB 3P9MB 4U1IB 5C0IA 3DETD 3LKOA 3OHXA 1ZGLB 4F15B 5EWIL 2NY7H 3K74B 1FYHB 4P46B 5C2UB 4HPYL 4PY7A 4FRWA 3QUZA 2ID5A 5I75C 1P69B 1CI5A 1CLCA 1R5IA 2HWZH 1W72L 4DVBA 2CLVB 3CFJB 3HR5B 4HFWB 2QSCH 1D9KC 3ZO0A 4EEEA 5D2LF 5I1IH 4NHCL 2R0WH 4LPUA 5HYQB 4CN6A 5KG9B 3OJDB 2VISA 4HK3J 3WHXA 3SQOL 2JF1A 1S7QA 3X3GH 5KW9L 1N3NA 5E00A 2O5ZL 3RKDC 2GSIA 2BVUA 2AGJL 3NZ8A 1A6VL 1KEMH 2VERN 3PNWA 3MV9B 5HHQA 1H8OA 2ARJB 1KENL 3T0EC 5ADPH 4XP1H 4G6AD 4HK0A 4Y5YC 1AH1A 4HK3N 3KYOB 1TETL 1IEAA 1DBBL 4PJ5B 2ADJA 1WVZA 2XTLA 3T0DA 3TYFB 4MZ3A 1A7NH 3OKDB 5TPWH 1MJ7L 4XCFH 1FYTA 3TZVB 3H9YA 5KANI 4JKWA 4OQTH 4AMKL 3HHRB 4PGEB 4TNWK 4BH8A 1P6FA 5HYJE 2VLRD 3HC0B 2ORBL 1Q72H 2H3NB 2HP4A 3RVUC 5DO2D 2ZUTA 1S9KC 5B21A 2QADD 4PBXA 4BKLB 3NIDE 1AQDB 1IAIH 25C8L 2I9TA 5BJTB 2XA3A 3UTZA 3U1SL 3ARQA 4LCWE 4I3SH 2D03L 4OZHB 3FMGL 1IC7H 1GJIA 4FXGB 3VI3F 3U30B 5E2WH 5C9JB 3T4YA 1ZT1A 1UZ6F 4TUKL 1ZGLA 1HHGA 1EBPA 2J8UA 4CN4A 5CILL 5JOFA 4HUWA 3IFLL 4FQ1L 4Y89A 5BOPA 1A7OH 3ULVH 2YZ8A 1FP5A 5IIEB 1N7ML 3RTQD 4L3ED 3RWGB 1OL0A 4JANA 4NPYB 4O2FB 3WN5C 4PJBE 5FGCE 1E27B 5F1IA 4HIXH 3NTCH 1RVFH 3MFFB 1E6JL 1EO8L 3IRZA 3MGTA 4Q58C 4WW2B 2E9IA 3NZHL 2ICCA 2Z91B 4MMZC 4WGVB 2VDRL 4LLQA 4FMKA 1JYWA 4MNQA 4X6DA 5EOCH 3TBWA 3OXSB 4WI6A 1ORQB 2XA8H 3AS0A 4XCEA 1I9IL 1JWSB 2DQFB 1CBVH 3CLEL 2OBGA 1BVLA 2PKDA 5CHNA 2QQKL 3VXTB 3BAEL 4GG6F 5TFSL 4ZUUA 3GMLA 3OKLB 4HUVA 3SE4C 5FYKH 2C3VA 3QDGA 2LAGB 4KV5F 4N0RA 3QCTH 3FQRB 2J88L 1HXYB 4W6YB 4JAMB 3MLVL 3O8XB 1DQDL 3WV0A 4N9GB 3P0VL 4R9HA 4TUJB 4WFFD 5EOQL 3FB8B 1J1PH 1JNNL 2HH0L 1KB9K 3TO4C 1L6ZA 3QNXA 4MA3A 1KFAL 5ICYA 4XNQB 4XPTH 3TZVD 2ARJA 3ILPB 4PRBA 5C0BD 5M94B 4JREB 3ZE2E 2QV2A 3HC3H 2Z8WC 3IXAB 3OPZH 4OIIL 2DLFH 3UJIH 1DBAL 1AGBA 2R9HD 5KANG 4XRCA 3KJ6H 1N6QL 1R5VA 3GSOA 3UBXG 4NKIH 3ESUF 1CFNB 2CIIB 5EPMA 3TN0C 4ZXBA 4K7PX 5LWYH 4IOIA 3LD8B 5FDWB 3O6KL 1U8QB 1PD6A 3HI6H 5KSUA 4OTXL 5H37H 5FKPB 5BS0D 3REVA 4QTHB 2EDKA 2VDMH 1MCEA 3T3ME 4ONHB 3GJEB 4U1MB 2APVA 2GTWB 2GYSA 3T2QA 5T33H 3MRRB 3TIEA 3BP4B 1XF3B 3E3QC 1XR8A 3V5DA 2DQTH 4FQXC 4NZRH 1G1YA 3O11B 4OF0A 1PG7L 3DVFA 3TBSB 1UXWB 3MCLH 2JJWA 3RTQB 4P2RB 3IDMB 1MCPL 4LLQB 2VO5A 1BFVL 2NXZC 3L5XH 3ME0A 2AQ3A 5I1GL 1KF9B 1IAMA 2BNRB 2PR4H 4NQTA 5EBLB 4D0CA 1FH5L 1P4LA 2Q3AA 1BGXL 3ECBA 1JUFA 4X6BA 4DUWA 5DT1H 3JUYA 1Q0YH 4A6YB 4P23C 1BIIA 5IQ7H 1IKFL 4LBEA 1DLFH 4KK8C 2V5TA 4EN3D 3R0MA 3LCYA 3NCYP 2RFXB 4DN3H 2F53A 3BIAX 2R8SL 5TQ2L 4EUPB 1RUMH 1S7RA 2R29L 1NC2A 2W65B 4PRDB 1PSKH 3LDBB 3EKCA 1MWAH 1X4XA 4NM4L 3WS6A 4JN2A 1DDHB 4WEMB 3M17A 1FZMA 4EUPG 3JTTB 1NPUA 2X44D 3VG9C 4UUJA 4XNQA 4NJAH 4LGRB 1B88A 3O8XD 1H3TA 5D2NC 3BD3A 3CLFL 3GI8L 4FP8H 4C55A 3LEXA 4DTGH 1KIUA 1AJ7H 3FN3A 5ITFA 3DGGA 3HZMA 4OJFL 4MQ7B 4U1KB 4LCYB 3BH9B 2CK0L 3BDXA 5EC1B 3LEVH 1K2DA 3LS5H 3VI4E 3VD7A 3S35X 1J0YA 3RZCD 5IMMB 3Q2CA 3MV01 4CMMA 1MFNA 4YHML 4YWGH 1SHMA 4D2NA 1WWAX 3ZKQD 3GSRB 1XGTA 2ESVA 1QKZH 1BLNB 4I0PB 4MA1B 4M6ML 3VRIB 1T5WA 3O3AB 1FFQA 1F45A 4NO3A 1FPTH 5CLWA 3IDGA 3DYOA 3OMZA 2OJZH 2CO6B 1KJ2A 1C08B 4LU5H 3DECA 4YDVA 1FVCA 5I19H 3N85L 1TJGL 4FFYL 4LLUB 1CTNA 3OKOB 5CFHA 1OD9A 4J12A 1FC1A 3RL1B 1W72H 2CKBA 3MLXH 4JO1H 5IG7B 5C0CE 3CXDL 4GKNA 3V0WH 1KCVL 2OTPA 1EZVX 3IDIB 5CP3H 3SDYL 4NHCH 5IQ9A 2NTSP 4K9EL 4LNVA 1IGYB 4JZNA 4EBQH 3L3JA 5DUMH 2VLJD 4PJXE 2AV1B 3MV8B 2BNRD 2UUDH 3BUTA 1J1XL 1FNLA 3QJFA 4NNXB 1RUAH 5EUOE 1KC5H 2RB8A 3UPRA 3HLAB 3I3EA 3CVHA 1OP3H 1ZLWK 1NGZB 3NCEB 4ETQB 5C0IB 4D0DA 1AR1C 3QWRD 2VN4A 3HE6A 4PJGB 4M1GL 3BN9D 3DVNA 4P5KB 5ESQB 4TVSa 5IJVA 4N8VB 1MHPL 3ARBB 4PLJD 1T5XA 4DCQA 1MNUH 3GHEL 3ZE2F 3FQTB 1EH9A 2OLDA 1P7KB 3VXQB 2JB5H 4M8QB 1JN6A 2CUIA 3MLSH 1A6AB 3MJ7A 4CJ1A 1MF2H 1UA6L 4GG8A 3QHFL 4H25A 4AG4L 4X5LA 3UTZB 5IKCB 2HFFB 3VXSA 1S78D 3T65B 1K8DB 2UYLB 1GZPA 3IFNL 1J8KA 5HDQH 1RJZA 4P9HC 4JQVC 3H3PH 1XCTA 5ENWA 4ZAKD 1D6EA 1KPRA 1JK8A 5FYLD 5KAQG 1G7JA 2YPKB 3BRGC 1UJ3A 5IVXF 3GZKA 3JTTA 4LARL 1PY9A 1B0WA 3F58L 3RZCB 2ITCB 3LKNA 4Z78B 1C7SA 4XAWL 5L2KD 3BI9X 5D1ZD 2W9EH 5I71B 3RJDA 1Q9OA 5EA0L 4XMLH 4I0PD 3RX7A 2ADIB 3QEGH 3QIBC 4FQ1H 3EYOA 3KYAA 5IW6A 1VHPA 1LNUA 2V9TA 1GYAA 5FA3A 1MY5A 5F88A 5H94B 2VLKE 3ZHLA 3P40A 4JFQA 4KMQA 1J7VR 5H2B