1E77A

Complex of active mutant (q365->c) of glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides with substrate
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
485
structure length
485
Chain Sequence
VSEIKTLVTFFGGTGDLAKRKLYPSVFNLYKKGYLQKHFAIVGTARQALNDDEFKQLVRDSIKDFTDDQAQAEAFIEHFSYRAHDVTDAASYAVLKEAIEEAADKFDIDGNRIFYMSVAPRFFGTIAKYLKSEGLLADTGYNRLMIEKPFGTSYDTAAELQNDLENAFDDNQLFRIDHYLGKEMVQNIAALRFGNPIFDAAWNKDYIKNVQVTLSEVLGVEERAGYYDTAGALLDMIQNHTMQIVGWLAMEKPESFTDKDIRAAKNAAFNALKIYDEAEVNKYFVRAQYGAGDSADFKPYLEELDVPADSKNNTFIAGELQFDLPRWEGVPFYVRSGKRLAAKQTRVDIVFKAGTFNFGSEQEACEAVLSIIIDPKGAIELKLNAKSVEDAFNTRTIDLGWTVSDEDKKNTPEPYERMIHDTMNGDGSNFADWNGVSIAWKFVDAISAVYTADKAPLETYKSGSMGPEASDKLLAANGDAWVFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Examination of the Role of Asp-177 in the His-Asp Catalytic Dyad of Leuconostoc Mesenteroides Glucose 6-Phosphate Dehydrogenase: X-Ray Structure and Ph Dependence of Kinetic Parameters of the D177N Mutant Enzyme
pubmed doi rcsb
source organism Leuconostoc mesenteroides
molecule tags Oxidoreductase
molecule keywords GLUCOSE 6-PHOSPHATE 1-DEHYDROGENASE
total genus 168
structure length 485
sequence length 485
ec nomenclature ec 1.1.1.363: Glucose-6-phosphate dehydrogenase (NAD(P)(+)).
pdb deposition date 2000-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00479 G6PD_N Glucose-6-phosphate dehydrogenase, NAD binding domain
A PF02781 G6PD_C Glucose-6-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1e77A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1e77A01
1EUZA 1OBFO 1KVQA 2C82A 4BNFA 1Z7EA 3DEYX 2H63A 4EJ6A 1IHYA 3GHHA 4TQGA 4C7JA 1I3KA 1E7QA 3D3EA 4YRDA 5HS4A 3GF4A 4I5FA 4XR4A 1B7GO 3OETA 4Z9XA 5B4VA 5COAA 5KOIA 4RZHA 4RGBA 3E5RA 3NUGA 3PRJA 3AM5A 1PJQA 3LDHA 4YT2A 5TLSA 5KIAA 1VE9A 2XOXA 1GYQA 4HFJA 5A9RA 3GVXA 3O8QB 4IXWA 2IEBA 1DHRA 5HTOA 1G6KA 2IEDA 3L77A 5IAAA 1H94A 1HLPA 3K96A 3LK7A 4BVAA 1BXGA 1GEGA 3ZWNA 5JFOA 4FOOA 2PV7A 3RFTA 2UV8A 4NK4A 3ETGA 1BW9B 2A92A 3BHIA 3E03A 1X7GA 2P4QA 1P1JA 3HFGA 4NZ9A 1Y8RA 4R16A 5COQA 2X1HA 1Z6ZA 2Z95A 1Y5MA 3VAZA 3H7AA 1ZSNA 3GR6A 4RDHA 3MJVA 1OMOA 1YE3A 1AGNA 2NADA 1DIGA 3CMMA 4CMKA 2GNAA 5T67A 3SC4A 2B69A 2LDBA 1H6DA 1R0SA 1ZW1A 3N74A 4CMIA 3ZNOA 1W8DA 3WTBA 3I83A 1GL3A 4JIGA 4BO3A 1Q0LA 1X7DA 4KTTE 3KXDA 2GYYA 4NBRA 3I1JA 4HP8A 4YAGA 2QQ5A 4BV8A 4PG6A 2EW8A 4J4BA 4F45A 4BKOA 4UVIA 3A14A 3TZ6A 2PGDA 3PLRA 4UVGA 4ALJA 1H9BA 1O94A 3RU7A 4EUEA 3E18A 2LDXA 4FJ2A 2DTDA 2G0TA 3PFFA 1DO8A 3OA2A 4CLDA 2W2LA 3CUKA 2FP4A 2JKVA 3FPCA 2W98A 3ITDA 3ZHZA 1NR1A 1XDWA 5IFLA 4KQWA 1CERA 1GADO 2NQTA 2DLDA 5DNAA 5CAEA 5K9ZA 3JYNA 4AJPA 3D7LA 4RO0A 2X0JA 6ADHA 2C5EA 1PJLA 3I9LA 3BYZA 5BQFA 4Q3DA 1DXYA 4J9UE 4BNNA 2BFAA 3ZV6A 1NVMB 4MVJM 8ADHA 3QY9A 3GQVA 4CMAA 4BO8A 4K6CA 4IY1A 4ESOA 4W7HA 1LSUA 1ENPA 5FFFA 4LVUA 3U3XA 3KVOA 5AXCA 1E92A 4IJWA 4L73A 3RASA 3W4IA 2C54A 2FZWA 4PFJA 3VPGA 4R51A 2BRUA 1Y1PA 4NMHA 3WIEA 3HWRA 3DOOA 2RHRA 5AQ1A 2V7PA 1ORRA 1DJNA 4R01A 4RQUA 5DN9A 4RQTA 3WQSB 4BNVA 2PKQP 3HDHA 3DAPA 3DHNA 4ZICA 2X5KO 1GYPA 4S1VA 1DJQA 4FOSA 1ADBA 1H5QA 3SLGA 4RLHA 3WS7A 1N9GB 2VNAA 4I9NA 1QORA 1RJWA 2ILTA 2X86A 3ZI0A 5U4QA 4H3VA 3MOGA 4J1TA 1SAYA 4R1SA 5ENDA 4ZVVA 1H6CA 3MWEB 4FDAA 4CR6A 2Y67A 3MOIA 3TJRA 3QJ5A 1E0DA 4IGFA 1PS9A 3F6YA 1BW9A 2VWGA 4L4SA 4TRJA 4BNMA 2C2YA 1WMAA 1S6YA 4CM4B 1U9JA 2HO5A 4BO2A 1YDWA 3QQPA 5C7OO 4RVDA 3G3EA 3LC7O 4WLUA 2DAPA 1UDAA 1Q7BA 4ALKA 1KIFA 1LA2A 2YY7A 4EEZA 2FSVA 4XCVA 4O6VA 2P2SA 3W8EA 3VZRA 2HU2A 1C0KA 3GN2A 4FSHA 2PLAA 2VZ8A 3PLNA 3E48A 1Y6JA 1SPXA 4CLHA 4BL5A 2HK9A 1H2BA 4XGNA 4DQXA 4UUOA 4RPJA 2X4GA 1XIVA 3M2TA 4ND1A 1DEHA 4RF5A 3GVCA 3O38A 2P9GA 3U4HA 3QVWA 2VHVA 1Z45A 2XPCA 3UKOA 3VVCA 5G0VA 1KC3A 2HCTA 4UAGA 1EVJA 2XF8A 3RFXA 4CM7A 3KZVA 3L4BA 4G5HA 1IUKA 3EZYA 3GEGA 1DRUA 4H7PA 5L51A 3GG9A 3UCEA 4FW8A 1NQ5A 2VYND 1GQQA 1HE5A 4FBGA 1PQWA 1RWBA 4B3IA 3Q2IA 1WZIA 2EV9A 4U8GA 1EDOA 4B8WA 4N54A 2IXAA 2EJWA 2QYSA 5L53A 1UP6A 1V0JA 3ZWOA 3GUYA 1LI4A 2ZKLA 2PD6A 3OFSA 3R6DA 2E82A 3BHJA 1Y9EA 1J6UA 1LBEA 1PJCA 2NU8A 1J49A 2QRKA 2G82A 2WE7A 1BXZA 1Q0QA 4I5DA 1OZAA 4LRSB 1CEQA 2PR2A 4K28A 3OEWA 3ZWWA 5L4SA 1U2DA 3AM3A 3BMCA 3TPCA 3PK0A 4CLOB 5JW6A 1CDOA 1C1XA 1TEHA 3H9UA 3IQDB 2NU9A 4DLAA 1HSZA 5CDUA 5I9MA 1X0VA 1C0PA 3BHMA 4JJIA 4XEHA 2J3JA 1GPJA 5F1OA 1PZGA 2YHIA 2O3QA 3C7AA 3IUSA 3ROKA 4N18A 2DFDA 4DGSA 4A27A 2JD1A 4D0SA 2B0JA 3TNLA 5JSFA 1A9YA 4AJ1A 3KEQA 1W73A 3PHJA 1JWAB 3RC7A 3TOXA 5I7EA 1NPDA 5U9CA 5L7YA 1EFKA 1B3RA 3ZWMA 1KS9A 3ZDFA 4Y6PA 5A03A 1NM5A 2C59A 2EF1A 4W7IA 5A3VA 4MPDA 1NWCA 1IYZA 2A9FA 1PZFA 1JAYA 3BZUA 1XELA 4PLWA 5A9TA 4HUJA 2G76A 4RPLA 4BMNA 5KVSA 4Z3DA 2DKNA 4QECA 4J7XA 4IIUA 5H82A 1KC1A 4JN6B 4XZ3A 1IB6A 3UH1A 4EYEA 1LUAA 4I08A 3NT5A 2IDZA 5C3MA 2FPGA 3SX2A 1HEUA 3ANMA 4EZBA 2XAAA 1TVEA 2Q2VA 3D4PA 5L4LA 1GAEO 2AQIA 3P2YA 2Y1FA 3EY4A 2C7GA 3CH6A 4PIVA 2NQ8A 2HMVA 2X23A 3ASUA 2B36A 1TT7A 5IXYA 2GZ3A 3UF0A 2V6FA 2B5VA 1W6UA 5GZ1A 3PPIA 4ZQBA 4ND3A 5L95A 4W9NC 4LCEA 2UUOA 3ASVA 2J3KA 1QLHA 5JO0A 2QHXA 1I0ZA 5EN4A 4F46A 5I7SA 2I5PO 3EYWA 1JWBB 5TNXA 3PGXA 5JAMA 4WKGA 3WBFA 3WSWA 1EVZA 4CL3A 1YL7A 3E8XA 4BNKA 1EUCA 1M66A 5A02A 1LRJA 3ROQA 3QP9A 4OMUA 1P1HA 2NNLD 1HYGA 3PFWO 4J6FA 4XB1A 4BKPA 4DPKA 4FN4A 1JW9B 3JQEA 4YR9A 1K89A 1VLLA 5EESA 5EQFA 4Z0TA 3S2GA 1ID1A 1F06A 2EKPA 3TSCA 2BGLA 1LU9A 3IKVA 3PYMA 4IGEA 1T4BA 3OJOA 3PYXA 1KEUA 3DZBA 4G81A 4WEOA 3JQ8B 3GHYA 4NPCA 5FF9A 2J8ZA 1V35A 4LSWA 4WE3A 4XDYA 3E5MA 5KJEA 4BNWA 3WGOA 1GCUA 4ND2A 3WYEA 4DTIA 2G1UA 5IZCA 5TX7A 3RD5A 3AW9A 1SO8A 3NKLA 4L0QA 4PCVA 5DP2A 5T64A 3TOZA 5JAZA 3WWZA 4YJDA 5DZSA 4ID9A 4P8RA 4KUHA 3S2EA 2J3IA 4E32A 2Y99A 3JYLA 3ONDA 4XIJA 3EVTA 4E5MA 2P91A 3RVDA 3GAFA 4I5GA 4BV9A 4DC0A 1LNQA 3H9GA 4A26A 1XLTA 1B2LA 3DTYA 1R12A 1VL0A 4JCOA 4TRRA 3VPHA 4DUPA 2OXIA 2AG5A 3GNQA 3U62A 1QKIA 2Z5LA 4MVJD 5EIOA 2D5CA 4XKJA 2O7QA 1KVUA 3PHHA 1QG6A 2YHUA 4YJFB 1IHXA 3VPFA 4E5PA 3A28A 1VL6A 2WYVA 3H2SA 3ZV5A 2D1YA 4FR5A 1A7AA 2VWHA 5HBRA 2NU6A 2WYWA 3L6OO 3K30A 4F3YA 1N8KA 3W6UA 4C7KA 5JAIA 1KVTA 1ZBQA 3N58A 3AJRA 3M2PA 4FQ8A 5TGDA 2D2IA 3U09A 5AXAA 4D44A 1NQTA 4IQ8A 3GRPA 3IJRA 4UVHA 5G0TA 1T2AA 3DHEA 1NPTO 5A4DA 1RYDA 2NUAA 4CMCA 4DIOA 3JD4A 3GEDA 3I3OA 2NLOA 4CM6A 3EDMA 4HNGA 1PQUA 4GPD1 3GNSA 5TQVA 3RBZA 1XGKA 5F5NA 2QG4A 4B79A 4P4GA 1P1RA 4YTEA 1HRDA 1MV8A 3PZBA 2CF6A 4GSKA 3AUUA 3OQ6A 4BNUA 2YYYA 1A71A 1CETA 4K1LA 4DQUA 3C1OA 2O3SA 2X7HA 3G17A 2C5AA 2EEZA 4Q3EA 3PDJA 4BOYA 1I36A 3O9ZA 4XRGA 3WBBA 4YJHA 1MUUA 1P0CA 1NFRA 2O3UA 3EC7A 4J49A 3EHEA 1T1SA 1NAHA 3QE3A 4GLOA 2IE0A 4R5HA 2RAFA 4I9HA 1KEPA 4WJZA 2ZB3A 3KYDB 3P5SA 1SNYA 4I5EA 4Y98A 2O23A 2NV6A 5ITVA 3NRCA 3U9LA 4ZRNA 3LU1A 4AG3A 5CFZA 3F5QA 3KYCA 1IL0A 3H5RA 4NBTA 5B1YA 3QVOA 2P4HX 4QUKA 2IZZA 1ONNA 3JQAB 1EE9A 1Z82A 1D1TA 2X0IA 3BMOB 5DF1A 3SJ7A 2WTBA 3TFOA 1YRLA 1LLDA 3CXRA 4NBUA 4M1QA 2EXXA 3CZMA 3DBHA 1NPYA 1U4OA 1I2BA 5EINA 4PLZA 5FI5A 4BO0A 5KJFA 3WR5A 3OH8A 1H6AA 4R1UA 3MJEA 3PQEA 1PJSA 3AU9A 3VVBA 4UVDA 2IZ1A 2JFHA 1YXMA 5BNTA 1GCOA 4RVUA 2PGJA 2C0CA 3NJ4A 4II3A 3JQBC 4J16A 3NTQA 3O26A 2OBYA 1DFHA 3Q9NA 2PTGA 1FXSA 5JY6A 2DPHA 3BMNB 3K6JA 2ZQZA 5L40A 3RC2A 2VZ9A 1O5IA 4FFRA 3ENNA 4U6QA 5TC4A 4DXHA 1IZ0A 3HDQA 8LDHA 1KERA 1YKFA 2VWQA 3C1AA 3FPLA 3JCZA 3LLSA 4H15A 4AFNA 5CPFA 3DFUA 2EW2A 3NT2A 5DBGA 4BNGA 2D4AA 2PZLA 3WGTA 3ZNPA 2IZ0A 4FC6A 1HTBA 3SEFA 2GCGA 3ZWAA 4W6ZA 3KYCB 3WX0A 1NQOA 4L9RA 1AE1A 3K31A 3MZ0A 4HKTA 1C1DA 4IQGA 4J0EA 3TN7A 4OOFA 1N9GA 2NWQA 2Y0EA 5CHEA 2E4AA 1ISHA 2FN7A 2E49A 3CZRA 2V65A 3JQ9C 1R0LA 2HQ1A 1LQUA 4J4TA 4WLVA 1WZEA 3COSA 4MVJF 4BGUA 1LJ8A 4MIEA 4CL8A 4OXYA 2AQKA 3C1TA 5K6AC 1K6JA 4YRAA 3RWBA 3GDFA 4Z0PA 1XG5A 3IDSA 4XQ9A 2GN9A 4NQZA 4CMGA 3F1KA 1WPQA 4OOEA 1UXIA 1V3VA 4BKUA 4QT0A 1I01A 3RC9A 4RF3A 2V6MA 1U8FO 4E2XA 4HNHA 3GFGA 3DMTC 5JO9A 4W4TA 4CQMD 1LXCA 3R3SA 1YQDA 3MTJA 3ENKA 1MFPA 1YL5A 1SC6A 2CD9A 2CSUA 3N7UA 5A3JA 4N5NA 1NVGA 2YV2A 2Y1OA 1U3UA 3ZWPA 1P74A 4BUCA 3OA0A 2CZCA 3ICCA 4B4VA 4U0KA 3JSAA 3QIVA 2PD3A 4JROA 1I3MA 1QYWA 3PTZA 4BB6A 5ICMA 1N1GA 3L9XA 4DIFA 1DDOA 1PL6A 2BF7A 3GRKA 1ZUD1 3MJCA 1O6ZA 3HE3A 5A5FA 2P68A 3BTOA 1NHWA 4AJIA 3PWKA 5G4LA 2HK7A 5EPOA 4OO3A 3GLQA 1D1SA 3BMQB 3VZQA 4CMHA 3KBOA 4PRKA 5BNFA 2PWZA 3A4VA 1NBOA 1CQIA 2OBNA 3WLFA 4BNYA 3I9OA 1YB1A 1E1KA 3FNFA 2R00C 1PS8A 5ILGA 3ETEA 1H93A 1YQGA 3ZW9A 5JCJD 5JDIC 4BGIA 2OFPA 2X5JO 3V2HA 2I9PA 1YH3A 4Q3BA 5TSDA 3S55A 1CWUA 1QYXA 4BMVA 2FR8A 2VOJA 3KUXA 4IM7A 1BG6A 3UGKA 2B5WA 3PQFA 2AA3A 3IMFA 5CPBA 2AE2A 1MX3A 4GLLA 4UVEA 1UXGA 3I6QA 1JU9A 3AUSA 3L4BC 2BI7A 3DQPA 3GMSA 3RJ5A 1PX0A 5L3ZA 3G1TA 2HKIA 3VDRA 3NEPX 1DIHA 3H2ZA 2P5YA 1D4FA 1DSSG 4OSOA 1ZK2A 4CM1A 4E6PA 2FWMX 3E9MA 3WGZA 4LW8A 3EMKA 4Q3AA 4UUMA 5DULA 5L7TA 3DMYA 5AYVA 4IDGA 3H3FA 3L07A 1ENYA 3U0BA 4O0LA 5JDIA 1P1IA 1HLDA 3LSYA 3MCVA 1CF2O 2PY6A 2OMEA 4BO1A 3GMDA 3ZN2A 1DRWA 4AJ4A 1Y9AA 1GPDG 1TT5A 2D5AA 1QXSA 4FJ1A 2NTNA 4YQZA 2CY0A 2QX7A 1PS0A 2JHFA 1M6WA 5F5LA 1LRLA 5H81A 3RUIA 3AWDA 4I9UA 3WNQA 5F1PA 4KUEA 3L4SO 3FHLA 4RPKA 2Q1UA 2GERA 4LN1A 4XYGA 2RHCA 4PVDA 3HQ4O 4J3FA 3NTRA 3ST7A 3DAGA 3IP3A 2Q2WA 4R9SA 4J1SA 3RUCA 4CM8B 1DHTA 2J6IA 1G0NA 3U49A 1ZKMA 3GZNB 1GV1A 1KVSA 1YWGO 1E3EA 2FZEA 3LF1A 4RVSA 1HYHA 3ITKA 3QVTA 3GT0A 3GN1A 4J1NA 4INAA 3GA0A 3QWIA 1BSVA 4YB8A 4RLSA 4XGIA 1SBYA 1WNTA 1ZIDA 2FOIA 1EFLA 4U0JA 2X9GA 2IXBA 3OIFA 2NSDA 3C8MA 3HDYA 4WLEA 1DIRA 3CE6A 5GY7A 2Z1MA 4KWIA 4YA6A 4HY3A 3ZNNA 5A04A 3TZCA 3ONEA 1UDCA 3BMOA 1KY4A 5IZ4A 4ITUA 2PA3A 3B1FA 4UUNA 2F1KA 1DC4A 3D4NA 1PL8A 3RUHA 5DT9A 3DAFA 2O7SA 5JDCA 4BKRA 4CODB 4ALIA 4TSKA 5DOVA 1VI2A 4LSMA 2E6UX 4KZPA 4II2A 1GEEA 1LRKA 2H9IA 4OM8A 4M8SA 3QHAA 1MXFA 1RM5A 3OSUA 5T8KC 3AFMA 2HDHA 4KDEA 3JD3A 3PI7A 5KKAA 3FTPA 2ZK7A 3TZQA 4AJJA 4IIVA 2SCUA 1U2GA 4IUYA 2ZB7A 1DFIA 2W2KB 3QWAA 3DOJA 1J0XO 4IJUA 4BNJA 2FPPA 4JNKA 4TROA 2B4QA 1SMKA 2ZATA 3VPXA 3JQGB 4BNLA 2GN8A 1RM4A 1VC2A 2OZPA 2DT5A 3JQAD 4A03A 3I9MA 3I9JA 4IDCA 2H6EA 3U4DA 2DPGA 1UP7A 4NFHA 2V6BA 5ENVA 1L1FA 2EGGA 5TF4A 2VYVA 2CF5A 2XXJA 4NNJA 3CEAA 5L7WA 4YAIA 5AVOA 1QSGA 1EE2A 1I33A 3DXFA 4JGBA 3F4BA 1FDVA 1GD1O 2FRDA 3E6AA 1DAPA 5CDYA 1FJHA 2ZYDA 5C7IO 2D8AA 1W4ZA 5KNLA 4YT4A 4N5LA 3OQBA 4FS3A 4P4NA 2GN6A 5KJCA 1FDWA 1JTVA 3OJLA 5JYDA 3K92A 5EL0A 1U7TA 1UP4A 4MJLA 3PHLA 3ICPA 4YJGB 1BWSA 3R0IA 2W2KA 1UR5A 1ZZEA 3UXYA 1O0SA 4CLOA 3W8DA 4NIMA 4A2CA 2CUKA 4E33A 4XQCA 3X2FA 3PZRA 1AXGA 4GX1A 3RJ9A 3A06A 3PIDA 1Q7CA 5A9SA 3DBHB 2VRCD 4MVJA 5A05A 3P19A 3PWZA 2UAGA 4WECA 3HDJA 3SBOA 4AJLA 5F3RA 1X15A 4S3MA 2GASA 4M49A 4YQYA 3JYPA 2JD2A 4HV4A 1SCUA 5THQA 2YV1A 3W1VA 2B37A 1MG5A 2QW8A 1HDRA 2RH4A 3RIHA 5DBIA 2VUTA 3PXXA 3CKYA 1AHHA 5ITWA 1KEVA 3BTUA 4PLGA 1YDEA 1Z74A 2CDCA 5ILOA 1ADCA 4OKIA 1JN0A 1ZEMA 4W99A 4D43A 1NR7A 2HMUA 4MVJE 1HSOA 3OQ1A 5KWEA 1FF9A 5C7LO 3VHRA 3WFIA 3S8MA 1BVUA 3ETDA 1ISIA 1PZEA 2A35A 2YFHA 1D3AA 4R4JA 4YT5A 3GVPA 4CR7A 1GR0A 4RORA 1Y8QA 1HWYA 2HJSA 3DZIA 3V1TC 3SJUA 4B4UA 2Q4BA 3VOSA 1ZK1A 2Q1TA 1N7HA 2BHLA 3I6IA 3LT4A 3BTSA 3NAQA 2HRZA 3S1LA 3DZGA 3GGPA 4GGPA 1E7WA 2PKRA 2VQ3A 2YFQA 2BFMA 1XU9A 2BI8A 1IOLA 3QLJA 4FFMA 3EAGA 4Z3KA 3S2IA 3BAZA 4YCAA 3V8BA 3EUWA 3UCFA 2WD7B 1QP8A 4R9RA 2CVQA 3SVTA 1TB4A 1DRVA 4XJSA 2Q2QA 1H9AA 1HDGO 1Q2XA 1VSVA 2Y1CA 4R68A 5DCYA 5AXDA 3Q1LA 4DQVA 4YAJA 1Z73A 1UAGA 1RM0A 2VHZA 1P3DA 1Z75A 1E1NA 4CLRB 2B4TO 1AXEA 3NDJA 1P45A 1VJ0A 1EUDA 1RPNA 4JBIA 5IDQA 3L0DA 1ZNQO 4PZCA 4M55A 4HFMA 3WYBA 3JD2A 5L4NA 3I5MA 1QLJA 3B1JA 4Q3CA 1LSSA 2F00A 4E13A 4LISA 2Y05A 4WUVA 4EUHA 4HXYA 1ENZA 4TKMA 4RVGA 1F0YA 2YJZA 2AG8A 4IS3A 4KTVE 2VNSA 3G1UA 2CFCA 4TRNA 3FRJA 1E6EA 3ZV4A 3WIDA 4WCFC 3RUEA 3ZU4A 4NJOA 4QEDA 2QYTA 4R41A 2GLXA 3I4FA 2A94A 4AVYA 3TWOA 3H5NA 4IJVA 4XD2A 3V2UA 2P9CA 4B4WA 4EEXA 3MJSA 1GQ2A 1R4NA 4XYMA 5A9SB 1UXHA 2JCVA 3TZHA 4MVJP 4GVLA 1R37A 2BKAA 4HWKA 4IPTA 1ADGA 1Y8RB 2DTXA 3GDGA 3LT0A 5JPIA 1ZJYA 5K0ZA 2B4RO 1OC4A 3AU8A 4L76A 2NVUB 2YZ7A 1PR3A 4XGKA 4GGOA 1EMDA 1A5ZA 3OICA 1E5LA 1KETA 2H5LA 4RVHA 2X0RA 1WAMA 1MC5A 3NTOA 2YUTA 4CMBA 2ZJ0A 4Z0HO 4WGGA 4PN3A 4MKXA 1PZHA 3AFNA 2GO1A 4NG5A 3OF2A 1EDZA 3DZFA 1ZSVA 3LVFO 2J5QA 2JFGA 3TF5A 3ZHYA 5KJ1A 4MKRA 4O59O 3AUAA 1HXHA 5LDHA 3E9QA 2FR1A 1MFZA 3OECA 4B3HA 2VT2A 3KSZO 4KUGA 3HSKA 3RKUA 3W4JA 2AQHA 3ONFA 2TMGA 3QWHA 1ZH8A 1YOVA 4QFCA 2WD7A 5KCZA 1NFFA 1C0LA 1E3LA 4P22A 5BSEA 4YXFA 3WFJA 5JCXA 4J91A 2CVOA 1TA4A 3FCOA 3FBGA 1ENOA 3VH4A 2O4UX 3D3WB 1I3NA 1O9BA 3LC2O 2ZB8A 3RCBA 3JQ8A 3OJFA 2Y0CA 3WLEA 5LDGA 4HFRA 3PJDA 3WMWA 4B7XA 2YDXA 3CTMA 1E6UA 2JAPA 1X14A 5HRUA 1YL6A 2I67A 2RCYA 1M6HA 3AK4A 4WCDA 1RM3A 2AMFA 1JKJA 3BMQA 2BD0A 1C1DB 4LMPA 4OYRA 1YQXA 4ZRMA 1HZJA 3D0OA 1UH5A 4MKZA 3E1KA 4FFLA 1PJ4A 3LZ6A 3GG2A 3V2GA 3G0OA 3FBTA 4D3FA 3ABIA 2ZYGA 3INRA 4Y67A 3K73O 3H65A 2HMWA 2Q1WA 3I9NA 3ZNQA 3ZU2A 3M1AA 1EBUA 3WQQA 3U5TA 2XXBA 2O2YA 5ER6A 1UXKA 1ZK0A 4GX2A 4E2WA 5IN4A 5JCJA 4AJOA 3TZKA 1R16A 4IJKA 3JYOA 2GRAA 4J4HA 1GUFA 4Q3NA 3ZW8A 4G2NA 4NK5A 4BNTA 2Y68A 5C5IA 4W82A 1Y7TA 3K2EA 5HWSA 4B8ZA 5KTKA 4J7CA 1ADFA 3BA1A 5JY1A 3WSVA 1NFQA 4OSPA 2ZTUA 1QMGA 3E82A 1F8GA 2Q45A 2EG9A 4RCVA 3ANNA 3WGYA 4IXTA 3IL2A 1E7RA 1XU7A 3ZWBA 3EGOA 1PGPA 1YS4A 2DUWA 3BMCB 3LC1O 3Q3CA 3DBRA 1PL7A 5ES3A 3IS3A 1AUPA 1PJTA 1PJBA 1EEHA 3D3WA 1E7SA 3ZWYA 2ZCVA 3H5AA 1QV6A 1QYVA 1JLLA 3ZZNA 3ZV3A 1PJ2A 5IF3A 3W8FA 2AEJA 2NVWA 1U3VA 2NTJA 5ADHA 3TDKA 1XYGA 1IE3A 5IJZA 1Y5RA 2E48A 3KV3O 2VWPA 5TS3A 1HL3A 3PJEA 1WDKA 3GGOA 3B1KA 1JQBA 9LDBA 4KDFA 2JAHA 5G4KB 3GOHA 1OFGA 2PFGA 4CV0A 4OL9A 2UVDA 1T1RA 1HDYA 1C3VA 4XA8A 4Z9FA 3H6KA 5TT0A 3RSHA 2WYUA 3JQDA 1WDLA 1WLYA 1A72A 4YRBA 3VPSA 3R1IA 4OGWA 3VZPA 2NTVA 2HJRA 3QVSA 1FDSA 2EHDA 2ZTVA 1T25A 1YJ8A 1Y81A 1JVSA 1M75A 2O3TA 1UZNA 3IOYA 3KO8A 3LYLA 5DBFA 3ULKA 4CV3A 4DBVO 4JP2A 4Z6KA 4GWGA 2FSSA 4NU5A 2WM3A 4WLNA 5F1KA 1X1EA 5IG2A 2EIHA 1B15A 4KQXA 4FB5A 3DBLA 1C1XB 4BQPA 2AXQA 4GVXA 1LSOA 4JK3A 4LVCA 3UFXA 4W9NA 2O3JA 4MOWA 1YOVB 1E7MA 1TXGA 2Q1SA 3F47A 2PKQO 2WSBA 1C0IA 3IJPA 4DREA 3FR8A 2C2XA 4UREA 4XB2A 3NT4A 3OIGA 3AI2A 3MWDB 5G2OA 3FWZA 4DWVA 3VTZA 1N7GA 3JQ6A 5CEJA 1VJTA 1YBAA 2I65A 1EQ2A 2HSDA 3FWNA 3IIEA 5KVVA 4GX0A 3DHYA 5JLAA 5I9LA 3TL2A 2EWMA 5ICSA 4ZJUA 1U5AA 1AHIA 2EKQA 3C7DB 1N5DA 3JQGA 4OJNA 3RROA 1LDGA 2GN4A 3RKRA 5T73A 4IS2A 4E5YA 3FR7A 4IQ0A 1FDTA 1DC6A 1H0KA 1UXJA 3Q0EA 3KRTA 3PHIA 2DBVO 2DUUA 2WMDA 4CM8A 4E2YA 1MLDA 3H9QA 3TRIA 5U1PA 1L7DA 2I76A 4FCCA 3ADOA 5DCWA 2UUPA 3UHAA 3WICA 1U3WA 4TWRA 3KM0A 3OJ0A 2JD0A 3DONA 4DVJA 1A4IA 3PVZA 2IODA 4P4LA 3WJ7A 4JBGA 4R1TA 1E3SA 1HDZA 3WXBA 4RJTA 2YW9A 1J4AA 2DVMA 3NYWA 4CM5A 4J2OA 3P7MA 3DO5A 1HE4A 4X54A 4WCFB 3JD1A 5B12A 2Y93A 4N7RA 4B4OA 5H83A 4BKQA 1GTMA 1P31A 4YPOA 3VZSA 3AY7A 3C3XA 1NP3A 4ZN6A 4UEOA 4GKVA 3FI9A 2BMAA 4PLCA 4HADA 4MIYA 5EJ2A 5A06A 1NXQA 4UUPA 2FY8A 4JP3A 4E3ZA 1HETA 2OOSA 4JLWA 1T4DA 3PJFA 5EQDA 2GZ2A 1NQAO 4CQMB 2O3RA 3D5QA 3QWBA 1E77A 4R3NA 2D59A 3UCXA 3ZGYA 1WMBA 4IDEA 1P0FA 4IDFA 4H16A 3VKVA 4ZHSA 1F17A 2I99A 3T4XA 5BT9A 1CJCA 1I5RA 3OMLA 1U4SA 2VRCA 5FI3A 3VDQA 1KY5A 4R3WA 2VCYA 5CEFA 3FN4A 3H9JA 3JTMA 2QRJA 3DL2A 4NR0A 4CMEA 1LSJA 5G0WA 4TKLA 1KOLA 3DBRB 2VHYA 3T4EA 1VM6A 2CDAA 3ZU3A 3U4IA 4ROSA 2VZ0A 3ROMA 2VYVD 2D0IA 2HAEA 3CPSA 4DL9A 1U8XX 4D3SA 4E5NA 4IMPA 3ZWCA 4DBZA 3EVNA 3OP4A 1BMDA 3O03A 2X9NA 2I3AA 1MC4A 1QV7A 4BGEA 2HK8A 4OQYA 4PRLA 3CINA 1XA0A 1LQTA 4JJGA 1ZK3A 4DMMA 4CM9D 1CRWG 2DC1A 4TZTA 4XIYA 4A7PA 1EQUA 1TI7A 4F6LA 2JFFA 2Q46A 3H8VA 1QYCA 4PLYA 4U6SA 3GVHA 2VUSA 3GGGA 1OC2A 1DOHA 3SLKA 4GMFA 4GBJA 3FNGA 1DC3A 1I2CA 1E3JA 3OJEA 2OGUA 5JC8A 4E30A 4PG4A 1EK5A 1XHLA 4NU6A 3NDIA 1PIWA 4NJMB 5LCXA 4Q9NA 2E37A 4PLVA 4DPMA 1PWXA 3JV7A 4DPLA 1DAOA 2BFOA 2NVBA 4OXKA 4GAEA 4NDNE 2RBEA 3H3JA 1BHSA 1D7OA 1LX6A 3UAGA 5IDWA 2I6TA 1K0UA 3UVEA 1KBZA 3Q9UA 4L8VA 4XX0A 5C37A 3KSUA 1ZXLA 2VTEA 2ZYAA 4EUFA 1O89A 4AJ2A 2O2SA 4OKNA 3D4OA 1P1FA 1X0XA 2IYPA 5KKCA 2O4CA 1E1MA 1A9ZA 4DLLA 1GUZA 3OBBA 3RC1A 4A10A 3JQAA 4DMLA 4PLHA 3FNHA 1MG0A 4MO2A 4YVFA 4OHUA 2X0NA 2GSDA 3UN1A 3S2FA 4IZIA 1DLJA 1P1KA 1GZ6A 3F46A 4UULA 4PVCA 1E5QA 1EBFA 5KJ6A 3TL3A 4GQAA 2A4KA 3GC6A 4HBGA 2DFVA 4DC1A 3D5TA 5CDTA 2Q50A 3AI1A 3F4LA 4ZQEA 3JQCA 1R66A 2WEKA 2AHRA 1K3TA 1WXDA 4EJ0A 2EJVA 4EW6A 4LK3A 4PLPA 4D79A 1B8PA 2W90A 1NVTA 1I8TA 5J9GA 1H6BA 1X1TA 4FPXA 1PQPA 3QA9A 3AOEC 1NHGA 3Q6IA 3PIIA 4FFOA 1I2ZA 2EP5A 3HZZA 1U1IA 1Z7BA 3T7CA 4D41A 3KETA 2Y66A 1B16A 3KLMX 4MP6A 2OUIA 3PWSA 1M76A 2JCYA 5JMPA 1DPGA 4WEQA 2DBZA 4NFYA 4CQMA 1JAXA 5KVQA 4NFSA 5BSGA 3WMXA 4EGFA 4YAKA 2ZQYA 1XKQA 4J9VA 4KMSA 1IPFA 3UOGA 1XQ6A 1SB8A 1CYDA 2HRBA 3NX4A 4MIOA 1BRMA 3O4RA 3PQDA 4JBHA 3RUFA 5JBIA 4RV9A 4L4XA 1PU2A 4DLBA 5CG2A 1I32A 3DBVO 3RFVA 1ZK4A 4CR8A 1LTHR 1LDYA 4BNXA 3K2BA 2P9EA 2UYYA 3ADPA 4CMJA 1SEVA 4GSLA 1T26A 2DQ4A 2QZZA 3QW2A 4MDHA 3L6EA 4E21A 3HJAA 3LT2A 5B4TA 1ZMOA 1P33A 2HLPA 4R54A 1KVRA 1U3TA 5JNLA 3NV9A 3FSRA 4D46A 4CLXA 1S7CA 1HKUA 3G49A 3V1UA 2RH8A 9LDTA 1JA9A 3D64A 3OIDA 2V6GA 5IZCC 2PZMA 4XYLA 3HN2A 4FD3A 4NJMA 1C14A 1W0CA 1DB3A 3F9IA 2OP0A 4QSMA 5T8KA 4FJ0A 2Y1GA 4KP7A 2J5KA 4C4OA 4WLFA 3ZU5A 3B6ZA 3DWFA 3JQFC 4TRMA 1GZ3A 3DZJA 1JVBA 4I1IA 3U4CA 3PYLA 1UZMA 7ADHA 5TIIA 1DC5A 4BB5A 5DDIP 1HYEA 3AY6A 4LMRA 4EI2A 5AXBA 4A5OA 1SEPA 1HZZA 1T24A 2C20A 2Y1EA 3IP1A 3H9EO 3KYDA 1YB4A 2VHWA 5GMOA 4D7AA 3HN7A 1SOVA 4XRRA 4XQGA 2Z1NA 2QZ9A 3WNVA 2NVUA 1Q7GA 1V3TA 3I4CA 4D3DA 1NNUA 1T2CA 4YEDA 3NDRA 3RUAA 1X7HA 4RPHA 3HB4X 5B37A 4R1NA 5CG1A 5ER9A 4J2HA 2O48X 1N2SA 3VTFA 2Q49A 1PGQA 4BGVA 4PG7A 1IPEA 4JJFA 5TRTA 5L45A 4XJTA 3I23A 1YONA 4PG5A 3AOEA 3KLPX 2CNBA 4BHTA 4J90A 3BTVA 3GZNA 4EJMA 4E0BA 1DBVO 1BXKA 3WG9A 4NHEA 2AE1A 4YWJA 3STHA 3WGQA 1P44A 1BDBA 2NU7A 3IUPA 3DBLB 5G0SA 3I9KA 1XSEA 4PLTA 2I66A 1DIAA 1E7YA 5M6DA 4FC7A 1ONPA 1RKXA 4WLOA 4YAEA 1ISGA 2EGHA 1JKFA 3B20A 1OOEA 2HUNA 2ZCUA 4ALNA 2OP1A 4E4YA 5FWNA 4NH4A 4Q39A 2EKLA 4FIZA 2VTDA 3RBXA 3I52A 1B8VA 1QRRA 3EW7A 1BGVA 4N5MA 4A0SA 4EDFA 3QSGA 4LCJA 1ML3A 3VH2A 3CMCO 3C85A 1EK6A 4GKBA 4CV2A 4OXNA 2PH3A 4ILKA 4RF4A 3ZHBA 2VRBA 3P2OA 1VKNA 1Q0HA 1T2FA 3HG7A 5I8WA 4MP8A 1SZJG 4CUKA 1XR3A 1YO6A 1SOWA 2J3HA 4QTZA 4BO4A 4WNCA 3EK2A 4RPGA 5IXSA 3GH3A 4DYVA 4PLFA 1GYRA 1FMCA 1A4UA 2Y1DA 4WCFA 4FFNA 3LF2A 3AM4A 5DOZA 4DRYA 4DA9A 1UZLA 5JC1A 1GUYA 5K6AA 3IKTA 4LGVA 4TMFA 1EZ4A 1VPDA 2ET6A 3HADA 4AJNA 1GFSA 3AOGA 1XEAA 3DTTA 4B7CA 3BIOA 2RIRA 3NGLA 1YBVA 4NBVA 4WNIA 4AJKA 3GAZA 4YT8A 2AEMA 1U5CA 4Y8VA 4MINA 5BR7A 5CDSA 3WGIA 1ZCJA 4YDRA 4ZU3A 3WDSA 4MVJH 4CM3A 1PTJA 1DFGA 2Q99A 4U7WA 1DLIA 1LDBA 2OORA 2CVZA 2DM6A 3GVIA 5TJ9A 2B35A 2GDZA 4UEKA 2YDYA 4IINA 4QO8A 1I3LA 4BNZA 1HE2A 3AUTA 3VH3A 1ISFA 4RL6A 3JQ7A 3OM9A 5JE8A 3GY0A 2WJPA 4L74A 1MP0A 5T57A 4E5KA 3RAJA 3MJ4A 3CIFA 5GZ3A 5LC1A 3WYCA 2B83A 4K9DA 1HF3A 4CQLB 1K2WA 1V8BA 2X22A 4IDBA 4TVBA 4ALLA 4OH1A 3UUWA 1PJ3A 3OHSX 1LC3A 4FFPA 1AN9A 1PEDA 1F8FA 1LDNA 1NTOA 1HDXA 1U7HA 1BXGB 1ISMA 1E3WB 2VN8A 5HA5A 4OIMA 3M1LA 3GZ4A 3E9NA 2WDZA 3WB9A 1B3BA 1PGOA 2WD8A 3DC2A 4GI2A 1J5PA 3O8QA 4BMSA 3IC5A 1LEHA 1WDMA 1LLQA 2TMDA 4ONEA 4ND5A 3RBVA 3ZH2A 4CM4A 4MVJG 2DTEA 1PR9A 2VOEA 3BMNA 3DOCA 2PNFA 1XQ1A 3WOHA 3K8ZA 2GPTA 4GX5A 4QQRA 4ZQHA 5IN5A 3K9QO 4GMGA 2W4QA 3BXXA 3KTDA 1EVIA 3WJAA 4D0RA 1VRWA 2NM0A 1YGYA 4O1MA 2R00A 5MGBA 5FEUA 4B3JA 4CUJA 4WASA 1K6IA 4BIIA 4L75A 2OL4A 1LC0A 3LLVA 3PJGA 5T6BA 4CPDA 1NYTA 2DU8A 4QFDA 1VJ1A 3PHGA 4BS9A 2Q3EA 1B14A 1I10A 1SB9A 2IRWA 4XYEA 5JAQA 4KWHA 1XWFA 1WVGA 4M89A 2W8ZA 1YB5A 2WWRA 4M54A 4PZDA 1HE3A 4XWYA 5AOVA 2EERA 2NACA 3AI3A 3ZWXA 2BGMA 2GF2A 3PP8A 3IAHA 3ZCXA 1K6XA 2C07A 4YJFA 4M86A 3VC7A 2J5RA 1NWHA 4QX6A 2G17A 3DR3A 1ULUA 1T2EA 2PD4A 3PDUA 3KOUA 3WWYA 1R4NB 3FF4A 2Y0DA 2POQX 4KOAA 1GQYA 3SXPA 2EP7A 4PGFA 1GU7A 3GK3A 2FPIA 5FYDA 1NAIA 4J0FA 1JKIA 3RU9A 4AICA 3QVXA 1EVYA 2ZTLA 2JL1A 1Q1NA 4QO7A 3Q2KA 4LRTB 1CIVA 2C29D 1QYDA 4EITA 1LLCA 2ZTMA 1GDHA 1WW8A 1ULSA 3JQFA 3MTGA 4O5OA 4BO7A 4P38A 3VKUA 2GUGA 1O8CA 3GPDG 1QR6A 1ZSYA 2FMUA 3QRWA 4WPGA 3DFZA 3VH1A 3W4KA 5B4UA 5BNIA 3GNTA 1VL8A 2X9VA 1ARZA 2ZIZA 4JXKA 3PGJA 2VHXA 2BFPA 3RUDA 1P9LA 1ZXBA 1ZO8A 1YVEI 3WGGA 1R15A 4Y6SA 4ZA2A 4EBFA 4NI5A 3D1LA 1MB4A 1LDMA 1TT5B 2PGLA 5DCUA 4BO9A 1KEWA 4YACA 1TLTA 5HM8A 2X8LA 2H1SA 2W2LD 2WE8A 4HX5A 4JX8A 3AY3A 4MVJI 1PWZA 1WP4A 2G5CA 5HS6A 3H4VA 7MDHA 4Y6RA 4E12A 1A27A 3TFQA 1UDBA 3ROPA 3F1LA 4CV1A 3MJTA 4YJHB 4OQZA 3R3JA 3NJ8A 4ALMA 2BGKA 2VUUA 2R2GA 3M6IA 2D3TA 3LT1A 5CP8A 5DP1A 1HDOA 3F5SA 3B70A 4IDAA 4CLRA 4RZIA 2ZJ1A 3A1NA 3HUDA 4Z9YA 1I30A 2DBRA 4J1QA 1IZ9A 3ZHXA 1V6AA 1F12A 1VKOA 3DMTA 2AQ8A 1BVRA 4GL4A 3TQHA 4BO6A 1BTOA 1KYQA 2JHGA 4FGWA 2BLLA 4CJXA 4D45A 2X6TA 3QWFA 4CMEC 4CMIB 4AJHA 1K5HA 1PGNA 4ND4A 5G0UA 5IDYA 1B26A 1IULA 2DBQA 2QRLA 4R5MA 5A1TA 4TVOA 2C7VA 3GUCA 4WOJA 3A9WA 4XQEA 5BSFA 5JMWA 1FDUA 1E1LA 1P77A 4GH5A 2FHSA 4DYDA 4CUZA 3HNPA 4B7UA 2UDPA 4OAQA 5KVCA 3JQ9A 4IDDA 4G65A 3C24A 3HHPA 3V1YA 3L6DA 4K6FA 1NASA 4RDIA 1R4MB 1BDMA 4CLEA 5F21A 4TZKA 3GDOA 1OI7A 4IZHA 5J23A 1B0AA 5IDXA 4J43A 3WQRA 2Q4EA 1HDCA 1ONOA 1MXHA 4URFA 4RVFA 3RQSA 3FD8A 5T5QA 2HMSA 4MP3A 5CEEA 2YQ4A 2VT3A 3WTCA 4L4RA 4RF2A 1F14A 1RYEA 2FR0A 4F6CA 3K5PA 1CQJA 1FK8A 3OEYA 5I9NA 4A73A 2YV3A 4YBZA 3G79A 4IBOA 4BO5A 1M2WA 5JYAA 4O63O 1YBMA 3UW3A 2HMTA 1NX6A 1B8UA 1N92A 1DIBA 1ISJA 4YJGA 4E2ZA 1A7KA 1N1EA 1O95A 2AW5A 3KHUA 5BSHA 4Y9DA 4ZD6A 1MA0A 2PZKA 3JQBA 1LDEA 1M67A 1ZEJA 3INGA 3LQFA 1V3UA 5TT1A 4AJEA 3NGXA 3MEQA 1WWKA 1ZFNA 2QIOA 3V5NA 3ANLA 2YHIB 4K26A 2GGSA 5EMHA 1GZ4A 2P5UA 3JYQA 5GZ6A 4ZQGA 4D42A 4NBWA 1XCBA 2OHXA 3WGHA 3KSDO 1GV0A 4M87A 4YYZA 4XYBA 2OO5A 3JD0A 4IMRA 4BQRA 1JDJA 5TJHA 1R6DA 5I7FA 2X5OA 3CSDA 1G0OA 4CM9A 3GFBA 3RI3A 3DDNA 4DIBA 1T2DA 3ORFA 2CMDA 3SC6A 1E3IA 2PH5A 3KYBA 4XDZA 4PG8A 5COBA 3JQ7B 4J7UA 2PK3A 1GY8A 1VSUA 2R6JA 2YQ5A 3T7EA 4ZGWA 4PZEA 5A5EA 2JCXA 4UEJA 3ZWVA 1ZMTA 1V9LA 3HFSA 5CDGA 4ZQFA 3DZKA 3DZHA 2BH9A 1Y8QB 4JQCA 3KB6A 1PGJA 1X13A 1UAYA 4BNIA 1U28A 5JDCC 3GEMA 2IYOA 1IY8A 1I24A 2I3GA 4XR9A 1UJMA 2O50A 4HFNA 4AL4A 2X58A 1E6WA 3INTA 2CDBA 1D8AA 1YJQA 2ZB4A 3PEFA 4R69A 1H2HA 1UUFA 5THKA 3QV1A 3X2EA 2VYNA 5JYEA 1E3WA 4U5QA 6LDHA 1G1AA 4WOKA 5JS6A 3ON5A 3UICA 3W6ZA 3F3SA 5I7VA 2PZJA 2GR9A 5EERA 3L9WA 1HT0A 5G4KA 5JXWA 4E31A 1LLUA 4BNHA 5MDHA 4GWKA 4CQLA 3FTNA 1MGOA 2BELA 3HB5X 2JJYA 3C7CB 3DB2A 1R0KA 1OAAA 2GD1O 1R4MA 4QXMA 1ZVMA 2AEFA 2Q22A 2GZ1A 1L7EA 3Q11A 1ZJZA 4FGSA 3FNEA 3EZLA 1PSDA 5JYFA 3KEOA 4WK6A 5I8ZA 4I8XA 5L9AA 3GPIA
chains in the Genus database with same CATH superfamily
2BMEA 2WM9B 2C82A 1KJZA 1Z7EA 3GA5A 4LMBA 1JT2A 2H63A 2PMWB 4KOEC 5JFGA 4B43A 2FHPA 2RGUA 3QEBZ 1P4AA 1VCIA 1LZKA 3F6BX 3GF4A 4I5FA 4LSZA 4PAGA 4TTVA 3HXLA 1N3LA 3TKLA 1B7GO 1MCZA 1TQ4A 1G3UA 4Z9XA 3WLIA 5COAA 4B4DA 4RZHA 4WOPA 4RGBA 1W0JA 4Z9AA 1YTLA 5BSRA 5JS2A 4MB0A 2ZAOA 1GPUA 1TYEB 4C88A 3E9RA 5HJ5A 1SC9A 1TEXA 4CL2A 3KPUA 3R7DA 3X2SA 4C1NA 1XTSA 3DLHA 3I61A 5IAKA 4EA6A 3PEEA 4Z2AA 4G6ZA 5HTOA 3V55A 2EFJA 2IEDA 3L77A 5DYYA 5L3VA 4X62B 1ZHHA 4ZGGA 3K96A 2Q8QA 4X00A 3Q7EA 3T3IA 3LQ2A 4GZ3A 2NTEA 1AGPA 4RD4A 1BXGA 4PQRA 3OUUA 1GEGA 4GO1A 4MGZR 1WX1A 4JOQA 4URVR 3RRXA 5EHZA 4O0MA 2PV7A 1BROA 2GHRA 3AG6A 1OWOA 1TZJA 3IOCA 1N9ZA 3H5TA 3I9FA 4ENQA 5J2TB 1E4EA 3ETGA 5FP0A 4XM1A 2A92A 2Z58A 4RQAA 1X7GA 3NM6B 1YR3A 2ZUCA 2R85A 1RBYA 2W2TA 1QH8A 4RHXA 3OPMA 2P2CA 4ZP1A 3H2KA 4WY5A 3B1ZA 5E4FA 2A5FA 1Y8RA 5HQJA 4REQA 3ZHCA 1RQGA 1IWBB 3VAZA 3H7AA 3RUPA 3VU9A 3MJVA 1OMOA 5ECWA 1Y1KE 1YE3A 3L8MA 2FE1A 2NADA 1DIGA 4LKRA 5AHKA 4CMKA 4S0ZA 4FHEA 4FT4A 2TS1A 3BXHA 1ZGBA 4H6XA 4L4ZA 2I62A 4WJKB 1ZW1A 3GDHA 1G64A 3N74A 1P2VA 4BVFA 4P4UA 1EUYA 1TJPB 2DOKA 1OFTA 3RJZA 2C1ZA 4JIGA 1QB7A 1Q0LA 1USUA 3KXDA 4FCVA 3I1JA 2FH5B 4OHYA 4HP8A 4PM4A 5CCBA 2I7XA 4BV8A 1GZ5A 2EW8A 1VE6A 2N9UA 4U9IS 1Q1EA 3WNBA 4BKOA 4F45A 3SZ3A 2FEXA 5FWYA 4UVIA 3A14A 1MX5A 1H9BA 1Y6GA 2Q0HA 3CJTA 1MJFA 1XL0A 4QJBA 4G1CA 2DTDA 2G0TA 1Y4UA 3PFFA 4QYXA 1HEYA 4GKKB 1N77A 2W2LA 1NUUA 1EFRA 2H2AA 3FKJA 3O1LA 4HRYA 1PK7A 2XADA 5ECDA 2H51A 2PT9A 3VZBA 4ZCLA 3EXEB 4TKUB 2WB2A 3AM1A 1NR1A 1P6UA 2XCIA 3CVWA 5EXTA 5CAEA 3IHTA 1OBOA 2FETA 2Y1LA 1VIVA 2GZRA 1WPXA 4AJPA 5DU2A 2V0NA 4RO0A 1X74A 4B32A 2WWHA 1E5TA 3VSAA 2ZJFA 1E3MA 4BNNA 3U44B 2QUKA 4HSEA 3ZV6A 4MVJM 1H42A 1VHQA 1QC5B 4BO8A 5AVWA 4K6CA 2OV3A 2QNBA 5BV1A 1LSUA 1DJLA 1ENPA 3UT6A 3ZCTA 1QCDA 3KVOA 4M22A 2G7ZA 5B1DA 4KLNA 5TMEA 4LWPA 3ANXA 5K0BA 3RASA 1UMDB 3TVTA 4QGFA 3COJA 1XZEA 5I7RA 2XCLA 3FSGA 3WYAA 2WU4A 4RAOA 1FFHA 4K9OA 4NMHA 3WGVA 1Z63A 4FI3F 3CRNA 1NG1A 1ORRA 4R01A 4MRRA 4P6VF 1FEZA 1XZDA 4RQUA 5DN9A 4AWAA 3WQSB 3UB2A 4XVRA 1C30B 2IYTA 5TMDA 4R3UC 4S1VA 1DJQA 3AR6A 3K8YA 4FOSA 4B76A 2ZUSA 1ADBA 5AHXA 2GXQA 4YMSA 3TR0A 1OZ0A 3WAJA 5KTYA 3A31A 3PQCA 1KI4A 3SLGA 1C80A 4AUNA 4KQEA 4EKGA 1FFGA 3VO1A 3WS7A 1N9GB 1QORA 1RT9A 3W90A 5LPNA 4W5WA 1JI3A 4YV2A 3U4AA 3ANYB 3HBMA 5ENDA 1LBHA 1H6CA 2K2QB 3I01A 4P92A 5JROA 2ZUVA 4CR6A 4GLJA 3MOIA 1QIEA 1E0DA 2FRXA 4IGFA 3P8ZA 2G0AA 3F6YA 1JE0A 4BNMA 4BRZA 1P73A 3H4IA 3GL9A 1WMAA 2PUDA 1JHYA 4WK2B 1AS3A 1MKYA 2BV3A 1YDWA 2YZNA 3B7GA 3K4HA 3QQPA 4N9WA 1QMIA 3IUEA 3UUFA 3IPXA 1XX6A 4OQQA 3P2JA 5BUQA 2JZNA 3U9SA 4CDGA 1KIFA 4XTRA 4Z99A 4Q1VA 4EEZA 1JEAA 3LHSA 4B45A 2ZETA 5TF0A 1YAJA 2GPYA 3N28A 2HU2A 2AUMA 4ZTBA 4DJDC 4L8GA 2HW8A 1PLJA 3E48A 1OPRA 1FVOA 1AKQA 4WK4B 3HCWA 3V8RA 4ENUA 1J24A 5J4YA 1NI4A 3A3PA 4BL5A 2C9MA 4HQ0A 5B3JC 2W5UA 2P7HA 5AP9A 4U7TB 5CBPB 2H1WA 1KDTA 4MULA 2ZYIA 4RKYA 5EMLA 3K70C 3ILYA 4AZSA 1EFPA 3A1CA 3C74A 1DEHA 1C3OA 5UKDA 2ZSDA 3O8DA 1A88A 4TQUS 2P9GA 1RWNA 1OYYA 4FYVA 1J2EA 3QVWA 4Y7DA 3U4HA 2VHVA 3VVCA 4CZ2A 2AK2A 3DKPA 5G0VA 4ZMRA 2GF0A 1Y82A 2HCTA 4LHZA 1EVJA 3HXMA 1TKCA 4CM7A 3M7IA 2OBMA 4G5HA 5DM70 3GEGA 2H11A 3MJFA 3ZHQA 1L8OA 3H1PA 2XH8A 1NDQA 4RD6A 4WY8A 5L51A 1I1OA 3LV8A 2XB4A 2ESRA 1VRCA 1NXPA 2QRUA 2ZIXA 3IBFA 4HMQA 3UCEA 3OCUA 1JPJA 1IXKA 3KBBA 5HKLA 4BKMA 2VYND 3KOYA 2A0YA 5K0TA 1CUUA 2WF8A 4MSUA 4TKZA 4TLEA 5AI9A 1RACA 5P8WA 2RKOA 1PP4A 3PC4A 1G66A 1VL5A 4B8WA 1ZC4A 1CUSA 1OLUA 3HA2A 3SX4A 3W77A 1L5YA 4QDOA 1SC4A 5A6SB 4D6YA 3CVYA 1LQ2A 4QUAA 3GUYA 4HVLA 4UE3S 1X9HA 2ZKLA 2PD6A 3R6DA 2HLNA 1SUEA 1TKBA 3BHJA 2XVAA 3WL4A 3TZLA 1ZM4A 1J49A 2HWWA 4HEQA 1GM5A 1PFVA 1P8JA 1BXZA 4W1RA 1VCOA 1V48A 1CRPA 3WLOA 5F2EA 5GP1A 5AM1A 3RVQA 1U2DA 3P9XA 3MINB 1K9SA 5JW6A 1ZCAA 2V7WA 3B9QA 2V7BA 1TJNA 2ZI6A 4QWWA 3H9UA 1GAXA 1F48A 3IQDB 2BWJA 2NU9A 4EFDA 1F0PA 3BHMA 1C0PA 3PENA 3UIEA 3SC2B 2Z09A 1COWD 5FV4A 1YS9A 2H54A 3IUSA 3ZUPA 1E69A 2ZANA 3FCCA 1QGOA 4EB6A 4F96A 1TQ8A 4RTMA 4DS3A 3C6XA 4V3BA 3JXEA 2DFKB 2DFDA 4MUYA 1A8PA 3TNLA 2ZDGA 1W5BA 5AI4A 4A2QA 1GNQA 4BZZA 2I4NA 5EGSA 1SUAA 1UKYA 1JWAB 5L3RA 1E63A 4EA8A 4H7FA 1T6BY 1Z8DA 3K6RA 3PGKA 3ZDFA 4YP5A 5A03A 3BORA 1LKZA 4KXWA 2BUCA 3TUXA 2C59A 3R5SA 2FLKA 1AN0A 2LIVA 3SBDA 3DD1A 4OH7A 2AEEA 3NIWA 5KHAA 3S4YA 2IU3A 2H57A 2W2XA 1PZFA 3AUKA 2JHAA 4QXRA 1SCAA 4P35A 1XELA 2BMDA 3ZH9B 1DXQA 3S70A 4B09A 3WMFA 3LCVB 2ENUA 3PPYA 3AJEA 4OQLA 2CXRA 1RMYA 3CJQA 4Z3DA 4YGXB 4C7OB 1P2GA 2HSGA 3GUHA 4FKBA 3T34A 4XZ3A 3T3DA 4MRVA 4URZR 4RJJA 2Q62A 1K3FA 1LUAA 3GRFA 2QX8A 2IHZA 3SG0A 3ZJ5A 3EQ2A 4A36A 1YR6A 2FPGA 1HEUA 3RV3A 3NEAA 3SX2A 4UE6A 1J1UA 2XAAA 1TVEA 1P4HA 2WT8A 2W6JA 2Y1FA 4QGAA 2C7GA 3FTDA 2NQ8A 2O5VA 1NG9A 4EI7A 3QPAA 3G0CA 2B36A 1A9TA 5CCDA 5J2UA 4F8YA 3DEKA 5HUHA 5IXYA 5LKAA 3LY9A 3NFYA 2OZEA 4AKTA 1T36A 2X4IA 1JIQA 3B82A 3NYQA 3BFXA 1MAAA 3EIWA 3EWIA 2V96A 2AOXA 1XZJA 3B6JA 2UUOA 5E6UA 3FCSB 4F5YA 1M0SA 3UAXA 2X8WA 1ORTA 3PB3A 4BIMA 1DRKA 4B82A 4PXSA 4E88A 3HCRA 3OURA 1AGYA 1IJBA 4XPIA 5LD2C 4KQFA 3NHSA 2E5WA 5TARA 1EVZA 4HX2A 2NSHA 3S6JA 1YL7A 1EFAA 4CF4A 4I55A 4N3BA 4GBED 2ZSFA 1LRJA 3V6LA 1QF7A 4C06A 3QP9A 2VF7A 4QM7A 3BRWA 3FIJA 2YZKA 5AUPB 3O4JA 2JLWA 1L5HB 1P1HA 2GTPA 3L7IA 3PFWO 4J6FA 4XB1A 2H92A 4KWTA 4FN4A 4QWMA 4JEUA 4OHWA 3TGWA 3F97A 1VCMA 3IXQA 5EQFA 4IIYA 3IAFA 3UMRA 1SXJE 5DHRA 2EKPA 2AWOA 3I6YA 3V1KA 5KYTA 2ZCJA 4C3OB 3E9YA 3DL0A 3GPBA 2VRWA 3UMFA 1IRXA 3MD9A 1OGYA 3OJOA 4G81A 5CLQA 3CX4A 5LB4A 4WEOA 4R71A 4J2TA 2YYSA 4NPCA 1CRZA 1VLQA 3FDXA 1PWHA 4B2YA 3QVKA 5JU6A 1RC8A 4FKMA 3R75A 3BGOS 4WE3A 4BNWA 3E5MA 4DAOA 4RFLA 4YCDA 1JJIA 2C61A 2R6DA 2WT9A 1ZD4A 2BVNA 3UAZA 3WL7A 1OGJA 3O4GA 3ZX5A 4CI9A 3U16A 4Q7KA 5KNBA 1TJ5A 1SO8A 3AW9A 3OE4A 2IP1A 2VG8A 1L7NA 2EJBA 3PE4A 3R0JA 4LJ7A 1R3DA 5T64A 3N2EA 3TOZA 3WWZA 3MTIA 4BFLA 4ID9A 4P8RA 4M38A 2ZIAA 2J3IA 1I7DA 1SBCA 2AFVA 2Y99A 2ZI3A 2B8EA 4OHMA 3G5AA 4LV5B 3M4NA 5EXPA 1HX7A 3A2LA 2WQZA 3LQQA 4KLRA 1RQRA 1TVKB 1F6DA 1SHKA 2O2ZA 4G8DA 3GAFA 4QUEA 2VDOB 4DC0A 2OHJA 4H4DA 3UT5B 1WJGA 1LNQA 1JDUA 1UL1X 1XXHE 1XNQB 4A26A 1T5TA 1W581 1XLTA 4MGYR 4UD6A 1W85A 2IYZA 4S04A 4RD2A 2AG5A 1T3GA 4H4CA 3H16A 1AZLA 4GMHA 4KPFC 3U62A 5FOUA 4G1BA 4MVJD 1LPOA 2D5CA 1UKEA 5JH7B 3IPAA 1XZIA 2ZWPA 3FDFA 1RWQA 4UZEA 2YHUA 3K8OE 3A4LA 1HQCA 3I6ZA 1SJ9A 4YCSA 3ESAA 4ZAGA 4PZUA 3ZV5A 2PSSA 4DDTA 3PDIB 2EEPA 4Y6GB 3U6BA 3MINA 3ETCA 1XAHA 3BERA 4BAUA 3W6UA 1QRTA 3BK1A 4Z4GA 6AT1A 4JLPA 3I4LA 1RLIA 2D2XA 2H0QA 4IYRA 3ZTWA 3GRCA 1NQTA 1WUKS 2QTHA 1PRYA 4LFAB 1UT8A 2I4RA 3F96A 1NPTO 4F5WA 5A4DA 4CIYA 2O8NA 3CZQA 5EVJA 1DKOA 4KACA 4JLMA 2HPVA 3JD4A 1M3SA 3H5OA 2W00A 4XOIA 2QAGC 2RFLA 1IM8A 1PT6A 1R0XA 3WL3A 4Y2JA 5IKEA 3CF0A 1NN0A 1ACJA 2XE4A 3QXJA 2WSMA 4GPD1 2VAVA 2M6RA 2QENA 3EZNA 1FX0B 4MPTA 2O1EA 4P4GA 1UBGA 3L0YA 5EXXA 4GOLD 1PDWA 1J00A 1HRDA 4PYOA 4TZ0A 3AUUA 3OQ6A 2FPIB 4MQFB 4B3GA 1LBTA 1CETA 3EHDA 3FXAA 3L7JA 4KQMA 3C1OA 4DQUA 3VZCA 1M10A 4MUHA 1CULC 1UMBA 1Z25A 1K6EA 1IN8A 1JQJC 3AEXA 4N7MA 4PPFA 2JA2A 1BX0A 1WHTA 4MWSA 4YJHA 1GUBA 1KIMA 3F5MA 4QU8A 4XCXA 1P0CA 2D74A 1PVDA 5J40A 4A6XA 4UOEA 3OT5A 3EC7A 2HQRA 3ISTA 4XVHA 1ZBDA 4DLXA 1CHDA 2CUZA 5IC6A 1OAKA 2G8LA 2Q3LA 1KQ3A 1KEPA 1MVOA 2ZB3A 3KYDB 2Q1XA 4QZVA 4YMIA 4Y98A 4JP1A 1N4AA 2O23A 2R5FA 3MCAA 4V0OA 4X60A 3TE6A 4EW3A 4V1CI 3C5WP 2QPLA 4RACA 2ECPA 1E99A 1I1NA 1I13A 1QK5A 3C5HA 4I5IA 2EZUA 2RE8A 1QRUA 3SM3A 4EAQA 3FROA 2P35A 1AVTA 2CK3D 3O92A 5BN5B 5B1YA 3G2NA 1N7IA 1KMMA 1BCRA 1KZ6A 4QUKA 3UH0A 2IZZA 1U63A 1ONNA 4KIFA 3CX8A 4J6EA 5DF1A 2X0IA 3VRHA 2CLLB 3NO4A 3TFOA 2QTAA 3HPQA 1YRLA 2JFYA 3OZFA 1QP4A 3BBPA 3IVRA 3RSOA 2ZJ6A 2AFIE 4X84A 2EXXA 3K09C 1AMOA 2FFBA 2R86A 2WUWE 2RJ3A 4MHSA 1D2MA 3A1FA 1ZRNA 1A9QA 3HO6A 2YHBA 3KR2A 3P0FA 5AJWA 4Q4DA 4DSTA 4ZAYA 3OE5A 4BO0A 3ZLBA 4XPZA 3THYB 1DQYA 1H6AA 4NTZA 3RF6A 4B7ZA 4R1UA 1EJ0A 4GR5A 4K9NA 3AU9A 2P0AA 2R8OA 2IWRA 3LP8A 2QT9A 2SICE 4HRAA 1MU0A 2GXAA 1XCJA 3PTLA 4NOKA 2OQRA 2XVXA 4DGQA 1OI3A 1EKXA 3BWXA 3NJ4A 4HGYA 3E1SA 1APBA 4I9GA 3QFSA 2IYSA 3ICOA 3CLRC 2IHTA 4NV0A 2DPHA 3BMNB 1Y7LA 1UXOA 3BIWA 1RHRA 3AEQB 4S2UA 4UXHA 4JASB 3QX8A 2VZ9A 4JR0A 4ZIRB 5LQUA 3K0BA 3GJXC 1P3Y1 4PR3A 2R97A 5BN5A 2HV9A 3FPLA 3AKYA 1FS6A 1L5KA 3W6OA 3OD5A 5ALDA 5CPFA 2OGWA 5DBGA 3PXUA 3MQ2A 5BYAA 1C9EA 5ALUA 1JTFA 5I48A 3OT1B 5CXXA 5KOJA 2A9RA 4MPRA 4AZ0A 3THXA 4HAUA 2GCGA 3SEFA 3P1JA 1RP7A 4B6QA 3SJCA 3EH1A 2RARA 1US8B 1NQOA 5IF9A 2OBXA 1U2PA 4J0EA 4HKTA 1C1DA 1YOBA 4IQGA 3DT8A 4LNUA 2AN3A 4PC6A 4AIIA 1D6MA 4YAOA 2X2PA 3R7LA 2QXYA 2FN7A 2E49A 3AVPA 3CZRA 3K7EA 3T94A 3S5JA 3JQ9C 1R0LA 2PSDA 5EE9A 4B35A 1WZEA 2NW6A 3CBQA 3AI7A 1SHTX 3QXHA 1XFAA 5ADUS 1QZZA 3JAKA 4QGSA 2XDQA 1E32A 3MD0A 2JAQA 4FS8A 3C1TA 4WN9B 5CM8B 1O6BA 2F9MA 5BNZA 1XTIA 2CLCX 3K16A 3LL7A 3QKSB 1OZGA 2G4VA 4TT3A 2XXAA 1VTKA 3JATA 1QKJA 3IDSA 4XQ9A 4U8HA 4CMGA 1NURA 1DTEA 1YI8A 2NO6A 1GRRA 4OOEA 2BDUA 3U40A 1UPCA 2CNWD 5FWDA 4C0LA 1I01A 1QKKA 1FXWF 2OTCA 3PA6A 4G24A 4D4IA 3AVVA 1U8FO 1UBMS 4L8FA 3KYJB 2XRZA 5E0OA 1MH1A 2HNAA 4D8TA 2MMCA 5EJMA 1U7DA 2Q6TA 3R3SA 4ICIA 5HF6A 1E9FA 2ZRCA 2J33A 1P4SA 1G2IA 3B53X 4JS0A 1QPGA 4QJ5A 3RS2A 1HQDA 3VR0A 4RNDB 4O4LB 4FCTA 4X20B 5JANA 1NVGA 4OJQA 1H2YA 2PM8A 1U3UA 3RAPR 4Q4AA 3UGJA 3PUZA 5KSYA 4PHFA 1UWVA 1WZCA 1WHTB 1IHUA 4U0KA 4HLNA 1QHGA 5E9AA 3TLJA 1BX1A 5ICMA 1XEFA 1WNFA 2QLNA 4HXFB 3QU7A 4UNRA 3C5VA 4OTZA 4IIJF 2MYTA 2LTAA 4M7WA 3UYLA 4YASA 3MJCA 3GLIA 5KC9A 1UJBA 3KSBC 1KAOA 5A5FA 2O0LA 2P68A 3UWPA 1NHWA 1MHPA 2XZTA 1NJGA 1G21E 4FE3A 5G4LA 3EUAA 1USGA 4COOA 1CFJA 4S1NA 1Y3FE 3JVVA 5K3AA 1RBZA 1CZLA 4PNHA 1N6KA 5KS2A 1WXGA 2PWZA 3T5DA 4G5FA 2WLSA 2HX1A 1DCKA 2XA2A 1PW5A 1E4YA 1WZNA 3FYSA 1KPGA 4GFDA 1EB9A 3RYFB 1E1KA 4DV3B 3ZGNA 1VLJA 2FP4B 4JODA 4ZOLA 3F3KA 3EIQA 5JD6A 2XV1A 1P9NA 3EGVA 3GIDA 3ZW9A 3KQKA 5JDIC 1M2JA 4BGIA 4FVTA 5FUWA 2PVPA 2X5JO 2WIAA 3O0DA 4Q12A 1HT1E 2HRDA 1W36B 1YH3A 4ETWA 1L7PA 2I78A 4PHTA 5JWHA 3VO8A 1CWUA 3CUEF 1BE0A 2FR8A 4BMVA 1P2DA 4HN4B 4IM7A 1QF9A 1BG6A 1JLKA 1Q20A 2B5WA 2OBBA 1T6YA 1YNSA 5H1YA 3UTCA 2VJPA 3W5IA 4HNUA 1MX3A 4GLLA 4JL6A 3P9YA 3GP8A 4DTCA 3T1HB 2I2XB 1NC3A 1GLGA 4Q4JB 3BEOA 5DKFA 3GMSA 3RJ5A 1PX0A 1JG4A 1W1IA 2EF0A 3AJ9A 2HKIA 2WIKA 4G5YA 3V8MA 2XLBA 2ETVA 1DIHA 4GWLA 5KTMA 2W83A 5H80A 1D4FA 3TSWA 4ZJPA 3P2MA 1T9ZA 1VE5A 1ZR2A 1A9PA 2QRGA 4ECAA 3HMKA 1L9KA 2FPRA 4CM1A 1GNPA 3LZCA 3E9MA 5KQSA 4LW8A 3EMKA 2IHJA 1GU0A 4WN3A 2DETA 4BFXA 4ETMA 3H3FA 4UW9A 2GARA 3I0MA 4R8KA 4M8NE 1P1IA 1HLDA 3LSYA 4F9FA 2GWRA 3G0IA 1YV9A 3FPSA 2Z5FA 5CYOA 5J63A 1GGEA 1Y9AA 9ATCA 4KMOA 3KIPA 4KLCA 4BTVA 5GJVC 2B25A 2D5AA 3MRSA 5DHSA 5BT8A 2R66A 1N0HA 4JDPA 1Y5IA 1YDGA 1ZI6A 3WNQA 3AWDA 3ENVA 3OWXA 3SKYA 5CA0A 3CA8A 4JJAA 2JCBA 1BWPA 2YBDA 4PZPA 1S2IA 4TLBA 2VDQB 1L7VC 2GERA 4XPIB 1J25A 3L6RA 5A71A 3BD9A 1FY2A 2MINB 4J76A 1CUVA 4LGYA 3HQ4O 4ODIA 1SUFA 3QUSA 4L5IA 1GKYA 3VJLA 1HMYA 5KWVA 2JIOA 3DAGA 3IP3A 2BR5A 2Z8ZA 2ZVPX 2Q2WA 5C0OE 4R9SA 4RQBA 2R84A 5DVZA 3SR3A 1JQEA 1V95A 1A5SB 1U2GC 4CM8B 3RNLA 5AH0A 3IEIA 2R47A 3B8HA 1G0NA 4ZHQF 3TB6A 2VPTA 2XDYA 4I6GA 3GZNB 3U39A 1RPJA 2G3YA 3FSEA 1JIIA 1KVSA 1CCWA 2IKQA 2ODBA 3IA2A 3JAWA 4R7GA 5FOWA 1EAMA 3LF1A 2QUIA 4RELA 1HYHA 2WKSA 3QVTA 3PNBA 5AW3A 2BKEA 2P1DA 2CCKA 2JI6A 3HU3A 5DIFA 3UFBA 2GVZC 5HGXA 1LS6A 4PWYA 4M9QA 3C6YA 2F4NA 2AOUA 4RLSA 1E8MA 1YS7A 4W1QA 3BJRA 3VNAA 1OCEA 2V5AA 4OU4A 2F55A 2PT6A 4UCWA 1XEXA 1XLUA 4HPWA 3VTAA 1EFLA 4XSHA 3OIFA 4L8WB 3C8MA 2NSDA 3JALA 4FONA 4GP6A 1DIRA 1QVVA 4KYUA 4MUNA 4QUDA 5FBHA 2Z1MA 4BFCA 4YAWA 5DNCA 1G20E 4KWIA 1FBTA 2OAGA 5ARDA 3C3JA 3ZNNA 1BQ3A 4YI3A 2ATXA 3PVSA 5EKTA 5J5VA 3KGDA 1ZN9A 3UENA 5AW4A 5CFQA 2WNHA 2DF8A 1ZY2A 1VCHA 1IZ7A 2F1KA 3JZAA 1PL8A 3SQMA 3ECAA 5DT9A 2V54A 3ND7A 5TGZA 2XHZA 5IULC 1X7ZA 5CHYA 1SHLA 2NYUA 4CODB 5DOVA 3OIUA 4F93B 3IPCA 2E6UX 3L0CA 2EQ5A 3AF1A 4LV6A 1QTRA 3GUUA 5HFJA 2I91A 4BXOA 1E2IA 1GOTA 1W2GA 5HIAA 1JE1A 2H9IA 3DVRX 4HDNB 4E2FA 4IUCS 1RM5A 2J7KA 2DY1A 3B38A 3SOPA 1Q6YA 3W3AA 4KGXA 5ES4B 3FTPA 2KHZA 2ZK7A 1Q92A 4IAOA 1WKBA 2YNMC 2SCUA 2D5BA 3L5KA 3HXQA 2ZE8A 5A4IS 5HMMA 1NXTA 1BNCA 1CJMA 2NZUG 1XPUA 1Z2NX 2FPPA 4OP3A 2WKQA 1SMKA 4FZ3A 1ECPA 2WIDA 1NVVR 1VC2A 4KFUA 3QLVC 4MB6A 1J0CA 3DJFA 3I9MA 3FYHA 3B9RA 4RJ2A 3IBCA 3MB8A 1SVMA 2AZ4A 5D3KA 4DF3A 2R7KA 5IM5A 1OTYA 5E2BA 1M33A 5TF4A 1OPXA 3ND9A 2ZSHA 1JEDA 1U6IA 5IMSA 3G0HA 1X1RA 3E58A 4NNJA 3CEAA 1U0RA 2CYAA 4O4HA 3ZY4A 1K75A 5AVOA 3IKJA 4Y7CA 1UK8A 1EE2A 1I33A 2C97A 5CLIA 1GTL1 2I55A 3IJ5A 2QTLA 4A8JB 4MR9A 5ALTA 2IBSA 1Q0RA 3Q3IA 3TTTA 3E6AA 3UPTA 3UJPA 1H2XA 2NUTA 2BHRA 4HVTA 1MRZA 2ZYDA 5C7IO 2XWBF 2O52A 3VYTB 3F7NA 2I2AA 3VR2A 1TYDE 1KI6A 5CT5A 4N5LA 4EBBA 3GLFA 2BFNA 3OWOA 3R0XA 4P58A 5DPMA 4P4NA 2PANA 4TLMB 3EG9A 4N3AA 4FEAA 5LFAA 3D2LA 2GH1A 3FMVA 2Q6OA 1T91A 3WKCA 1KAQA 5EL0A 4ENSA 3F9CA 3PHLA 3JW8A 4LEIA 5AKLA 2FPUA 3R0IA 3OC0A 2Q7XA 1W49A 1MA3A 3IEKA 4TGLA 1O0SA 1M73E 2V55B 4XTCS 1MQ9A 3SY8A 3MWYW 3SIPA 3E84A 3DPIA 4RFSB 3W8DA 2IS6A 4WV3A 4LF5B 5DN6D 2CUKA 1EVEA 3PL1A 1E9CA 4GX1A 3RJ9A 5JXJA 3PIDA 3ZE6A 5A9SA 2P69A 1RHQA 3DBHB 4GS5A 4MS4A 3W79A 4EZIA 2Z2IA 2D6FA 4ENPA 4MUGA 1IMOA 3K8QA 4O2AF 4QOFA 3T3MB 4N8DA 1IXSB 3HV0A 3PWZA 4LDJA 2UAGA 4O3FA 2LCIA 1DDGA 3TINA 5F3RA 4AJLA 1Q77A 4M9ZA 3F6CA 5BY2A 3QLVA 1JHUA 3F7OA 4EP1A 1XLTC 2Q3JA 3QNMA 4YQYA 4EYOA 4RTSA 4JXXA 5THQA 3DDUA 3W5JA 1KXJA 1XYVA 1NF8A 3H1AA 3N8NA 1P7PA 4HLCA 1VZ2A 1HOTA 4E1VA 5C34B 1V2HE 3PXXA 4GP7A 5DI9A 1YVPA 1AHHA 3BTUA 4PLGA 1YDEA 5ILOA 2R5NA 4OKIA 1DTSA 3R5XA 4NPAA 5BN4B 2ZUTA 4W99A 4I81A 4QFMA 4UHHA 3UC5A 4JH0A 4D43A 1VB3A 1HSOA 3JALB 3NAZA 4PZ9A 3U61B 2FJPA 2ZBEA 3R7BA 2EAUA 2L2QA 4NXMB 1J8YF 1BVUA 1MJGM 3RGGA 3MPOA 3MCTA 4X1YB 3KUKA 4R4JA 3SHVA 4WTOA 4EFLA 3PQ8A 3R5JA 4HDRA 2QYOA 5KI6A 1RWXA 3GVPA 2HH9A 4KNWA 3UT0A 5K8UA 4DV7B 4TWJA 2DY0A 1AJEA 5DHPA 4RORA 2JANA 3OAAD 1O9GA 1T0BA 1RHUA 1VLHA 2GM3A 3DZIA 2A86A 4HWTA 1QWSA 4IGKA 1GUDA 1W9MA 2VI5A 2FOXA 2ZT6A 5E4YA 2ISSD 1Q1QA 3SWWA 4MZDA 5ELXA 4FFBA 4Q6BA 2HCBA 1ZK1A 3M6FA 3VTKA 2I3BA 3LT4A 4OK3A 1QFSA 3ETNA 3NOQA 4Q03A 3Q8KA 5LQJA 3S1LA 1PJ8A 4BP3A 4GC9A 1QPBA 2VPPA 3VDXA 3TAUA 4YCLA 4HGQA 2XKAA 3LCCA 1VI6A 3OSZA 3ZCVA 1UC9A 1J1ZA 2C3MA 2VKQA 3STWA 4FFMA 3GX1A 3TTSA 4CKEA 3EAGA 5DXFA 5AW8A 1RFGE 2GYUA 2ZRLA 3KYIB 3SU8A 3RK1A 2B92A 4Z3KA 2O8EB 1Y8ZA 1TM2A 2CYCA 3KJHA 5AUQA 5IU6A 2UXDB 3EUWA 1OROA 4MR7B 3SVTA 2CVQA 3KZKA 1TB4A 2AJDA 2F3PA 3A6ZA 4IWNA 3RF7A 4AX4A 2ZS8A 5LQDA 5A4FS 4CEJB 1HDGO 2WA1A 3OD1A 4R68A 3TM4A 1KQGA 1Z73A 1C9JA 2R751 1RKQA 2VHZA 1P3DA 4DMHA 4UZFA 1AXEA 3QJYA 2GFIA 2QX6A 3NDJA 2GTIA 2HQOA 3PQ5A 1MC1A 1SKAA 2RSLA 3OZUA 3AX6A 4YQEA 1AX9A 5IT4A 3NTVA 5AM5A 5LSAA 3L0DA 1JEEA 4G4SP 1ZNQO 4PZCA 4HFMA 3WYBA 3JD2A 2UKDA 3RHSA 1FP4B 3OZDA 3WC4A 4F6RA 3PXBA 4TYYA 2F00A 4HATA 1FSSA 4LISA 4PCLA 1NMQA 2B0CA 2H5JA 4RVGA 3A2KA 2OV1A 4U5XA 2AG8A 2HO4A 5DHAA 3SICE 2CFCA 3FOBA 4H17A 5HZMA 4EGJA 221PA 4Q7EA 2UZ3A 3RSLA 5L3SA 2FDRA 4LZJA 5LZ7A 2ZAGA 4QEDA 3G2MA 1GHTA 1L1EA 1GA6A 2YMPA 4Q15A 2A94A 3TWOA 3GJ3A 3H6GA 1G21A 1ST2A 4NEGA 1K6MA 1P1CA 2WSYB 4XD7A 5ICGA 2HA6A 3I0ZA 5DMXA 3RWMB 1I6MA 2NTYC 1TA0A 4L4YA 1QOZA 3MUFA 4XYMA 3NTLA 3LIPA 1E2DA 1UXHA 4EVIA 5A9SB 1H2EA 4EG1A 3AC0A 4GVLA 1R37A 2BKAA 2ZWIA 5K0EA 1Y8RB 2WJVA 3ZYZA 5H7XA 1YJ5A 1Q0SA 3AU8A 4KXFB 1U8TA 4Q00A 1PR3A 2CK3A 1ZJJA 3MQ4A 4R98A 3LWZA 1E5LA 1GZSA 3EP9B 1Q22A 1SXIA 4V02A 5HCNA 3W3AH 3D59A 1TO6A 4JVOA 1GZUA 2XUAA 2GWHA 2Z3WA 5LZ9A 2QLLA 1OR8A 2NG1A 1M2OB 4FYJA 1YGPA 2EFYA 3FCAA 5JHHB 3VSEA 4WGGA 4PN3A 3AFNA 1QTIA 1Q17A 2GXSA 2GO1A 2JW5A 4FN5A 4HNRA 4LHSA 4NG5A 5IW8A 5FDFA 3PX7A 2ZZMA 5BQ5A 1SVNA 5LN1A 3DZFA 3EOBI 1TAGA 4O4LA 1R10A 3AHGA 4G5XA 1G9TA 1NRIA 2YL2A 1U2DC 2J3DA 3TF5A 3AUAA 1HXHA 2HCJB 2PKXA 2E4VA 3E9QA 1XMVA 5H5JA 1MFZA 3W9UA 1NI5A 1Z2DA 3CYFA 4GC5A 4ZAFA 5EHIA 4K2AA 4KJZA 3UMCA 1K8ZB 1JQKA 3EZ2A 5DM4A 1GPWB 1IN1A 2ZIVB 1SCIA 3W4JA 3V4OA 3RABA 5LM3A 1SCDA 1P17A 4RBNA 4MWCA 1CK4A 1YOVA 3ML1A 4QFCA 3URKA 4N39A 3W3ZB 3R5KA 1A5AB 4AUEA 3IR6A 4EO9A 5KCZA 5DW0A 5GWXA 2PX4A 3ZQ4A 1SQFA 3QIAA 2ORWA 3STUA 1M2GA 2GESA 1ENOA 3T7AA 3D3WB 3PXDA 1I3NA 3WAKA 3LC2O 2HWXA 1E4EB 3RCBA 3NOXA 3O9VA 4O3MA 2IH5A 1E2JA 3NG1A 2KWIA 1NJ8A 4YIKA 2YDXA 1E6UA 2JAPA 1X14A 3EEIA 3ZD9A 1YL6A 2R9VA 3TR6A 4ZJZA 3RS8A 3C8ZA 1KZHA 1W34A 1JKJA 3BMQA 1B00A 1BA3A 1C1DB 3OKCA 3WLHA 1TDJA 4DC9A 4TYNA 2PUTA 3IWDB 1NRXA 1YQXA 3CRVA 4XGRA 4YO8A 2ZRGA 4AF8A 4YRGA 5L3QB 1UH5A 3T3EA 4HDQB 2OLJA 5CJJA 4GOOD 1FSGA 4J0DA 4XLLA 5F7JA 3T4PA 4JI0B 3E1KA 4N5IX 2CWDA 3SGLA 1E6KA 2FX2A 3GG2A 3JVIA 3LQ1A 1IZYA 3PF9A 4X1YA 3DM5A 3WHPA 1T9DA 2D00A 4D9GA 1SN7A 2HK6A 3H65A 2WU3A 1NZFA 3H1TA 1S2LA 1VJRA 3B85A 3MERA 4LWQA 4GYWA 4V0KA 2C77A 5FEMA 3FPJA 2NN3C 3IEUA 1HKHA 5F23A 2R6ZA 2DT8A 2QVYX 5JCJA 1A82A 2V6IA 3B2QA 3TZKA 1XQ9A 4ESVA 1R16A 4IJKA 1KI2A 5BPFA 1RKUA 2GRAA 1E1RD 4J4HA 3ZW8A 4UC0A 2PUWA 3DYVA 1I51A 4G2NA 4E4YA 5C5IA 4W82A 1Y7TA 2ZROA 3A27A 4PPYA 4B8ZA 4EY8A 3BK7A 3BA1A 3WSVA 1NFQA 2JZOA 2GJ9A 1YBHA 4LF6B 1XAJA 3GRRA 5CCEA 2Q45A 3T7SA 2O7NA 1AT1A 4EH1A 3VSCA 4Z4HA 1E7RA 5JJBA 1XU7A 1ODJA 3ISJA 3EAQA 4N12A 4K9RA 3BMCB 5AOCA 1F60A 3DBRA 1QVAA 5ES3A 4EHNA 2II6A 3VR3D 4L1KA 2XSZA 4LF4B 3DE6X 2FP3A 1RWKA 3DNPA 3LPCA 3H18A 4YXWA 1E7SA 1PQYA 5EE1A 4UM5A 4E51A 3HDTA 3FDZA 4ZYWA 3WMGA 3LOQA 1CUBA 2A1TR 4ZYXA 2FFJA 3W8FA 1JHAA 5EWJB 3VI4B 3MVEA 4QATA 3EMDA 2G1AA 2VWPA 2AW3A 3PJEA 4Z8XA 3B1KA 4LG1A 1GJRA 1T6NA 3H0VB 3DOIA 3GFRA 1M1YB 4ZOEA 1DL5A 2VHQA 3QW4B 3GLFB 3GOHA 1KXZA 3L7MA 4HAVA 1YRYE 4OL9A 3K32A 4URWR 2HXGA 4Z7OB 3B52X 3SHWA 1J9ZA 3EEFA 3MMXA 2FRDC 4TV8B 4BDSA 2LP4Y 3VX3A 3UHPA 1YMVA 3CO5A 1JJAA 1FLNA 1K4MA 1S4QA 1VRVA 3VZPA 2XCRB 4JBYA 4A6DA 2FPMA 5FKJA 4INPA 3L79A 3OPYB 1E1YA 3C3DA 1TTPB 1Y81A 2V97A 3KO8A 1UZNA 2Z2YA 3IOYA 4LQLA 4PSDA 4GE3A 5BW5A 5H9WA 2Q3MA 2H0RA 2OZKA 4B5KA 5J4KA 1NDUA 2B8NA 2YTZA 4NU5A 2IPLA 3CLSC 4WH0A 5F1KA 5IG2A 5FJIA 3LOUA 1NR5A 2Z6AA 1WE2A 4FB5A 1XCOA 1G8FA 3T61A 1C7ZA 2AXQA 2ZYUX 1NRWA 2OBFA 1PYOA 1FZQA 4M36A 4WKPA 4W9NA 3NRJA 5FWYB 5IAJA 5KDDA 1UBTS 2JI9A 4DA8A 2ZUDA 5JWRA 3KQNA 1W96A 4E33A 1TXGA 1P18A 1W0JD 3ZDYB 3EISA 3NHLA 2CEAA 2WSBA 4LYEA 3A9TA 2C2XA 2HCFA 4RESA 2BCGY 4MK4A 3DR5A 2OECA 2BT4A 1T4CA 1SBHA 2WJYA 1CR0A 3QPDA 1L3IA 4MV1A 2OG1A 4N1AA 2WV7A 2WA2A 3UOWA 3MWDB 4D02A 3FZGA 1TZ2A 4EOGA 3E27A 5G2OA 3BJMA 3TKYA 4DWVA 2CXXA 3MM4A 5CEJA 1OXSC 4K9QA 1VJTA 2I65A 4ZHQA 3EVBA 4PNPA 3KXKA 3W5BA 3H2BA 2HJGA 2PZGA 3FWNA 4Y9SA 1NW3A 5FPYA 4GX0A 1X7ZB 1ZD9A 4OXQA 5ICSA 4KVFA 1HZZC 1U5AA 2CD7A 4OJNA 1N5DA 2YWDA 3S40A 2GN4A 4D0NA 3D54D 4MI3A 4QIHA 4JI4B 4IS2A 1RXSA 3OX3A 3TCXB 4DJAA 1Y1RA 2EZ9A 4MWDA 4YJ3B 5IABA 3A0RB 3GLIB 1FDTA 2I2CA 2HNBA 2NT4A 3SQOA 1RHKA 1IVYA 2RB4A 3HEBA 5AKZA 3JASA 3Q0EA 1AU9A 1Q83A 2QTFA 2R6FA 3D6TB 4E5SA 1E5DA 2RI1A 1XMPA 2AJCA 2OT3B 4K5QA 4QELA 4TWZA 3REQB 3TRIA 2E5FA 1ECJA 1L7DA 4TTJA 1G6Q1 5U1PA 1NNI1 5FOTA 1ULTA 1W52X 2QV0A 4LOIA 4F4FA 3W8RA 1X8KA 3UHAA 1YZVA 3G8AA 1HG1A 2ZBPA 4RETA 2FZKA 3UATA 3A6DA 2RGDA 3PVZA 4EK9A 2IODA 4P4LA 1M2FA 2PHZA 1F2UA 4EPRA 4ZCMA 1WSAA 2PZAA 1IN7A 2PWBA 3B5IA 3G5TA 1XRQA 3E7WA 3ZW7A 1M72A 4IEFB 1H4VB 2RDMA 3JATB 2DVMA 3NYWA 1QQBA 2WV9A 3IEVA