1E7MA

Active site mutant (d177->n) of glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
485
structure length
485
Chain Sequence
VSEIKTLVTFFGGTGDLAKRKLYPSVFNLYKKGYLQKHFAIVGTARQALNDDEFKQLVRDSIKDFTDDQAQAEAFIEHFSYRAHDVTDAASYAVLKEAIEEAADKFDIDGNRIFYMSVAPRFFGTIAKYLKSEGLLADTGYNRLMIEKPFGTSYDTAAELQNDLENAFDDNQLFRINHYLGKEMVQNIAALRFGNPIFDAAWNKDYIKNVQVTLSEVLGVEERAGYYDTAGALLDMIQNHTMQIVGWLAMEKPESFTDKDIRAAKNAAFNALKIYDEAEVNKYFVRAQYGAGDSADFKPYLEELDVPADSKNNTFIAGELQFDLPRWEGVPFYVRSGKRLAAKQTRVDIVFKAGTFNFGSEQEAQEAVLSIIIDPKGAIELKLNAKSVEDAFNTRTIDLGWTVSDEDKKNTPEPYERMIHDTMNGDGSNFADWNGVSIAWKFVDAISAVYTADKAPLETYKSGSMGPEASDKLLAANGDAWVFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title An Examination of the Role of Asp-177 in the His-Asp Catalytic Dyad of Leuconostoc Mesenteroides Glucose 6-Phosphate Dehydrogenase: X-Ray Structure and Ph Dependence of Kinetic Parameters of the D177N Mutant Enzyme
pubmed doi rcsb
source organism Leuconostoc mesenteroides
molecule tags Oxidoreductase
molecule keywords GLUCOSE 6-PHOSPHATE 1-DEHYDROGENASE
total genus 181
structure length 485
sequence length 485
ec nomenclature ec 1.1.1.363: Glucose-6-phosphate dehydrogenase (NAD(P)(+)).
pdb deposition date 2000-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00479 G6PD_N Glucose-6-phosphate dehydrogenase, NAD binding domain
A PF02781 G6PD_C Glucose-6-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1e7mA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1e7mA01
2X1HA 4XR4A 4FN4A 5TJHA 3HJAA 3DO5A 1ARZA 2NADA 1MXHA 3RUFA 3QVWA 4L75A 2WYVA 5AQ1A 3RWBA 2E49A 1ZSYA 4J49A 4MVJF 4CMGA 1HLPA 5CHEA 5L95A 3MCVA 4F6LA 1HLDA 5B12A 5DT9A 2Q2QA 3I23A 5T8KC 3OHSX 3QHAA 3O9ZA 3DC2A 4BS9A 2UUPA 3PWZA 1EVIA 1SAYA 4ALJA 3U5TA 3D4PA 3NKLA 3ONDA 3V8BA 3KSUA 3IP3A 4OQYA 1JWAB 2GNAA 5HA5A 3WGHA 4E2YA 2B5VA 2IRWA 1JKJA 4H15A 3N58A 4YRDA 2HKIA 3O8QB 4XYGA 4UVGA 4HNHA 3AU8A 1YBMA 4NJMB 3DOOA 4J1SA 3H2ZA 1O89A 1N9GA 1SOWA 3H9JA 3UVEA 4CMAA 2BF7A 1PJLA 4MJLA 1RM5A 3IJPA 1ZSNA 3F9IA 2AQKA 3GOHA 2XF8A 1Y81A 3TZQA 2QZ9A 1A9YA 3PQFA 3WNQA 3MJCA 3RBXA 1PQWA 3AFNA 3WDSA 1R4NA 1N7GA 3N7UA 1ML3A 2PZMA 3TSCA 4TWRA 3KLMX 5G0UA 1DB3A 1GYQA 4QSMA 3ETEA 3MJVA 3WJAA 1RM0A 2H5LA 4A10A 1YONA 1MC5A 4PLZA 4O0LA 3WGTA 2EKPA 3OQ1A 2NV6A 4ZRNA 1AUPA 1MA0A 4O63O 4BKRA 3GHHA 5CPFA 4D79A 2Q1SA 4L4RA 1MB4A 3BYZA 1WNTA 4LW8A 4Q3AA 4PLHA 1CERA 1M6HA 3F5QA 1T4DA 2HMSA 2FSVA 3FPCA 3PLRA 4QUKA 2HMUA 5G0VA 2E4AA 2D5CA 1ADBA 3RBZA 5JAMA 1HYEA 2BMAA 4XB1A 3GVPA 4N54A 3W4JA 9LDBA 3H6KA 2G17A 3RQSA 1C1XB 4EBFA 4UUPA 4LK3A 2X5OA 2HRZA 2QRJA 2YHIB 3PDJA 1KEPA 4EGFA 4CUKA 1ISJA 1V8BA 3WICA 2Q46A 3ZW9A 4XCVA 2DBZA 2IEBA 2NSDA 4OHUA 3RI3A 4B4VA 2DQ4A 1PGOA 4IJWA 4XA8A 3NTOA 2I3GA 2CDCA 1Y8QA 4L8VA 2NM0A 4CQLA 3W8DA 1B26A 5JC8A 3FTNA 1BTOA 1U1IA 3AOGA 4HKTA 4QX6A 4PGFA 1PJBA 4QFCA 5BNTA 3UCEA 4J16A 1X7HA 5TRTA 3D3WA 3JQ8B 3P19A 5FF9A 3RVDA 3KTDA 3GNSA 2OBNA 4RV9A 2X86A 1GFSA 3TWOA 3E48A 4CLOA 5TGDA 2Y1GA 3S1LA 3SC6A 4D0SA 4Q3NA 4CLRA 4CMEA 4RPJA 4J1QA 1GR0A 1ZVMA 1V6AA 4YBZA 1XKQA 2WD7A 1PZEA 4RQUA 4GGOA 2X9VA 3JYLA 3OJ0A 2EKQA 2RCYA 2B4QA 5AYVA 1VLLA 4Z9XA 5JYFA 2HRBA 2O48X 4K1LA 5TT1A 3B70A 4PFJA 3EW7A 2DBRA 2AEFA 5AXAA 1ZH8A 1X1TA 3FN4A 5H82A 5DBGA 4CPDA 5FEUA 4JBIA 1P0CA 5CEEA 4YJHA 3INGA 3U4DA 4P38A 2DT5A 3ZWXA 1IHXA 2VUTA 2NTJA 1OAAA 2OFPA 4OKNA 2GN6A 1Q2XA 4XQGA 1K6IA 2DUUA 1VL8A 2ZB7A 3ZU4A 2VYVA 3NT4A 1TT5A 1N1EA 2Y93A 3B6ZA 3PXXA 1ZIDA 1GZ6A 4EJMA 3OH8A 1DC4A 3LF2A 1KETA 1K0UA 4R1TA 3PI7A 4E31A 3GG9A 3LLSA 3KYCB 5JPIA 4NJOA 5COBA 2JAHA 1GUZA 5AVOA 4BNYA 1P1HA 3QVSA 2GASA 1J49A 1UDCA 1IZ0A 1UXGA 4DC0A 4L76A 4CMBA 3RC9A 1H93A 4K26A 4MVJI 5H83A 2WSBA 3L9WA 2O3TA 3FD8A 3QA9A 3GZ4A 3H4VA 3BMOA 5JAQA 5T67A 2AHRA 3CINA 2Q4BA 2Y0EA 3HN2A 5B4TA 4CLDA 1V9LA 4RDIA 5KJCA 4R3WA 2EP7A 3KB6A 4ZQHA 3MOGA 5EN4A 5KJFA 4RPLA 1QLHA 1X13A 5LC1A 4NBVA 2A92A 4A03A 5JYEA 3L4BC 4IGEA 4FFPA 4JCOA 2O3SA 1F0YA 3U49A 3C8MA 2OMEA 1A4IA 2D8AA 1NR7A 3FCOA 5A03A 4KUGA 5DCWA 4BKPA 3ZV5A 3DMTA 3GAFA 4NR0A 3NDRA 4JGBA 4GLOA 3JTMA 5F5LA 5ILGA 1BSVA 1GUFA 1OI7A 3JCZA 4OGWA 4DQVA 2E48A 1LLUA 2VCYA 2EKLA 3LC7O 1JTVA 4J1NA 3K73O 1AE1A 1RKXA 2JKVA 2VQ3A 4CLRB 3VVCA 4EUHA 1KY4A 4R54A 1U8FO 4KMSA 3GEDA 3GPDG 4ROSA 1DIRA 4WLEA 1Z75A 4TVBA 3BTSA 1YDEA 3PPIA 4GX0A 4ONEA 2PD4A 1BW9A 3Q6IA 4TROA 1RM4A 4ZGWA 1BVUA 2DTXA 4Q9NA 5L4NA 3LT2A 3G79A 3AFMA 1TA4A 1K6XA 1PJSA 4YJFA 5AXCA 1H5QA 3IAHA 3F6YA 3STHA 1BDMA 2G5CA 4JLWA 3IJRA 4CL3A 1GTMA 5K9ZA 5CFZA 4PG8A 1G6KA 1KEVA 2C82A 5JYAA 1ZMOA 3H7AA 3R0IA 1EE2A 1C0KA 3LYLA 1PJ2A 4A5OA 4II3A 3NT2A 2Q3EA 2FZWA 1GEEA 1C1DB 4TKLA 5I9MA 2GZ2A 3MJEA 4L73A 4UVIA 4W9NA 2FN7A 3INTA 1EEHA 1EZ4A 4OSPA 5ITVA 5KCZA 2J8ZA 3DOJA 1T4BA 3HN7A 2BHLA 4FQ8A 4I1IA 4CMJA 3ZWCA 5IDXA 4WASA 3BMNB 1W73A 4I5EA 4J0EA 4Y67A 3D1LA 1IB6A 2X5KO 1DC5A 3FWZA 3WG9A 2AEMA 4Z0TA 1PJQA 2O4CA 3ADOA 5JY6A 1T2FA 4W7IA 5JDCA 2JFHA 4BO4A 4H3VA 2YW9A 4XDYA 3FNHA 3IQDB 3ORFA 1E1LA 4W99A 2WE7A 1JVBA 3GGOA 1AN9A 2VRCD 3NT5A 1XIVA 2ZYGA 2OP1A 2NVUB 1HDCA 1JKIA 3O26A 1A7AA 4CR8A 2GZ1A 3H9QA 3EDMA 4P8RA 4U8GA 4WGGA 2HO5A 5F1OA 4DBZA 3EZLA 1WMAA 2C0CA 4E0BA 1I01A 3JQFC 1KVTA 1NFFA 4PLVA 2I3AA 1O94A 4OXKA 5LDGA 2YFHA 2YQ4A 2QG4A 3E03A 4RQTA 4IXTA 1GPJA 4KDEA 5EL0A 5TJ9A 2TMDA 4NK5A 3EUWA 4CM4B 1E3LA 4ZICA 2IZ0A 1ZUD1 4K6FA 2B37A 4S1VA 2FHSA 4BGEA 1QYXA 2XAAA 3FI9A 5BSEA 2ZYAA 3GAZA 4Z9FA 1ISGA 1GV0A 3DBLB 3A28A 4JIGA 3WQRA 2NTNA 2W2LD 2OGUA 3HZZA 3AOEC 4UEKA 4TRJA 4YJFB 3T4XA 4ZHSA 3K96A 3WJ7A 1FXSA 3WXBA 4ALLA 2EJWA 4II2A 3RC2A 4RGBA 5L4LA 4OSOA 1E6WA 4NJMA 1TB4A 1GQ2A 1I3LA 1UXIA 3TFQA 3GY0A 3RFTA 5A5EA 3ZN2A 4IM7A 4CQLB 1PS8A 4JP3A 3JD1A 2WJPA 4HV4A 3F4BA 4CV3A 3FWNA 1DIHA 2Q4EA 3AWDA 1E1KA 1TXGA 1IY8A 5FI5A 9LDTA 3PQEA 3RASA 2HMWA 4FPXA 4Z0PA 3IS3A 2Y1FA 2VN8A 2NQTA 4A0SA 3CIFA 4XQEA 4XZ3A 4PLFA 1GYPA 1N2SA 5L3ZA 3OJEA 2NU6A 1D1SA 2FRDA 4IPTA 4MVJA 1WPQA 3IMFA 2J3JA 2JD0A 3ICPA 4NBTA 1E0DA 4XB2A 3EK2A 4MDHA 2C2YA 4RZHA 1HDZA 2NVUA 1GQQA 5DOZA 1IOLA 3L4SO 1DLJA 2VHZA 3X2EA 3ZHYA 2BGMA 5I8WA 4YJHB 5BQFA 1B8VA 2AXQA 1I0ZA 4WPGA 3ZV6A 3DZKA 3DZIA 3F5SA 2EF1A 4U0KA 2H63A 4FSHA 4M89A 3WGGA 4FB5A 1SBYA 4KDFA 4CM1A 5CPBA 2W98A 1GD1O 3PZBA 3F4LA 1KVQA 1DO8A 5KKCA 1DAOA 2YV3A 1PJ4A 3P5SA 4R16A 4YT8A 4WECA 3ZDFA 3DHYA 1Y8QB 1EFLA 1ZFNA 1HXHA 4YAGA 3UOGA 3AY6A 2ZB4A 4CM6A 5ER9A 2JCYA 3EC7A 5IDQA 4Z9YA 3BMOB 3E18A 2HJRA 1EVZA 2P5YA 3QY9A 1NX6A 2ZTUA 1SB8A 2D0IA 4MVJP 1YBVA 4B7UA 1SB9A 4YAEA 4Y9DA 3R3JA 4CLOB 1QV7A 4BNZA 4KUHA 2VYVD 4KQWA 3PIDA 4IDBA 4MOWA 3JQ9C 3QRWA 4J7CA 4NZ9A 3MWEB 4DLLA 4U6QA 5TC4A 2ZJ0A 5B1YA 2VTEA 4DC1A 1X7GA 1ZMTA 2ZTVA 3WS7A 1GEGA 2CNBA 2Y1OA 3I83A 5DOVA 4ALIA 4PIVA 5F3RA 4L9RA 4BO8A 1BMDA 4W7HA 1NBOA 4GBJA 1IUKA 3UGKA 1H9BA 4RF4A 4A7PA 1L7EA 1PU2A 1PX0A 1V3TA 1X1EA 3WBFA 1Q0HA 3E5MA 4ND4A 4BO1A 5CDYA 3RIHA 2B83A 3IIEA 4M1QA 2I65A 4Z0HO 1XU9A 3KUXA 4MKXA 1WP4A 4B4WA 2CVQA 4PLGA 2HK8A 1I33A 4OAQA 1EQUA 3QLJA 4JXKA 1HZJA 1LBEA 3VPFA 4N18A 5JDIC 4XQCA 2OHXA 4RVGA 2Y05A 5JCJD 3Q9NA 3WGYA 2YDXA 3PGJA 3KYDB 4TRNA 3DBRB 5L7TA 4Q39A 1EDZA 3MOIA 1CQIA 1ZO8A 4QO8A 5DN9A 3JQ9A 3RSHA 4NFHA 1BDBA 3GVIA 3T4EA 2I5PO 3ABIA 1Q0LA 5DULA 3D3EA 4FW8A 4R1NA 1GY8A 1YDWA 2BLLA 4RJTA 2PGDA 4RLHA 5CG2A 1E6EA 4M87A 3L9XA 3EYWA 2VOJA 3V1YA 5IZ4A 2B4TO 2B69A 4D44A 3UAGA 5DF1A 3KOUA 1OZAA 1JA9A 1I2BA 1PGPA 1I24A 5EJ2A 1PGQA 1LRKA 2J6IA 4FOSA 3JQ7B 2Z1NA 2O3RA 3OF2A 3E1KA 3FHLA 3FNGA 1HYGA 4GI2A 4IS2A 1MXFA 2FOIA 4IY1A 1NPYA 1NM5A 4BV8A 4ND1A 1ZEJA 1P1JA 1XR3A 5HS4A 2IXAA 2O3JA 3JYQA 4OM8A 1DRUA 1E5QA 4D3DA 4WLOA 3WSVA 4D7AA 1FF9A 1S7CA 1I10A 2BD0A 4IIUA 3RKRA 3WYCA 1U9JA 3F1KA 5KVCA 1L1FA 1Z7EA 1NQ5A 4GX5A 3WGOA 1I2CA 4S3MA 4Y98A 4E5NA 5DZSA 1QYVA 3DZBA 5G4KB 4UVHA 5GY7A 3KRTA 4HY3A 3DXFA 4FFRA 1K6JA 2Y0CA 4CM5A 2VWPA 1R66A 4I5DA 1LTHR 1QYCA 1ZK2A 4TSKA 3NYWA 3RUCA 2DBQA 3GNQA 3TN7A 1I3MA 5JMPA 5U9CA 3BHJA 4LCEA 5JYDA 4BUCA 2C7GA 2CUKA 3ZU5A 1MX3A 1PQPA 1X0VA 2W2KA 3GUCA 5TLSA 3TZ6A 3OEYA 1GZ3A 3NJ4A 2JAPA 3X2FA 3CZRA 2WMDA 1LQTA 2FMUA 4DMMA 1U28A 4RF3A 5F1KA 3KM0A 2P68A 3TJRA 3WQSB 1C14A 5IJZA 3GN1A 2X6TA 3AK4A 5FI3A 1LA2A 3OMLA 2P5UA 4WJZA 3VH3A 5I7SA 2HK7A 2V65A 2NQ8A 2X5JO 2C54A 3WQQA 1PS0A 2NLOA 2BRUA 3ETDA 2GUGA 3R3SA 5BSHA 2CVZA 2ZB8A 1VC2A 3AW9A 4R5HA 4WUVA 2F00A 4XR9A 4D3FA 2V6MA 4NMHA 3IL2A 1ULUA 4TZTA 4DL9A 4AJ1A 1P45A 1E1NA 3UKOA 4IQ0A 1ORRA 1SO8A 3VDRA 1HL3A 2IXBA 1LSOA 1W8DA 2EGHA 2FPIA 5BNIA 3Q9UA 3JQ6A 4MP8A 4BNGA 2G76A 3ZCXA 5B4UA 3ZNNA 1T26A 1E92A 1MG5A 4BNKA 3H8VA 1LDEA 1SEVA 1R4MA 3QE3A 2X0IA 5KVQA 2Z1MA 3JD3A 2Q1UA 5IZCC 1NVGA 2VWHA 2ZIZA 3UXYA 1UZMA 2C29D 2OBYA 2X7HA 5MGBA 2WEKA 2VZ9A 4AJ4A 2X23A 2HDHA 3CEAA 3QVTA 2AG8A 5L7WA 1RPNA 2GCGA 4LVUA 4FCCA 2HK9A 3FBGA 3IP1A 1N7HA 5CP8A 1D1TA 5JS6A 1E1MA 5GZ3A 2X58A 4KWIA 4KWHA 4DMLA 4GSKA 3FBTA 2P9GA 3OSUA 3ETGA 3H9EO 3WIEA 1Y7TA 4U5QA 3PHLA 1D7OA 2P4QA 4RCVA 5G0WA 3ZV4A 1LRLA 4ND3A 3OQ6A 1LDYA 5TS3A 3DWFA 2RHCA 4WLUA 4DIFA 3DTTA 4YYZA 2P2SA 3NTQA 4R1UA 4CR7A 5EPOA 4CLHA 4UREA 4GQAA 3ZNOA 4AJEA 4A73A 1I3NA 1I30A 2C2XA 3DBLA 3TDKA 5DCYA 3MJ4A 2YYYA 1JW9B 4P4NA 4DXHA 1ADCA 4F3YA 1D8AA 2XOXA 1MLDA 5JW6A 2OZPA 2XXJA 4DYVA 5KJ6A 3CMMA 5T8KA 4FGSA 3S2EA 1HDGO 2WM3A 1GUYA 2ZTMA 2BGLA 1KEUA 5I9LA 4WEOA 3BIOA 3DAPA 2WTBA 1SNYA 1ZK1A 4QTZA 3RUIA 4NHEA 2V7PA 3DZJA 4D46A 1U3VA 3HB4X 4NH4A 3U3XA 3JD0A 4F6CA 3GEMA 2C5EA 1O9BA 4WLFA 3ZWOA 1E3WA 2HCTA 1U3WA 4L4XA 2VNAA 2YZ7A 3B1JA 3AJRA 1HZZA 1UAYA 4YB8A 5C7LO 1U2GA 3GDOA 1I32A 1FDSA 4KZPA 5DDIP 1R37A 2DPHA 4JQCA 4EEZA 3KYBA 4ILKA 3HSKA 2UDPA 1P1IA 1NAIA 1P0FA 2PH5A 2VTDA 2V6BA 4CL8A 4QECA 3RD5A 3M2TA 1XU7A 2PA3A 3D4OA 4HNGA 3W8EA 1I8TA 1K5HA 1NPTO 5G4LA 2D3TA 4CUJA 1G1AA 4OIMA 1O95A 4A2CA 4RVUA 1PZFA 2UAGA 5C5IA 1XWFA 1XSEA 2C7VA 2GGSA 3AUTA 4GL4A 5THQA 2Q99A 4DA9A 4AJKA 4L0QA 1U5AA 4YXFA 4RORA 4NU6A 2Z5LA 4DUPA 4FR5A 2O23A 3HDHA 3UW3A 4WLNA 4BNVA 1XQ1A 3V2HA 5KIAA 1E7RA 2ZCVA 3D3WB 3JQ8A 3VKVA 4ALKA 1KVRA 4FFNA 4ZU3A 2J5KA 2VT3A 1OBFO 4XYBA 4AJJA 4YWJA 1PIWA 4MKRA 1P77A 3ENKA 4JJGA 4E2WA 5IZCA 1JDJA 3ULKA 3TZKA 4UUMA 1IPFA 5K6AC 3EMKA 1WDKA 3HFSA 4CMIB 2ZB3A 1OC2A 2JCXA 4RZIA 4Z3DA 3VH4A 2OORA 1J6UA 3K2BA 4XYLA 1MGOA 2EXXA 3HDQA 5A1TA 4PRLA 3V1UA 4BB5A 4FJ1A 3O03A 4EI2A 1HDYA 1YQXA 3DONA 3INRA 4DIOA 2PZJA 3ZZNA 4B79A 3HQ4O 5JCJA 2I99A 1YJ8A 1YL6A 5G2OA 4F46A 3ADPA 3H5NA 1SOVA 1WZIA 1H6AA 4YDRA 3HADA 1CETA 1C3VA 1KEWA 2CMDA 3WTCA 1ZW1A 2R6JA 3JV7A 2BFMA 3H3JA 1Z74A 1YL5A 1N5DA 3H9GA 1NXQA 3PHJA 5AXBA 4GMFA 1UDBA 4EW6A 2VUSA 4OXNA 1YJQA 5JDCC 3GGPA 3PZRA 1HSZA 3OIFA 5ICSA 4YTEA 1E7QA 1MV8A 1E3WB 2JHGA 1X14A 4FC7A 4PZDA 1EFKA 4ESOA 1MUUA 3DL2A 3QW2A 1WWKA 5A9SA 3LT0A 4XYMA 1UXHA 2AA3A 3PYMA 3GMSA 4IDCA 1A27A 4O5OA 4UVDA 5G0TA 1ONNA 1R16A 4QO7A 2GN4A 2P4HX 1C0IA 3GGGA 3K8ZA 5ENDA 5T57A 5HBRA 3WOHA 1PQUA 2VYND 3G1UA 2ZJ1A 5G0SA 1YKFA 4E21A 1NYTA 4RVSA 2H9IA 3CSDA 1TVEA 4XD2A 3C7DB 5I9NA 3ROKA 1JKFA 3QVOA 4DGSA 4Y6PA 4JX8A 2XPCA 2RAFA 3WGZA 3HDJA 5U1PA 5KVSA 3PJFA 1IYZA 2FY8A 5I7EA 4ZJUA 4O59O 3LF1A 2GSDA 1Q7GA 4LGVA 1F14A 3VDQA 4E13A 3EAGA 5IDYA 3NRCA 3ENNA 3RJ9A 3WR5A 3MJSA 1NHWA 3VTZA 1VRWA 2DPGA 1VL6A 4LRTB 1DXYA 3M1LA 3AY7A 1GCOA 3RROA 1M6WA 4QXMA 2NNLD 2WWRA 3CXRA 3QWHA 4IQGA 1AHIA 4BO5A 4NNJA 1N92A 1WW8A 2B35A 5ICMA 1XDWA 3LK7A 1B2LA 1NR1A 1YRLA 2J5RA 3L07A 1A71A 3PJGA 4LRSB 5CDTA 3MEQA 1O6ZA 1QMGA 3GDFA 4XRGA 1BWSA 5BNFA 1ZK3A 2HQ1A 3JD4A 1W6UA 4IMRA 3W6ZA 1I2ZA 2A94A 1E7WA 4BO6A 1BXZA 4K9DA 4N5MA 3EZYA 1R4MB 2IE0A 5IG2A 3NGXA 3TPCA 1F17A 5EQDA 3EY4A 1OC4A 1E5LA 3JQBC 5ILOA 4H7PA 5IDWA 1PWXA 1G0NA 2UVDA 1ZEMA 2SCUA 1E7MA 1EVYA 4ITUA 5A9RA 2NWQA 1YE3A 3S8MA 3LZ6A 3HNPA 4AJIA 3PYLA 5U4QA 1R0LA 5K0ZA 4N5NA 1A4UA 1M67A 5F5NA 4GWKA 1WLYA 1KYQA 3Q1LA 4RLSA 1VL0A 2E37A 5HS6A 4PG6A 2QW8A 2JD2A 4CR6A 1DRVA 3NAQA 3OFSA 4W82A 1WAMA 3K31A 1ISIA 3JYNA 2ILTA 5A3JA 5BR7A 1CDOA 1DFIA 2BI8A 2D1YA 2CF5A 3W4IA 4AJLA 3D5QA 1R12A 4TZKA 3DB2A 2R2GA 4D3SA 2YV1A 3IC5A 4PG7A 4PCVA 2VWQA 1LC3A 3W4KA 2YQ5A 1AXEA 2CDBA 4PZEA 1PR9A 3U4HA 2B4RO 2NVBA 2B0JA 1B7GO 1B8PA 2YHIA 5L7YA 1E6UA 1LLDA 3OA2A 1P33A 4J9UE 3GFGA 5CG1A 4U7WA 3C1OA 3WFJA 1EUZA 5EESA 3ONFA 1U8XX 4XGKA 4D45A 1Y1PA 4CV1A 5CAEA 1EUCA 1KS9A 4I5GA 2GLXA 3CUKA 1EK5A 3ANLA 3VHRA 3PRJA 1EK6A 1ENPA 2POQX 2FSSA 4OOFA 1YS4A 4NFSA 2VOEA 4BKOA 1LNQA 1P74A 1DFHA 4DQUA 4QQRA 3AUSA 2VT2A 4J9VA 5ES3A 4YT5A 3DZHA 3ZU2A 5JMWA 5L4SA 2OL4A 3WBBA 2HMVA 4JJIA 4B3IA 2G0TA 3MTGA 1NP3A 4WEQA 3S2GA 2Y99A 2O4UX 5CEFA 2QYSA 2JJYA 1DIBA 1ADFA 2DKNA 2I6TA 3AUUA 3GUYA 1LRJA 4GMGA 1JWBB 1MFPA 2D5AA 4JJFA 3U4CA 4ZVVA 4E5PA 2WD8A 1E3SA 4WNIA 3OIGA 1HE3A 3SX2A 2CSUA 4QFDA 4E33A 3GPIA 4CM8A 1VSUA 1T24A 4ZQGA 3UN1A 2NU8A 1ENOA 3C1TA 3JQFA 4W4TA 4DTIA 2C5AA 4DLAA 4WK6A 1U5CA 3E82A 2IZZA 4BO9A 4CM3A 5C7IO 1T2DA 2CDAA 1PEDA 2IYPA 2QHXA 1TT5B 2FR0A 2O50A 5THKA 4OL9A 3F1LA 3U0BA 2VHYA 4YRAA 1HDXA 2Q1TA 1QYWA 3VOSA 1QORA 4EUFA 2VHWA 1Y8RA 2VRBA 4RF5A 3QIVA 4CLXA 3UH1A 2BFPA 1E3JA 3KEOA 4J2HA 3WTBA 2Q45A 4YR9A 1PJTA 3BMQA 4LSMA 3PWKA 4Y6RA 1ENYA 2IODA 3I9MA 4U0JA 4B4OA 5G4KA 4TVOA 4O6VA 3Q3CA 1Q7BA 2DTDA 3BHIA 3P2OA 4XX0A 3JYOA 1DIAA 3WWYA 1K89A 1LSJA 4ZRMA 2X9GA 1G0OA 3ROQA 2RHRA 4BB6A 1GYRA 1NTOA 1U7HA 2QRLA 3L6DA 1FMCA 4Q3CA 4YA6A 3IDSA 1CIVA 5ITWA 2Y67A 1DRWA 2J3HA 4G5HA 4HFMA 5ER6A 2AQIA 1A72A 3ICCA 3LT4A 3B20A 3DAFA 4E2XA 3H3FA 4UEOA 2RBEA 1HYHA 1GU7A 1DC6A 3KXDA 4MPDA 4YQYA 4BV9A 3FPLA 3OJFA 1ZK0A 1DFGA 5TNXA 2PK3A 4Q3BA 4A26A 3A14A 4AJHA 5A9TA 4LN1A 3WWZA 1LU9A 3VPGA 1JAXA 3V2UA 4IUYA 2AMFA 1ZKMA 1T25A 3DQPA 1PSDA 1NQAO 3FR7A 4ZA2A 4XDZA 5AXDA 3U62A 1QG6A 2GN9A 2HAEA 5B4VA 4RVFA 3JSAA 5JO0A 4R4JA 1MP0A 3DMTC 4I9HA 4PZCA 4GKVA 2VUUA 4DRYA 3OIDA 4OMUA 1VPDA 5T6BA 1U4SA 5DCUA 3SVTA 4R51A 4G81A 1M75A 4AG3A 1E77A 4EEXA 1C0LA 4CUZA 2ZQZA 1ISMA 1XG5A 2AQHA 1DJQA 1I5RA 1Z73A 3GZNA 3HB5X 4IQ8A 4NIMA 4RPKA 4B7CA 5JAIA 3WYBA 2A9FA 1C1DA 1BXKA 1EBUA 1Y5MA 4OO3A 1LXCA 4P4GA 3QQPA 4WCFA 2NUAA 1HRDA 5L45A 1LLQA 1Z82A 1I3KA 2LDXA 1XEAA 4JP2A 5JO9A 3TRIA 1X15A 3HG7A 4F45A 4YAIA 2F1KA 4MVJM 4XEHA 4M54A 3I9LA 5B37A 1J5PA 4EZBA 1CWUA 2VHVA 4IMPA 1Z45A 4HFNA 4YJGB 3D64A 1DC3A 1T1SA 1T2CA 3BMQB 1D4FA 4AICA 2OP0A 1QRRA 3TFOA 3TOZA 1UR5A 1HSOA 1H2HA 5M6DA 4PLYA 1EBFA 1ISHA 3BAZA 3KBOA 2D4AA 2O3QA 2RH8A 3BMCA 4FGWA 1U3TA 3ZNQA 3HDYA 2IDZA 2E82A 2PGLA 4RVHA 2ZQYA 4INAA 2Q22A 4IJUA 1C1XA 3BTUA 1PTJA 3WLEA 1I36A 3FR8A 3E9NA 2GERA 3SEFA 1ZK4A 4DPKA 4HWKA 5IN5A 4ZQBA 2ZKLA 3JQ7A 2DU8A 1T2AA 5JY1A 5FWNA 1DJNA 3KLPX 3DBHB 5AOVA 4R1SA 4IDFA 7ADHA 2AG5A 4Z3KA 1QR6A 2D59A 3HFGA 3B1KA 3GA0A 3ROPA 1XYGA 1Q0QA 4MVJG 2CFCA 5A02A 3MJTA 3G0OA 2Z95A 3ANMA 2DC1A 4XJTA 4WKGA 2X0JA 2NVWA 4FFOA 3S2IA 3JQAA 1RYEA 3VC7A 3KYDA 1NQTA 3GFBA 1M76A 3FF4A 5FFFA 3SC4A 2Q2WA 1PL8A 2ZATA 4ZQEA 1YOVA 3A4VA 5BSFA 3ZWMA 4RDHA 1YXMA 1V3VA 1UXKA 3ZU3A 3TQHA 3I6IA 4M86A 4HUJA 4BOYA 4UUNA 4IJKA 4E2ZA 3E8XA 1C0PA 5GZ6A 3C85A 5IN4A 3KVOA 1BHSA 1FJHA 4EITA 3C1AA 3GZNB 3OBBA 2Q1WA 1NVMB 1DPGA 4YQZA 4B3HA 3U09A 4U6SA 1UDAA 3SJ7A 4HFJA 3H2SA 3KETA 3QWBA 2EW8A 5EQFA 3WGQA 5A3VA 4BKUA 3GVXA 3G3EA 4RF2A 4W6ZA 4GAEA 4FBGA 3VKUA 3VVBA 3MZ0A 4BMNA 2PGJA 2QYTA 2ZTLA 4BNTA 3WMXA 4J91A 4BMVA 2X9NA 3DTYA 3GH3A 4IDDA 4OQZA 3ROMA 2C07A 3QWAA 4GWGA 2WDZA 1O5IA 3GT0A 5H81A 5IF3A 4DVJA 2QZZA 4J90A 4BQPA 4FD3A 4DPMA 1DHRA 5F1PA 3RU9A 3RUAA 4WOJA 3O8QA 1OFGA 1K3TA 1P3DA 4HP8A 4TRMA 1YO6A 2PLAA 2V6FA 1N9GB 3COSA 2JD1A 3NX4A 5HTOA 2JFGA 2PKQP 5JAZA 4IDGA 5DP2A 3TNLA 1T2EA 5I7VA 1YB5A 2FP4A 4C7JA 2BGKA 4BO2A 4B4UA 2X22A 1IHYA 2A4KA 1HE4A 2X8LA 2PH3A 1CF2O 4C7KA 1H94A 5JCXA 3OEWA 5IXSA 4XGNA 2HMTA 4CQMA 3BMNA 3UCXA 5A04A 1BXGB 4CODB 2JHFA 1NQOA 1GADO 2R00A 4XQ9A 4J3FA 4Y8VA 5KKAA 1XA0A 3GRKA 2PR2A 3QVXA 4QT0A 1DLIA 5EIOA 2E6UX 3E6AA 2O3UA 1XCBA 3K2EA 5JFOA 1HT0A 3B1FA 3KHUA 1TEHA 2I76A 4GLLA 4FC6A 4YEDA 4BNUA 1GDHA 4DREA 3T7CA 4QEDA 3LC1O 4ALMA 3PK0A 4NBRA 3AM4A 1H9AA 2PKQO 4MINA 4B3JA 1KC3A 4HX5A 3EGOA 1FDUA 3DHEA 1PZGA 2RIRA 4MP6A 4LVCA 4HADA 2QIOA 1Q7CA 4GVXA 3HE3A 1L7DA 4NFYA 4PLWA 4UEJA 1N8KA 4FJ0A 1A5ZA 4M49A 4OOEA 1MFZA 1D3AA 3I6QA 5I8ZA 3WX0A 1UP4A 3QWIA 4MVJH 4CLEA 5C3MA 7MDHA 1UH5A 5JBIA 2V6GA 2PTGA 4BGUA 1ZJZA 1AHHA 2ZCUA 4L74A 4OKIA 5T64A 4BNLA 5JNLA 1BW9B 4AFNA 3ZWBA 4Z6KA 5KNLA 3H5AA 4YCAA 2W2LA 1ZSVA 1ADGA 2H6EA 2VWGA 3L77A 1YQGA 1TI7A 3I4FA 4FOOA 2AQ8A 1B15A 2JFFA 5TSDA 3PTZA 5GZ1A 3HUDA 1UZLA 4BNWA 1Y6JA 1QLJA 1WXDA 3P2YA 1KOLA 1PR3A 4GGPA 5TQVA 4XJSA 3UFXA 2O2YA 2WYWA 4BO0A 3DBRA 4R41A 3OJLA 1LLCA 4ZN6A 2YDYA 3SJUA 6ADHA 2HU2A 3A1NA 4R5MA 4J6FA 3H65A 1LEHA 4UAGA 4N7RA 3ZWNA 3PLNA 3S2FA 4BIIA 2DLDA 3GK3A 1NWHA 1FK8A 2OXIA 4BGIA 1IL0A 1GV1A 5TIIA 4B8ZA 1KVUA 2EERA 1Y9AA 4AJNA 2GR9A 3CMCO 4J0FA 4LMRA 4BHTA 1R6DA 1LDGA 4WE3A 4J43A 1SC6A 3NJ8A 5KWEA 3GN2A 1P1KA 3F3SA 2IYOA 1H6DA 4E3ZA 2FPGA 1ONOA 4BKQA 3RC1A 1XGKA 1CQJA 2JL1A 3T7EA 3RJ5A 5EINA 4FS3A 3FRJA 1EE9A 4XWYA 4DYDA 1LUAA 2QX7A 1H6CA 4YJGA 2YUTA 3LLVA 3PP8A 2DTEA 4JBHA 3ZHBA 3AOEA 3Q0EA 1P31A 3EVTA 5KJ1A 1KERA 3PFFA 2Y1EA 1WDMA 3OQBA 4PLPA 1J0XO 4R9SA 4OH1A 4FIZA 1AGNA 5DBFA 1Z6ZA 1BVRA 4IIVA 5TT0A 8ADHA 3I9NA 1F8FA 3UF0A 4JN6B 3K30A 3D0OA 4CM4A 1EVJA 3K6JA 2PZLA 2Q49A 3QP9A 4IBOA 1DSSG 2YJZA 4EYEA 4EJ0A 3IOYA 4CMKA 1ONPA 5JC1A 1QYDA 3FNFA 1P44A 1F8GA 4EDFA 2Q2VA 4URFA 1V35A 4J7UA 1JVSA 3VPXA 4YACA 4P4LA 1DHTA 3WB9A 5DNAA 5COQA 4BVAA 1P1FA 1HE5A 5CDUA 4PRKA 1EUDA 1X7DA 3M6IA 1N1GA 1HETA 2Y0DA 1B0AA 3AUAA 1KC1A 1TLTA 1WMBA 4YT2A 4I9NA 1PL7A 4EUEA 3ANNA 4ID9A 4E12A 2PZKA 4YAKA 4GH5A 4NK4A 2B5WA 1WZEA 2EWMA 3SLGA 1QSGA 4YRBA 5TX7A 3IKTA 4K6CA 4WCFB 5CDSA 1AXGA 1VM6A 3LU1A 5T5QA 2O7QA 4GX2A 4E5KA 1SPXA 1FDVA 2CD9A 4PVCA 3VZPA 3C7CB 3KYCA 1BGVA 4IZIA 1NHGA 3FNEA 2BI7A 3UHAA 2HLPA 3I5MA 3GC6A 4IS3A 3ZNPA 1DBVO 2EJVA 4WNCA 2PY6A 2BH9A 1LQUA 1Y5RA 3C24A 3GLQA 4J1TA 2GPTA 1YGYA 4L4SA 4MVJE 1R0SA 2YV2A 3WMWA 2PFGA 4NQZA 4ND5A 1RJWA 1JQBA 5JSFA 5GMOA 2EG9A 4HXYA 2X0NA 2C20A 2GZ3A 1R15A 4LISA 1VJ1A 3A06A 3BMCB 3GF4A 3RC7A 2Y68A 5A4DA 1E3EA 1B14A 2ZYDA 3ZWAA 3N74A 2ZK7A 2FR1A 3QJ5A 2GYYA 1J4AA 1PGJA 3BTVA 4DQXA 2FR8A 3DAGA 2WE8A 1U2DA 3FTPA 2W2KB 4IDEA 3I1JA 5KVVA 4IINA 3JYPA 2QRKA 3V1TC 3BA1A 4LSWA 3AM3A 4RL6A 2OOSA 1GL3A 3NDIA 4Q3EA 1LDNA 3OM9A 3SLKA 3VZRA 2UUOA 4LMPA 3E9QA 4IGFA 1T1RA 2AEJA 3WNVA 3ZHXA 5KTKA 1WVGA 4CJXA 4FFMA 2C59A 1XHLA 2PD6A 2IZ1A 3QSGA 3EHEA 3JQAB 4YAJA 4GPD1 1XELA 1EQ2A 3M2PA 4ND2A 3RBVA 1B3BA 3M1AA 4AJOA 2CZCA 4CM7A 2EEZA 3MTJA 3AU9A 4CM9A 5HRUA 3DEYX 3GDGA 4CQMB 3WFIA 3PJDA 1BXGA 4E32A 1Q1NA 2OO5A 1JU9A 3MWDB 3K5PA 5ENVA 3LC2O 4WLVA 5FYDA 2GO1A 3ZH2A 1YH3A 1LDMA 4BGVA 4FFLA 3VZQA 4NI5A 1ZXLA 8LDHA 1NVTA 1PJCA 3LT1A 1GZ4A 2X4GA 4YJDA 4NBUA 5ADHA 3HWRA 4KP7A 3ZWYA 1VJ0A 2EP5A 3OA0A 2Y66A 1ULSA 3NEPX 4B8WA 5JLAA 4B7XA 3RKUA 3GEGA 3OP4A 4OJNA 2P9EA 3OECA 5F21A 4D42A 2DBVO 4JBGA 2WD7B 5LDHA 3F46A 3L0DA 3ZI0A 1HE2A 1RWBA 3KSDO 3JQBA 5BSGA 2DVMA 4YT4A 4R68A 3BTOA 3RFXA 3GR6A 2RH4A 1SCUA 1ZNQO 1SEPA 4NPCA 4D41A 4KTVE 4TMFA 4GSLA 4MIYA 2CF6A 2EW2A 4UVEA 4GKBA 1NWCA 2JCVA 2I66A 3JQGA 3ZHZA 3I3OA 4DBVO 4E30A 1U4OA 3GNTA 4R9RA 4PG5A 2VHXA 3Q2KA 2I67A 2R00C 4GVLA 3ASVA 1EDOA 4IZHA 4WCDA 4BMSA 3WLFA 4CV2A 2P9CA 3L6EA 4HFRA 4WCFC 3I9JA 4MKZA 2A35A 3I9OA 3OJOA 1TT7A 4UULA 1LSUA 1DAPA 5EERA 1VI2A 2HSDA 3WSWA 4AVYA 3VH1A 5MDHA 1DOHA 3CE6A 3GHYA 1DIGA 1NASA 1OOEA 4O1MA 4OYRA 3W6UA 5T73A 3VPSA 1XQ6A 3AI2A 3GG2A 4PN3A 1HTBA 2X0RA 3LSYA 4RO0A 3TZHA 5COAA 1M2WA 5L9AA 3PFWO 2VRCA 2VZ8A 4JROA 3ZWPA 3R1IA 2GF2A 1W0CA 4GX1A 1LI4A 5IFLA 4XYEA 3F47A 4CV0A 1R4NB 3PHIA 1GCUA 1UP7A 1H6BA 2DFVA 1R0KA 5KJEA 1O8CA 4BNHA 4PLCA 3VPHA 3E5RA 2ET6A 1ZJYA 4BL5A 1VKNA 2VYNA 3KV3O 1B16A 3G17A 3G1TA 4FDAA 3HHPA 4J4TA 5A5FA 1HKUA 3H5RA 1YB1A 3AY3A 3ST7A 4TQGA 1F12A 4NDNE 5TF4A 3DZGA 4TRRA 4J4BA 4NG5A 3ZW8A 4XGIA 1V0JA 2EHDA 3UUWA 2XXBA 3O38A 2CVOA 4CM9D 4I08A 4IXWA 4OXYA 1HWYA 3VTFA 1HDRA 4CMCA 3K9QO 4BO3A 2DFDA 5DBIA 1FDTA 1KIFA 4BQRA 1YOVB 1U7TA 1CYDA 3RAJA 4A27A 1DEHA 2BFAA 1PZHA 2IEDA 1M66A 4MP3A 3DOCA 3NUGA 3BXXA 3V2GA 1PGNA 2O7SA 1FDWA 1PS9A 3PHHA 3WGIA 1UXJA 3GVHA 5I7FA 3CTMA 3VZSA 1K2WA 5L51A 3W1VA 4YVFA 3Q11A 1UUFA 3JQGB 4KQXA 3CH6A 1DDOA 4KOAA 1NPDA 1PWZA 2NU9A 3PGXA 4PVDA 3ONEA 4FJ2A 4TKMA 1YBAA 1X0XA 5L53A 4BNMA 2J5QA 4KUEA 1JN0A 3BZUA 4ZD6A 1B8UA 3W8FA 4R01A 3RUHA 1SMKA 1YL7A 3CPSA 2DM6A 3SBOA 3IUSA 1HF3A 3QWFA 3UICA 1YVEI 3DMYA 4UUOA 4MVJD 1LJ8A 2G1UA 3KZVA 3WYEA 4BNXA 4MIEA 4XRRA 3BHMA 3LVFO 1ENZA 3GVCA 2GD1O 4PG4A 4C4OA 3U9LA 4M55A 4DPLA 1VSVA 3ZGYA 4AJ2A 4BNNA 2DUWA 5JDIA 5DP1A 2D2IA 1O0SA 2EGGA 3PJEA 3S55A 2NACA 4E5YA 3PDUA 4J7XA 4I5FA 1EMDA 1NNUA 3D4NA 1YQDA 3DHNA 4I8XA 2VNSA 5A9SB 5JXWA 5A06A 2PWZA 4D0RA 1B3RA 3LDHA 5BT9A 2EIHA 2YFQA 1MC4A 2QQ5A 3AI1A 1E3IA 4RPHA 1UAGA 1Y9EA 1KVSA 3PWSA 1ISFA 1H0KA 3RUDA 4EJ6A 1JLLA 2AE1A 1YWGO 3DBVO 3KO8A 1ID1A 2EV9A 3IUPA 2Y1CA 2P91A 5C37A 5A05A 3PIIA 3ZWVA 1GPDG 1MG0A 5J9GA 1ZBQA 5HM8A 4I9UA 4DLBA 4W9NC 3V5NA 4J4HA 3GMDA 1LC0A 3TOXA 4E6PA 3WIDA 4WOKA 3DFZA 4CMIA 1QV6A 3JQDA 2I9PA 3DR3A 3GQVA 4IDAA 4P22A 4K28A 4M8SA 4Q3DA 2UYYA 5JE8A 3DFUA 3ITDA 2B36A 1P1RA 2W4QA 3TL3A 5L40A 3CKYA 1OMOA 3GRPA 1GAEO 2H1SA 3ZWWA 2Q50A 4DIBA 4XKJA 2PNFA 4KTTE 3D7LA 3LQFA 1UZNA 3D5TA 4MO2A 3VH2A 4MIOA 3EVNA 3PVZA 1IE3A 3I52A 1PL6A 2NTVA 3E9MA 4E5MA 3VAZA 2HJSA 1KY5A 1LSSA 1E7SA 2YHUA 5LCXA 1RM3A 5HWSA 2J3KA 2PKRA 4YPOA 1KBZA 1ZXBA 3PHGA 4ZQFA 1P9LA 3NTRA 3TZCA 1A7KA 2GDZA 2GN8A 3RU7A 1CEQA 3NDJA 5C7OO 3PQDA 4AJPA 3TF5A 2BKAA 3DBHA 4G2NA 4RVDA 2FPPA 3TL2A 3PEFA 2PD3A 3AM5A 1ZZEA 4CMHA 3A9WA 4LCJA 1UP6A 5IAAA 2PV7A 3KSZO 4CMEC 2G82A 1QXSA 3I4CA 1CRWG 3UCFA 3FSRA 5CDGA 5J23A 4ALNA 3ZV3A 3QV1A 3DDNA 3CZMA 1QP8A 3IKVA 1BRMA 1LDBA 1VKOA 4R69A 1IZ9A 1H2BA 1A9ZA 5KOIA 2W90A 4N5LA 3RFVA 3ON5A 1NFRA 2OUIA 2Y1DA 3O4RA 3RUEA 5K6AA 4CM8B 4AL4A 3L6OO 4NBWA 3ASUA 1V3UA 3ITKA 3KEQA 3JD2A 1NAHA 4Y6SA 1Z7BA 2AE2A 4IJVA 1JAYA 3JQCA 2LDBA 3H9UA 3R6DA 3JQAD 4D43A 1NFQA 4H16A 2VZ0A 1RYDA 2UV8A 4BNJA 3I9KA 5CEJA 1PJ3A 2BELA 2YY7A 4HBGA 1VJTA 4XIYA 1LX6A 4JK3A 3U4IA 2J3IA 1Y8RB 4CQMD 3C7AA 1SZJG 6LDHA 1W4ZA 1HEUA 1ZCJA 3C3XA 1YB4A 4E4YA 3NGLA 4J2OA 2CY0A 2HUNA 4PLTA 1QKIA 4BO7A 2W8ZA 2WYUA 4DWVA 5IXYA 3AI3A 1VE9A 3PYXA 3K92A 2O2SA 3NV9A 1WDLA 3SXPA 2NU7A 4R3NA 1IULA 3P7MA 1IPEA 3G49A 3JQEA 4XIJA 2TMGA 1BG6A 1CJCA 1XLTA 3OICA 2BFOA 4RPGA 1HDOA 3OETA 4G65A 2AW5A 5EMHA 1S6YA 3Q2IA 4BNFA 4NU5A 2FWMX 2DAPA 1U3UA 2GRAA 1F06A 1GQYA 4X54A 1E7YA 3L4BA 4BNIA 1UJMA 3RCBA 3DZFA 2FZEA 4JNKA
chains in the Genus database with same CATH superfamily
1KQPA 3DVRX 1QVAA 3IT0A 3K9GA 3DO5A 1U0RA 1X80B 4YUZA 2IEGA 5J2UF 1MXHA 3KC2A 4AMVA 5F77A 4CG0A 1UPTA 1ZSYA 5AJZA 4CMGA 4M60A 2HIAA 3ADKA 5K3CA 3NFRA 4WJLA 2P0YA 5I3ZA 1XAIA 2IPMA 2NW6A 3C6KA 1Y80A 2WQ6A 1Q44A 2Q2QA 1AG9A 1JJBA 2FN9A 5I01A 4KRFA 4INJA 4U6NA 3SM3A 3OHSX 2D74A 3CZQA 3O9ZA 3DC2A 1CR4A 2OE2A 2UUPA 4H7HA 2P9TA 1MOPA 4ALJA 4C5BA 1TQHA 1E3MA 2C5SA 3KSUA 3IP3A 2MINB 5ALLA 2GNAA 1W36D 1Q57A 1MT3A 3IWDB 3N58A 5L3RA 4BV2A 2QGNA 4YRDA 1DQPA 4NOMA 3SHWA 3N59A 1W47A 2J7PD 1OBHA 4LDQA 3DOOA 4OGGA 4H60A 5F9FA 1FBTA 2CJXA 4ZDWA 2D2VA 1JLHA 1SOWA 4I6EA 4DDUA 4D8YA 1QIJA 4LZZA 4RSRA 2A0WA 1L4FA 3B8EA 4CMAA 2BF7A 4UU8A 3VMMA 1F2TA 3IJPA 2RBKA 3LECA 1ZSNA 5AKXA 3RIMA 2XF8A 1Y81A 3BICA 5GQSA 4N3CA 1A9YA 1ZD3A 3K2QA 4FT4A 3TE7A 1T9ZA 4FBMA 1CCWA 1EM8A 3OKFA 2ERCA 2GVNA 4ANFA 4CYMA 2JDID 3EEYA 4TTQA 4DARA 3AFNA 1LS1A 1Q6ZA 2ODPA 5TB5A 5K0EA 2VP5A 5BXYA 1Y6GA 2R1TB 4ZIRB 1R8JA 3U7FB 2OAEA 1IQUA 1T5TA 1WXFA 1KGDA 1CRPA 3A70A 4HXEB 4FT2A 2X4DA 3P9CA 1KBQA 3ZDQA 1G6Q1 3ETEA 3M3HA 1T91A 3KLOA 2CFRA 1BGXT 1FL9A 1WS6A 4EHFA 2IIBA 2AB0A 1CKEA 3SIXA 3ENWA 3OQ1A 1O08A 2HFJA 5BQ5A 1ZLYA 4DV5B 3P27A 1M2FA 3L7BA 4MIKA 4O63O 5F76A 3ICQB 3UC9A 1GGJA 1TMYA 3CLUD 3FA2A 3GHHA 1JG7A 4G0XA 4BKRA 4C01A 2ATIA 2GPBA 4URUR 1WNTA 4NKRA 2ZYIA 4FYXA 5DTMA 1CERA 5ALVA 3RTBA 4UHKA 4P3KA 1JQLB 2C42A 2Z2JA 1W35A 3FPCA 2ZUDA 4MPTA 3STXA 1GTRA 2HF9A 4DANA 4DNQA 4HOYA 2B9EA 3IB6A 3WP0A 3DLBA 4N54A 4HB3A 2WAYA 4EHLA 2XEXA 3RQSA 1COWA 4PYJA 1TM3E 1TZJA 4EBFA 5K4GA 4UUPA 3HU3A 4FZRA 2DCUA 3KNZA 4FMBB 3HJBA 2QRGA 5TQ2B 1IOVA 4C0JA 4GI3A 4K8OA 2H07A 4CUKA 1V8BA 1N7JA 5F9HA 2WHYA 3WICA 1KH3A 1V48A 3ZW9A 3DYIA 4B6OA 2ZSAA 4MS3B 1Y37A 1TTPB 1M2NA 2IEBA 1UEIA 2YWEA 1N8TA 2DQ4A 3VR4H 4GF5A 3R75A 5HRAA 1PR2A 4IJWA 3GFOA 1E9CA 8ABPA 3EA0A 1EAMA 1CNFA 3CSSA 3GIWA 3W8DA 2VPZA 2J4CA 1B26A 4YR7A 4PZZA 3VJMA 3AOGA 1U1IA 1P29A 3Q3HA 1Y1KE 4AZWA 4MV4A 1ORWA 4DJ5X 4BV3A 4KYVA 4U7DA 1ZMBA 1NVUQ 3JVVA 5BNTA 4J16A 4AWXA 3FX2A 4TMVA 2V4ZA 3RGWS 2C4TA 4ZAVA 3TIFA 3JQ8B 5E1DA 4PTYA 5JWOA 2IV2X 3RVDA 2W58A 2XQIA 1JTFA 1Q16A 3D7MA 2X86A 2YFYA 3IQXA 4PX5A 3E48A 1RBYA 2DYKA 1ISRA 3SC6A 5K8IA 3IAS1 4QWWA 5FLXA 2ASEA 1ZWLA 2GXSA 4TL8A 1PZNA 4ZV9A 1IAQA 5FA5A 2JFZA 2UZ1B 3EGWA 3I30X 5D3ZA 1AUVA 2ZUBA 1RI1A 1V6AA 3PEUA 4RQUA 4GGOA 5KHAA 1AGXA 3JYLA 3NDBB 1DX9A 4G8BA 3CH5A 4G5GA 4JUIA 4NEQA 4E7OA 1EHCA 3ND7A 4HDAA 4Y0VA 4RUKA 4COKA 4YCLA 3ILHA 1PK8A 5H82A 2R97A 2EVWX 1E6LA 1IZ7A 2QLLA 3N8NA 4ZO6A 1USVA 5I48A 5K8UA 2RHGB 1SXJA 3OP1A 1TPZA 5MGNA 1NBMD 3IRVA 1G60A 1XL0A 1XMSA 2QG9A 2HSZA 4B6FA 3PC7A 1IHXA 1B23P 1BFKA 1U5BB 1UOPA 4MRAA 3FPHA 4RM2A 2O1WA 3T9BA 1DEKA 1K6IA 2FRDC 2ZB7A 4XWTA 4LJLA 3Q72A 4OHWA 3K94A 4V02A 1YRBA 1LW7A 4M1KA 5EVJA 1OB2A 3IEMA 2R8BA 2XMCA 3FNRA 1KO1A 3PD7A 1QK3A 2WUDA 3ZI7A 2FLKA 2AIRA 4R1TA 3RJMA 4WN9A 2IF0A 4E31A 2VDVE 3GG9A 1U3DA 2Z3VA 3PDIA 5HIMA 4EG3A 3HXMA 1JFTA 5COBA 5EYPB 2MWMA 1CUDA 2OV3A 2IY7A 3DULA 3TCKA 4PNEA 2XSZD 4Q34A 3QVSA 4J0HA 2GASA 5FBQB 2CKDA 2Y6UA 3A58B 3LTEA 4L76A 4RFVA 4DJTA 1Y8AA 4YJ2A 1SM4A 1H93A 1CJTC 3BIWA 4K26A 4L2IB 5ALRA 5LYJF 2GK4A 2J46A 3L9WA 1YV9A 3VHXB 2DFKB 4P5PA 1P5HA 1UBUS 3QA9A 4KWEA 1CE8A 1VJCA 4BB0A 3L04A 5LQJA 3H4VA 4L85A 2HTEA 5JAQA 3RSLA 5B4TA 2Q4BA 6PFKA 1IXZA 2VAWA 2AHOA 4FZ3A 2IPAB 3WAGA 1VE6A 3GRUA 4RDIA 2ZUUA 1T0BA 5KJCA 4TQUS 2DWPA 1AXRA 1V5WA 2O8BB 3MOGA 3HJHA 1UODA 4CKEB 1RHUA 3ETNA 4NBVA 3VHLB 2VF2A 5JYEA 2QPOA 3D8BA 2CEAA 3L4BC 3MAAC 2ZRBA 3IBYA 3LPDA 1BHO1 3H6GA 4JCOA 5CD9A 1QYIA 2RHOA 3CUYA 3OPNA 4FDLA 3C8MA 2OMEA 3UAOA 2WU3A 3CNHA 5AW8A 1KOGA 1I2AA 1JI0A 2H1HA 5B7QA 2TECE 3ZHOA 2HY7A 3FZYA 1NA5A 3ETCA 5DHSA 3L41A 5GM1A 1U9YA 3AYXB 3TO5A 3EIQA 4B8YA 1H4QA 2FFQA 5IDQA 1TCAA 2W2MA 3I6BA 1BSVA 1GUFA 4DQVA 2MYNA 2XNDD 4S24A 2E48A 1LLUA 2VCYA 1D4AA 3WA6A 1UBEA 4FUTA 1I6MA 5TARA 1G38A 4NCAA 3BBLA 3G89A 1MZVA 3AEQA 1Y42X 1M0SA 1ZIYA 4L8WB 3AINA 3UWSA 4G25A 4ZI7F 1HFEL 3WV4A 1BE6A 2BGRA 4B2YA 3NUQA 1J42A 2DHQA 4GW3A 4JOSA 5AW9A 5DH9A 3FHTA 2N1MA 1HQYE 1Z75A 3WNCA 4D9CA 2UYCA 3BTSA 1YDEA 3PPIA 1F60A 4ONEA 1QLWA 4PCUA 4PHTA 1TYBE 3PE6A 1M54A 4CNBA 3THXB 1BVUA 1WNFA 2YHSA 4FTWA 1KZYC 1T35A 4JFAA 3W9UA 1G5QA 3HMKA 1HTWA 3F6YA 4R98A 1BDMA 2Z83A 2REXB 4KX3A 5AESA 5AW0A 4QVIA 1T8TA 2BKLA 2HFKA 4MGKR 4YCJA 2QVGA 1G6KA 1ZMOA 3R0IA 1HC7A 4B6JA 2B4AA 2O5RA 1QRAA 2A88A 3A1DA 2CFIA 3EEOA 4HAVA 2R48A 1GEEA 1YKSA 5I9MA 3AUFA 4LY3A 4W9NA 1V4VA 1MAVA 3O8NA 1R0CA 4G1FA 1EZ4A 3FSJX 3KPJA 4B5LA 1YVUA 2LIPA 3NFYA 1SBHA 3QJGA 4RHYA 4TMKA 5ITVA 2XUIA 4I81A 1RLOA 2QMQA 1JKJB 3CPEA 3G2OA 4ARZB 3BB3A 3HN7A 2CB9A 3FAZA 2JFOA 3M82A 4I1IA 4Q9LA 5G1PA 1DNPA 3M6FA 3UJHA 3UAWA 4OY3A 2QX8A 2ZUWA 2PYDA 1AD2A 4I5EA 4LA4A 1SA0A 5BWBA 1OUMA 4JDUA 1W5FA 5BN1A 2CHGA 4JOCA 3FWZA 2AMVA 1ODSA 1YBFA 5AIBA 2OPBA 5EMMA 3H11B 3OFNA 2CJYA 3QXHA 4HNAA 4TMTA 3R20A 3DFFA 4R8KA 5JY6A 4PC7A 3EG5A 2CLSA 3NHAA 4RCYA 1P7YA 4KQHA 1PFUA 2JFNA 3QVMA 4JI3B 4DG8A 4EH1A 4HBZA 5FADA 4GOKA 1M2OB 3DW3X 3R6LA 1VJGA 3FNHA 2JEYA 4PWZA 1XEXA 1SVNA 5B1EA 1QGED 1SZDA 5EJMA 3TQCA 1KQNA 4CGYA 3ODPA 2VRCD 3CN7A 2ZJ8A 3K4HA 1DO2A 1ZNWA 4B73A 5DRTA 3NBKA 1A7AA 3O26A 3H9QA 2OCAA 3TLYA 1IDOA 3D8HA 2W6IA 3EDMA 4KQ1A 4BBAA 3HA7A 2M2IA 1AQIA 4B2IA 4UAJA 2BFFA 4KXVA 3LGXA 3EZLA 4E15A 2DY0A 4DLRA 1IOZA 3I2YX 1J1IA 1WMAA 3D6MA 3HCEA 2JGMA 3KWMA 2E0IA 2MYTA 4E0BA 5EWLB 4WIAA 5CDHA 3GUUA 1OI4A 1PZXA 2AJBA 4D9NA 1KVTA 1I7PA 1U2ZA 3DGFC 4X94A 5E38A 2YBDA 5DK6A 2F1IA 1JHYA 1VPTA 1WHSB 1Z9BA 2E4VA 3G8BA 5ERYA 2I1QA 2YFHA 5LDGA 2YQ4A 1VOTA 2QG4A 1V96A 4WZAE 5EJ5A 2I6GA 3OFVA 4OJTA 4IXTA 2CXQA 3OX4A 1UBLS 2HHHB 1AHPA 1EXMA 2YJNA 1NI4A 4BLRA 3KPYA 4F4CA 3N7TA 3CONA 4G8DA 4IP0A 1MHMB 2XUDA 4UOEA 1SUIA 2P69A 4BGEA 2BMEA 4X1IA 3GUHA 5EE0A 5HW0A 2ZYAA 1EB8A 3N8HA 1ISGA 1GV0A 1FQWA 1RVV1 3GFPA 1ID8A 3PDHA 3C4VA 4JIGA 1Y63A 3A4LA 3LKDA 4RDCA 3T4XA 4YJFB 3AOEC 5IUNC 3JZDA 2GPJA 1UBFA 5JRDS 1FXSA 1TLLA 1BIFA 1PBTA 2QT1A 3OFND 1O9GA 3TMAA 1V47A 2Z56A 1QQBA 3T15A 4EP1A 2FUG6 4C29A 1A7UA 5GJCA 4CQLB 1F2TB 4M1MA 1Z63A 2JLYA 4JP3A 2IXFA 3JD1A 3IULA 3F4BA 3CNLA 1E0SA 1W34A 4JP8A 4CV3A 3UO8B 1DKPA 3AIOA 3DTVB 1V5FA 1TXGA 4BVHA 3Q5GA 4TL9A 4Y2PA 1G6HA 1P2SA 4N48A 1MJGM 2IYLD 5FI5A 5IVDA 4CLHA 5IBCA 4BPBA 1PFGA 2L18A 4XH9B 4FE7A 1U1CA 1NRWA 4UQPA 4Q24A 3HBFA 4K1XA 4XZ3A 1XCMA 1EIWA 3EVGA 5FL7D 1B6SA 2NQ2C 3MCZA 1DRKA 3OJEA 4R8SA 4IPTA 3U3JA 3ZZMA 1RRFA 3IMFA 5SZHB 3R7SA 1XCGB 1KAMA 2NPOA 1S4MA 1M2VB 4C30A 1H4VB 1GQSA 1T15A 3JZAA 2IK8A 1ABFA 4ODIA 1IJBA 1LPSA 3QBVA 4U7GA 1L8XA 5BMVF 3ZY3A 2O7NA 5JUWA 4HQFA 1FNDA 4M98A 1AKTA 4UTXA 3EK2A 3RVLA 2AFIA 4MDHA 3WNDA 3PR2B 4LYGA 1HDZA 4TS3A 4US0R 2NVUA 3A4TA 3ZOKA 4ZYVA 3L4SO 3AVYA 2GBPA 3CR8A 2OCPA 5F5XA 4O08A 5I8WA 5BQFA 4P7FA 1NJ5A 1E1CB 2BEVA 4LBVA 3HCWA 1I0ZA 3GFVA 3A2NA 2I29A 3DZKA 1F7UA 1CZOA 5CXSA 5GIPE 1YOBA 1H65A 1FE8A 3U9TA 1U80A 4KQCA 2X0FA 4M89A 4WK0B 3WGGA 1SVMA 4P3NA 2O8EB 4CKWB 1Z35A 1J8QA 3EP8B 2ICAA 4HQRA 1IAVA 4KDFA 5CPBA 5AK0A 4CM1A 3NC1C 4LV6A 4INZA 1RIIA 1ZLXA 3FMOB 3QIAA 4U9UA 4JI8B 2I2CA 3QU4A 4LY9A 4DLSA 1UMBB 1S0UA 2YV3A 4R16A 4DNPA 4XASA 2NUTA 1AX9A 5KYKA 3DHYA 1Y8QB 4X44A 1A04A 3QE2A 4FCVA 1HT3A 4R1QA 1P4GA 2CJFA 5FI1B 1JIQA 4YAGA 2CL0X 1AGPA 1E3TA 2CZQA 3ZV7A 2WB2A 1BXRA 1TMOA 2Q4DA 3GFRA 4Q4LA 1JXOA 3BMOB 3UBMA 3KYJB 4MA5A 2WU4A 2B1RA 3MBKA 1AKEA 4O1HA 3ZCRA 2ZTUA 2MU1A 3C3BA 4HCJA 4I5IA 2MSEB 4LRWA 4B7UA 1ISPA 1ZU4A 2ADMA 3OZSA 3KOWA 3FSGA 2QR2A 5EAIA 5CA0A 2ZT8A 1O94C 1QV7A 3LKVA 1G5IA 2AK3A 2ECOA 2Z8XA 3ONWA 3ZLBA 1PG5A 4KRYA 5K7SA 2WJAA 1SN7A 2GFHA 3JQ9C 2RE8A 1XJWA 2L0XA 3HUUA 1CY7A 4NS1A 5KWVA 1X3LA 3GOQA 4GZ6A 3RNOA 1SQ0A 1XMVA 3W78A 2VTEA 5B1YA 1AK1A 1PX2A 4QU0A 2C3YA 2CNBA 2R6DA 1IG0A 3D7KA 3I37X 1MQAA 4JMLA 4RENA 3GJQA 5AKKA 2BFEB 3ROFA 3OT1B 5A5DA 1I2DA 3G2HA 2BFWA 1UK6A 1X1EA 4U02A 2VG8A 3TUJC 2PMFA 2OESA 5KDOA 3RIHA 2IWRA 3URKA 1KI6A 4RD3A 3D8NA 3EZXA 3MILA 4MKXA 1WP4A 4MICA 5AWFC 3DZ7B 4D9BA 4TZ0A 4PLGA 1I33A 4OAQA 4R9NA 4UOZA 2J6BA 2BY4A 3EDQA 2WWTA 2OHXA 3WWOA 1QIEA 2Y05A 4UDXX 4E03A 4R81A 1EM6A 4Y2JA 3WGYA 2ZJ3A 5LP6F 2DETA 3Q8MA 3KYDB 4TRNA 5IH7A 2AC4A 1XK7A 4Q39A 1CQIA 1DG3A 1ZO8A 2OZLA 3JQ9A 3P97A 1N2OA 1GFZA 1M10A 4QXAA 1JKMA 3B89A 3RSHA 2XOKA 1YNSA 4JZKA 2I5PO 1E9VA 5DULA 3C3DA 5CFLA 4FW8A 2VCHA 4TLBA 4D56A 4R1NA 4HGQA 5CH5A 2DUNA 2FE1A 3M6MD 1YDWA 2XUJA 4FHZA 1ZI6A 3AETB 1RKUA 1TTHA 1OW3B 3G2IA 4RLHA 2WICA 4MJ7A 2ONZA 3RU2A 3S29A 1E6EA 4P53A 2PVPA 8GPBA 1FUYB 4HPXB 3HCNA 1RCTE 2DWUA 4HC4A 2B4TO 2AF3C 1F6BA 3ASZA 3S8EA 3NH6A 4KIJA 2R62A 1JA9A 2E4XA 1WCWA 4K87A 3T1VA 3HVIA 1U9IC 5EJIA 1FW6A 2Z1NA 3LWZA 1P9WA 4L5BA 2HW8A 2QVCA 1JDTA 3PNYA 4CCYA 1T9GR 2WF9A 2ZRCA 1ZC3A 3NCTA 3AR2A 2TS1A 1NPYA 4IS2A 4IY1A 1I4DD 5CLQA 3G9QA 4RQBA 1ZEJA 1P1JA 3PE3A 1DARA 2O3JA 2R0QC 1DRUA 1E5QA 1R88A 3AR3A 4WLOA 3VR5H 4D7AA 3AFHA 4LFAB 2BD0A 2CXPA 4IIUA 3LHFA 1U9JA 3VFDA 1BE1A 1EXWA 1I1OA 1NVVR 4OQQA 3DE0X 2QTGA 5F35A 3KR9A 4JLDA 4QYWA 3S8YA 1KJ8A 2QPTA 1FJXA 1P1BA 4CETA 1PFQA 3HMQA 4PYQA 5GIOE 1QANA 3DE1X 3RIGA 6YASA 5ICCA 2AEEA 3GMIA 3FHOA 5AD1A 4GNRA 5NLLA 1GTG1 3RTAA 4DV7B 4FEEA 3PC3A 3H3XA 1D2EA 4S3MA 1QYVA 5DZSA 2BHSA 2YOFA 2WNSA 1PNOA 3JPWA 3FNBA 4Q3OA 1P8JA 2HC9A 1R66A 2FGJA 2W2PA 1PNRA 4PO9A 1TAHA 2BEWA 3KJGA 1UQUA 3NYWA 4D6YA 2RSLA 1TF2A 1Q17A 1Q7RA 2ZG6A 1LB1B 3ORYA 4F9TA 5JMPA 1U0EA 3R5SA 5U9CA 1Z6XA 4B3GA 3K15A 2Q6OA 1CY6A 3G8AA 4HAXA 2ZBGA 5JYDA 4AULA 3PGA1 3THXA 1NSFA 1RAAA 2F9LA 4QOHA 5LWHA 1PQPA 2A59A 2XITA 2C9BA 5CFPA 2DCMA 2PX8A 3EGDB 4ZJYA 4RNCA 3D2LA 1ES9A 2HYIC 3HBJA 4IDHA 2V7GA 1NDUA 3H17A 1C14A 4NCKA 2X6TA 1YNOA 1FFXA 5FI3A 3D2BA 3AHEA 4JR0A 2OENG 1D2RA 2OAP1 2VBIA 5E1OA 3IYLW 3SR4A 5I7SA 4OMFG 4MWTA 2APJA 2WG1A 5A5VA 4RCZA 1EWTA 2IUTA 2GM4A 5A5GA 2FU5C 5I7OA 1KFKB 4OLBA 3G59A 2REQB 1GGKA 2P4SA 2ZB8A 3MJDA 4KJZA 5ITZA 3JZFA 2JLUA 4R5HA 3UJNA 2AOUB 1N7IA 2QL7A 2MJLA 3CRRA 1G2IA 1G8MA 2YNMC 4UDNA 1BWPA 3OPMA 4D3FA 5IRCD 3BJMA 3IL2A 1E6CA 2PS0A 1UBMS 3AETA 1E1NA 4AJ1A 1Q3HA 3X1DA 1KFCB 3H2HA 3EW9A 1NDHA 4IQ0A 4TKVB 5BN5B 3R9KA 4D81A 4DDMA 4DQLA 1HL3A 3JQ6A 3AY0A 1P5FA 3F8SA 3FOFC 4JHLA 3UATA 4QVKA 2FF7A 4BNGA 3AJEA 3GLTA 3ER9A 1T26A 1CRLA 1MG5A 3KTOA 4KE9A 1LDEA 5DN6D 1R4MA 2X0IA 5KVQA 2C57A 2DUJA 3H5OA 2VWHA 2BR5A 2VL7A 1UZMA 5LQAA 5MGBA 1J9EA 2WEKA 2VZ9A 2HU5A 2WRZA 2Q6VA 2Q3HA 2RHHA 2GBGA 1H23A 3QVTA 5IMBA 2GN1A 4EHHA 1MW8X 4TTSA 1EJ6A 4BQIA 4XGQA 3FBGA 5EVCA 3GGDA 2RGWA 5CP8A 3UANA 1F9AA 2YNMA 2QUIA 1ZD4A 1NRJB 5E95A 4V2IA 5LQSA 3RC3A 1RTTA 4FSXA 4HK4A 4KWIA 4KWHA 4EF4A 3T7IA 4PX2A 1NF8A 1T0HB 2P4QA 4RCVA 4W5WA 2AZMA 2PR7A 2ZS7A 5D86A 1EINA 5DGTA 3DTTA 3M33A 4FZ5A 1FFBA 1H2EA 4D57A 4U00A 4TYYA 1YCFA 2JBAA 4PONA 4R1UA 3BHNA 4CR7A 2DHDA 2QJTA 1UDWA 3CPHA 4NCBA 4OHCA 1YRHA 3A3YA 4ZT3A 1RJ9A 1SQSA 2WR8A 4AJEA 2V4UA 4PE5B 1LJLA 2XUOA 4A73A 2HT6A 3G6WA 2QSJA 3L46A 1I30A 1NY6A 4WESA 2C2XA 3MFQA 3UWDA 4ZGBA 1UFRA 5KYTA 1O6BA 2AD1A 1TJPB 4ZRDA 4TWBA 1ECLA 2O6HA 3SX4A 3KSAC 2IELA 3W3AH 3ZCVA 4KH1A 2ZR0A 3ELBA 3UT5A 2XOXA 2HTFA 3AJDA 1OH5A 5B7PA 1SGWA 1OX5A 4C0QC 5KJ6A 2DECA 3CMMA 4FGSA 1Z4MA 3GARA 3STYA 5HG0A 4DCMA 3PJRA 4HH4A 4P84A 3ANXA 2WF5A 3S0JA 1F7VA 4Q4HA 3JVUA 1KEUA 2RHBA 4QYTA 1WXHA 2W43A 5HCUA 2Z6UA 2WTBA 3BK7A 3N9IA 3UMYA 4R2JA 5G1OA 1S8AA 4PAQA 3UBTA 3SBEA 4NHEA 2VPTA 4IDOA 1U3VA 4HZIA 4LJ4A 4M8NE 4CF4A 5ADWA 3IJ5A 4YREA 4F6CA 1JHUA 1E5TA 3R4VA 2ZI7A 3TINA 1ZN9A 3EP5B 1CY0A 1RHJA 4L4XA 5J5VA 2ZULA 2VNAA 4ARCA 1ZA2A 2ST1A 3BSWA 2X76A 3PUYA 4IVPA 4MDEA 1ADYA 4NOJA 5C7LO 1U2GA 1FDSA 2AUMA 3LPMA 5CH8A 3UWKA 2BONA 1XXHE 2F3PA 2QX6A 4OHBA 4IV8A 4RS3A 1N0HA 4UHEA 5KYUB 4EEZA 4UHCA 3KYBA 3P2KA 4LRXA 2AI2A 4M8IA 2NP6A 3ZHCA 4CEJA 5CNKA 3GFTA 2VTDA 1IHOA 1M2VA 2HPHA 2QV7A 1QONA 1RW4A 3A26A 4ACBA 2V6BA 4MEJA 1SKUA 4DEYA 5J4HA 2BDEA 1K5HA 3DEZA 3A1VA 3FYCA 4FKBA 1TO6A 1FCJA 1T2VA 1XTTA 2G8NA 1A98A 2P0EA 3EXFA 4HDSB 5FHRA 1G1AA 4CUJA 1HE1C 4CIBA 4MYCA 3GLHB 2P2LA 3L7LA 1PZFA 2UAGA 2ZJYA 3JSXA 4KGVA 4L8LA 3SS9X 1T5DX 2C7VA 2GGSA 5T3YA 2XMPA 2ADFA 2ISQA 2WF7A 4TN5A 1Q1AA 3H16A 2HNBA 2Z5LA 5KSPA 5C8ZA 4FR5A 4MX8A 2Z1DA 2O23A 3CUWA 3RW9A 1N6KA 4GXQA 3C3EA 1ABEA 4CI9A 4EYQA 1IC6A 2J9FA 4WLNA 4ENQA 4UQOA 3VR4A 2ZCVA 3NEYA 5D5HA 1OWMA 4HDCA 4C0XA 4FFNA 3ZK7A 2RK6A 4P5EA 4U2FA 3OLWA 2VT3A 1XXHB 4X60A 5AH0A 5F33A 4D74A 5JHGB 2WKWA 2DQKA 1WEHA 1EH5A 3A9SA 3V00A 4QEZA 3OCJA 2OPHA 1T4CA 3ULKA 4HQOA 1E79D 1NUPA 1T5OA 1IPFA 2PJDA 3D59A 3EIHA 1FFGA 3MWKA 4UUMA 2W22A 1WMEA 3GT3A 4IWXA 2ZB3A 4BP8A 4Z3DA 2QM7A 4REMA 3K2BA 3EFEA 1MGOA 2EXXA 3TTYA 2FMFA 3O03A 4FJ1A 4EI2A 2X0KA 4YV1A 4KYTA 5JJCA 3UWMA 3DONA 1U0FA 3INRA 4I1OA 4DIOA 1V4BA 2AXEA 5KQMA 3ZY5A 3ZZNA 4B79A 2OD2A 4OA5A 4AIIA 1RKVA 1VLZA 3DLPX 2I99A 3BZBA 5G2OA 2UKDA 2A5DA 1WZIA 2JGKA 3HADA 3LXMA 1CETA 1KEWA 3GLGB 2ECQA 3LWDA 5HDQA 2Q7DA 2WP0A 4LF5B 4FXOA 4QD3A 3JV7A 3IESA 1XALA 1SZCA 1YUMA 3QHQA 3H9GA 1DT3A 3OPYA 3Q7RA 2IS6A 2HOQA 5EWJA 2P2CA 4EW6A 2AG0A 4ZU1X 1ECBA 4HF7A 2ZI9A 4HTFA 1L5MA 3E3NA 1D2CA 2GM3A 4FYYA 4QTYA 4ME6A 1HSZA 4FX2A 2A67A 2ZYUX 4UFPA 3TUTA 1R6BX 5TR9A 5FULA 3JYHA 4BATA 4DQ0A 2JHGA 3AEKB 4FC7A 1F1JA 2CFOA 3A2LA 4R2IA 1W7AA 1MUUA 2QZSA 1B6GA 2BEKA 2HGSA 1N6PA 1SUWA 2V5UA 2VF8A 4W8OA 1P8AA 2EYQA 1L5GB 4O5OA 4UVDA 4JQYA 2DT8A 5YASA 4XUEA 3MMSA 2Q4OA 3S2UA 4QO7A 5JADA 2C4WA 3IR7A 3QPDA 1C0IA 3WOHA 5HBRA 5JD3A 2PX2A 1JEQB 2GF0A 1OFTA 1RHMA 1CUFA 2FEMA 1EGQA 1NYTA 2P3SA 2RIPA 3A3OA 1Q15A 3QVKA 4Q21A 4QUBA 4RVSA 3TVTA 5CBPB 3U4MA 4AKIA 2JJ1D 2Q9CA 5I9NA 1DMRA 1TK9A 4DGSA 4Y6PA 1I2MA 4F3CA 3SKYA 5FV7A 4YRPA 3BQMB 2W71A 1C0EA 1U90A 5KVSA 3PJFA 5I7EA 5GGYA 1Q84A 2C4KA 3K8QA 3PQCA 4YHBA 2PUDA 1CNMA 3MXOA 3MTIA 1F14A 1UWCA 2JDIA 4NESA 3VDQA 4B76A 3EAGA 4AO8A 2FEPA 221PA 3MGKA 3MJSA 4LHZA 2EWVA 1VL6A 4CIYA 2H4WA 4LRTB 4PCLA 4OVKA 5CLIA 1E1RA 3UJ7A 1D7AA 2ATXA 3ODGA 1BO6A 1ESNA 5ECDA 4QXMA 5C2JB 5AP9A 4LYHA 5E7QA 4NPAA 3W9YA 2PKXA 3KOMA 2ZE8A 4KV9A 4WXHA 4IQGA 3NATA 2XMBA 3KZ1E 2Y9PB 1YJXA 4NNJA 1O95C 1WIWA 5LLDA 3NOOA 1GSIA 5J9FA 1XDWA 4NMXB 1YRLA 4C4YA 4EO7A 2J5RA 2C3PA 2GAAA 3L07A 4MYDA 1A5AB 4LRSB 2OHIA 3IBTA 1O6ZA 3I8SA 2QTFA 1H8EA 1BWSA 3MK31 1EPUA 2FGKA 3JD4A 5MHTA 1JR6A 4LK2A 1THGA 4DMFA 3MIIA 4U7FA 1E7WA 1C2YA 4TTJA 5LDDC 1BDJA 4JVSB 3EZYA 1JPUA 1GPH1 2PUJA 5FPHA 2I34A 1L5NA 5H70A 5EJ8A 1G3MA 2FSIA 2WJ6A 3QLEA 3TPCA 1BD4A 1LLFA 3EY4A 2CGEA 4WBNB 1X7YA 2OYSA 1E5LA 4B33A 5T7BA 2WSSA 3UJAA 1N1MA 4CHTA 1JI3A 5C0OE 5IDWA 3AW8A 1ESDA 3C8ZA 2SCUA 4KXXA 2GCOB 5HE8A 1LI5A 2XB9A 2NWQA 3HRIA 3W06A 3LZ6A 2H4XA 4GIBA 5EE5B 3AEUB 4QU9A 3HNPA 3L1JA 3LGSA 4AJIA 4UTNA 5EJ6A 2C8LA 3RSZA 1R0LA 5K0ZA 1OLOA 1T8WA 3LKBA 1NC3A 4LXUA 4C1NA 4GWKA 5LNK6 4WOCA 1KK3A 2LXNA 3DKKA 3K16A 3PT9A 4YH1A 2YHAA 5HS6A 3P26A 1XMPA 1N3LA 1OIVA 3H19A 2I2FA 1U7OA 2B1GA 3HR8A 3UV3A 4CR6A 2HJHA 2P5TB 4W82A 3K31A 4XFKA 1K9VF 1M1NB 3JYNA 4CIDA 3SICE 4D80A 3NKFA 1GAXA 3UTCA 4AJLA 3IMCA 1NSYA 3DB2A 3W1EA 3HTXA 2B4YA 1QG0A 3IC5A 1WMFA 3A6PC 2IEIA 1M34E 4L15A 3GX1A 1LC3A 1TUIA 2YQ5A 2H2IA 3QENA 1YB2A 3WFZA 5K20A 2LZ0A 2II6A 3UMVA 3W2IA 3IPRA 5U4XA 2F3RA 4IICA 2BFBB 4YXWD 5E0OA 1ZHHA 3BIJA 1KRXA 3BMXA 3EXG1 3WC4A 5ARBA 3C1OA 4IDNA 3TGPA 1GRVA 4QKQA 3SZ3A 4DZZA 1FOEB 4CV1A 5HP4A 1EUCA 4OM7A 1E2PA 2G88A 1DXQA 4FYKA 4X90A 3EP7B 3GJ7A 2GX6A 3R7NA 3AUJB 1ENPA 3CCCA 2XI4A 3MCWA 4G4JA 5GV7A 4YIHA 4KPFC 2Y1WA 1XAHA 1M33A 3LAWA 3VSCA 3K0KA 1HY3A 3DFKA 1VHWA 3EVCA 3QUBA 2QVBA 5K6TA 2WTEA 1FSGA 4KDRA 1RZRA 2G4VA 1LQ2A 2VT2A 4FMDF 4YT5A 4TPKA 2VTBB 1CBUA 1G1MA 5IWAB 1UM9A 2H85A 1ORDA 3WBBA 4BDTA 1R0BA 4AF8A 1RE1A 2B1IA 3PDWA 2DQZA 2Y99A 4TM7A 3VR0A 2M9MA 1Q0ZA 1OAKA 1WZUA 1CP2A 4Y2RA 1P4HA 1AS3A 3AUUA 4MPPA 3TYXA 1G8AA 1LK5A 4EB6B 4ZVVA 1AB6A 4JLMA 1QNLA 4JVOA 4WOBA 5DIZA 4LPSA 2FETA 1E3SA 4C05A 4DJEC 1Y3IA 3PFHA 1LPOA 3OIGA 3LY8A 2CSUA 4EARA 1J2RA 4QFBA 5CYOA 1GA1A 3TW3A 1T24A 1UPFA 3BRQA 3HC7A 4RAOA 3DTNA 2C5AA 1SKMA 1DRJA 1PE0A 5BVGB 2LNDA 1VHTA 4QGGA 1OA0A 4PAOA 1JHMA 4XGRA 2P8JA 4BO9A 4PGMA 2CDAA 4HLQB 4Q4JB 1XZQA 4CXMA 2IYPA 3LP8A 1E96A 4WESB 5DM70 4C2TA 5AJWA 1DQNA 5E1BA 1W44A 5TF0A 2HJGA 4OL9A 1QCZA 4W1RA 1TTQB 2W6JA 1X86B 1HDXA 2ZSBA 1Y8RA 3LK6A 1DQYA 2VRBA 1YK1A 2PSEA 1OJ7A 4BJ5A 5KYWB 1A8IA 2ZWIA 4CLXA 3U3ZA 2DHRA 3W8RA 4F92B 5HCIA 1UIRA 2FEWB 2IOFA 2BFPA 1E3JA 3KEOA 4V24A 2E2WA 3TB6A 3JARA 2X6QA 4B6QA 4Z4FA 2YJ3A 4LSMA 2GPSA 3CT6A 4YI3A 5JPDA 3CZ9A 5JZMA 4DADA 4PXSA 1A9XB 3CG0A 2FQQA 1NR5A 4U0JA 1M5TA 4IXMA 5G4KA 4ZI5A 3AVXA 3SQMA 1Q7BA 1E4VA 2YJTD 3CA8A 4NXNB 2XUZA 4A36A 2OO3A 4RS4A 1DIAA 3QEBZ 3WWYA 3WL4A 4ZRMA 1QX4A 1QP7A 3G2NA 2X9GA 3EIOA 4J0IA 2VATA 2YMQA 3SC2A 3WLOA 3W2HA 4B4DA 3EOAI 4BB6A 3ND5A 4Q3CA 3FUWA 3L6DA 3TNYA 3DLIA 3IDSA 1RMTA 1CIVA 5ITWA 2QTTA 3CRZA 2J3HA 2RK3A 4HFMA 2N46A 4R8VA 3GQBA 5ER6A 3VI4B 1Z62A 1ZQ1A 4NCNA 1PKEA 1DAMA 1RQNA 3B20A 2O2GA 4E2XA 1QPGA 4OUDA 3F73A 3WO0A 3CVXA 1M74A 2RBEA 2TRSB 3KXDA 1KI8A 5KOHA 3JQPA 3Q87B 5C5CA 4CEIA 2XRMA 3LUAA 2VP6A 1CS0B 5HCNA 5TNXA 4A26A 3A14A 4FHCA 1RBQA 3I9V1 3BE5A 5H02A 5A9TA 2H59A 4O2AB 2K4MA 1IUPA 2JK1A 2I80A 1LU9A 1UEJA 3VPGA 1U28C 1IY9A 1X1RA 4JT2A 1QCDA 2AMFA 3DQPA 3FR7A 1PSDA 1SCAA 3X43A 2C1ZA 4XDZA 1NMQA 3I76A 1RDFA 3HPRA 4HNQA 1BYIA 1JNXX 2EC5A 3KKLA 4WN3A 2UZ4A 1R9MA 5JO0A 1CY1A 3C4JA 3DMTC 1X9HA 4GKVA 3PC8C 4UTVA 4DRYA 1CVLA 1KOJA 1NW7A 3CF6R 4IIDA 4OFBA 4OMUA 5T6BA 3VSAA 4B4KA 1RQLA 3ZCTA 1REQA 4ESVA 3CLHA 1GL9B 3THYB 4MCIA 4U2CA 2C9CA 2ZQZA 3HDTA 2QAIA 3N2KB 2HXSA 4A8HA 4BRSA 1XO1A 3AEYA 1E2IA 1XNQB 3MWJA 4HI0E 1Z73A 3HV2A 3HB5X 4IQ8A 4REQA 1F8YA 4NZOA 1BXKA 5CJ2A 1GXSB 3AERB 3EPKA 4P4GA 1YR8A 4WCFA 4C87A 1TQ2A 2XDYA 2L69A 1HRDA 5L45A 1ZJWA 2HHJA 1LLQA 4M1EA 5HUQA 2WT4A 1KKMA 3HG7A 3KE8A 2AUNA 2HYDA 2F1KA 4MVJM 3OZEA 4IG4A 4X41A 4Y6OA 2CL5A 3I9LA 3UK0A 4RHXA 1Y1RA 5T4HA 3EPJA 1ZM4A 1P9RA 2V0CA 3I2KA 4NZPA 3SYTA 1G8HA 1N2GA 1YZVA 3PRYA 4MQBA 4O0MA 1Y33E 3IR5A 3LC0A 1RQ7A 3T5AA 3UG7A 1O4WA 3NHJA 5DBHX 4HTFB 1I6LA 2ON6A 2XMSA 3E27A 1M2OA 5JT1A 4D3ZA 4DV2B 2QN1A 3MB5A 2AV6A 1QRRA 4QWMA 5TEWA 1TW3A 3TZBA 4GUAA 3TFOA 4FONA 2CNWA 3HA5A 1HSOA 2QX4A 1H2HA 1ZBDA 4HWGA 1EBFA 1W19A 1ISHA 2NSHA 4PR0A 1MQSA 2IEYA 2O3QA 2NXWA 2QMYA 4PXAA 2ZUTA 1U3TA 5AFSA 2G63A 3IOBA 3FHJA 1W88B 5EJ7A 2DR0A 2IDZA 4LOKA 2E82A 3LUPA 1FFDA 4RVHA 3TTXA 3K0CA 3VU9B 4C06A 4C4PA 2VPQA 3SXUB 4IJUA 3U7RA 1EVLA 3C5CA 4JVMA 2GERA 3ZDXB 4DPKA 3NKVA 5FJJA 5IN5A 1JEQA 3LQRA 3HNOA 4LHXA 2ZKLA 3JQ7A 2IOHA 1L4LA 3RFFA 4ZHQF 4LRUA 3TQQA 5ICGA 5EP1A 2DU8A 2ORWA 2JGAA 3LX5A 3KHSA 3KLPX 3ZHRA 4KDCA 4IDFA 5IM5A 2O59A 1FP2A 1L4GA 1PQYA 1QR6A 4TSFD 3EEQA 1ESMA 3HFGA 4FE3A 4K0RA 5E2BA 3TK1A 3L5KA 3ICEA 1XYGA 4R6WA 2CFCA 3JRXA 5A02A 3MJTA 1ZKDA 4DLUA 3KSRA 4C3UA 4QFMA 1T5IA 1OPRA 4LYJA 4XJTA 1ZDMA 4WKGA 4CL0A 2X0JA 3L6CA 3BWMA 4FFOA 1TCBA 4H7FA 3JQAA 1RYEA 1QMIA 4WK4B 3S2IA 3VC7A 1H0HA 2BE7A 4BIMA 2JK0A 3GFBA 3EPLA 1UMKA 3GRCA 3SC4A 4ENSA 3DDUA 1GTJ1 1PL8A 1RVDA 3IBCA 4GRDA 4KN9S 4NONA 1X70A 4Y2SA 3V8MA 3ZIUA 2C1EA 5B7NA 3FFTA 5BSFA 1G291 2FQ1A 4EI8A 3RT9A 1UXKA 5BVHB 3ZU3A 3MMXA 4B83A 4TTVA 1JXAA 1U1DA 4HUJA 1WF6A 1W4BA 4V0MA 2QI9C 5BSMA 4DCNA 3BXHA 1C0PA 1LF0A 2ZUFA 1WCV1 4DR6B 3ROTA 3STWA 4XDHA 4EQ6B 5HQTA 5CX1A 3QU7A 2EG5A 1FJHA 2HDOA 1FXWA 2BSQA 2C58A 3A4NA 3GZNB 3OBBA 3VI3B 4J0QA 4C0BA 1TYZA 2FPRA 4REQB 4J7AA 3DNFA 2NAFA 4XCQA 3EG9A 1Z17A 2M1ZA 3LZDA 2C5BA 4FOTA 4RLQA 3U09A 4HRAA 2Q5LA