1E7RA

Gdp 4-keto-6-deoxy-d-mannose epimerase reductase y136e
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
314
structure length
314
Chain Sequence
KQRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPEAIAKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQSAPDVVVWGSGTPMREFLHVDDMAAASIHVMELAHEVWLENTQPMLSHINVGTGVDCTIRELAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVTRLHQLGWYHEISLEAGLASTYQWFLENQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GDP-FUCOSE SYNTHETASE
publication title Probing the Catalytic Mechanism of Gdp-4-Keto-6-Deoxy-D-Mannose Epimerase/Reductase by Kinetic and Crystallographic Characterization of Site-Specific Mutants
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 108
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.271: GDP-L-fucose synthase.
pdb deposition date 2000-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1e7rA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1e7rA02
3OIDA 2ZQZA 4YJGB 3AFNA 3DMYA 2HMUA 4M86A 4PZCA 4RPLA 4J1NA 3V2HA 3WYEA 1XU7A 1A9YA 3OEYA 4BUCA 4D45A 3SC4A 1SO8A 5TX7A 4YQYA 3DAPA 1J5PA 4B4UA 5K6AA 1GZ3A 3L4SO 5EQFA 3RC7A 2DBRA 1B3BA 5CFZA 1R0KA 3EDMA 2XF8A 4NR0A 4Z0PA 4B7UA 4GGPA 1QG6A 1T24A 2CNBA 4XB1A 5JCJA 1MXHA 4C7KA 4D0RA 5BSHA 3PJFA 4EJMA 4J90A 1PS0A 1KYQA 4HFRA 5DZSA 4Y6PA 4EITA 1BVUA 3ANMA 1YQXA 4CV1A 4O5OA 4OYRA 1UXJA 4JBIA 3C7CB 4U6SA 3Q2IA 3VH1A 1KBZA 2JD1A 2RBEA 4TRMA 5JLAA 1A72A 3RROA 3EAGA 3F1LA 3ULKA 4IQ0A 2O3JA 4OXNA 1XQ1A 1BXGB 1LC0A 3KUXA 4ZRNA 1N2SA 2SCUA 3AU9A 3E9QA 5ICMA 1V0JA 2GZ3A 3SJUA 2ILTA 3KYCB 4RV9A 4CM4A 1O89A 1WZIA 2DBZA 2JJYA 5DBGA 1BW9A 3GZNA 1IZ0A 4UVDA 4E5KA 2BD0A 2BELA 1OI7A 3S2EA 2NVBA 2CSUA 2V6MA 2W2LA 4WLVA 4ZQGA 1P45A 3LQFA 5DF1A 2FWMX 1AUPA 1NVMB 4PVCA 4YT8A 1GV0A 4DIFA 4E3ZA 4XYMA 3HB5X 4ESOA 4WNCA 3VPXA 1BDMA 4ND3A 4WLUA 4IDBA 3AM3A 2VZ9A 3N7UA 4ZQHA 3PYMA 4N7RA 3PIIA 4NDNE 4R01A 5HS6A 4J7CA 4ONEA 3IP1A 4Y8VA 3RBVA 2IXBA 1FJHA 3QRWA 4J43A 5DBFA 4WLOA 2CVOA 2J8ZA 2WD7A 1KVTA 1AHIA 2DU8A 3P5SA 4JIGA 2WSBA 1DFHA 1B14A 3RASA 3JQ6A 1FXSA 2C20A 4FN4A 2OHXA 6LDHA 3MWEB 3N58A 2IZZA 5JAQA 3BYZA 2PK3A 3HADA 3PHGA 4L73A 2FY8A 4Y6RA 1C1XA 4YDRA 2PGLA 5A5EA 3JQ8A 4KUGA 1NAHA 3DHYA 4E33A 4YYZA 1MX3A 1ZK4A 5B37A 4GBJA 3O03A 4BGIA 5A9SA 2DT5A 3RUCA 3ROMA 1C0LA 3PP8A 4A2CA 4PLPA 1NM5A 4EUHA 1UXHA 1JVSA 2C2YA 2J3JA 3RCBA 4DRYA 1CYDA 4WCFA 1JVBA 3I9NA 3PJGA 1LNQA 2HDHA 3GN2A 4GLOA 5F1PA 4MP8A 3IL2A 4XB2A 4BNMA 1HZJA 4E2ZA 1LSJA 4NJOA 5EQDA 2UUPA 4RVDA 4J9UE 3TZKA 3HJAA 1IHXA 1UDCA 3L77A 4GX1A 3NTQA 1N1EA 1QV6A 3P2YA 1TVEA 5EPOA 4CL3A 3FTNA 2CF6A 1P1IA 1KVQA 1PJTA 1QP8A 1R6DA 3FPLA 4XQCA 3RKRA 2JCYA 4NFYA 1BRMA 3TWOA 3IJRA 3UCEA 5JYEA 3EVNA 3S2FA 3VTZA 2ZJ1A 3M1AA 4FGWA 4E4YA 1BDBA 1UP6A 1ZK2A 2Q45A 4YT5A 3LC7O 2X86A 4WE3A 2ZTVA 2VRCA 1ZNQO 3WFJA 3WGZA 3WXBA 4INAA 4KDFA 4H15A 2V65A 2BRUA 1GD1O 2X0IA 1Z82A 1L7DA 3ROPA 1D4FA 1G0NA 3TZ6A 3O8QA 1CRWG 5CAEA 3LC2O 5L3ZA 2VWHA 1HXHA 1UAYA 1VL0A 5COAA 1B2LA 1TT5B 1NWHA 4NU5A 3WGYA 1R4MA 4LVUA 4Q3CA 1E5LA 4AG3A 1CERA 2PH5A 3KYDB 5I7SA 1X7DA 5CPBA 4CV0A 2X1HA 2HJSA 4FD3A 3IAHA 3DBLA 2BKAA 1A27A 1U3TA 1ZSVA 4EGFA 2PFGA 3CZMA 4OJNA 4ALMA 1R4NB 3OH8A 4Y9DA 4TKMA 4FFOA 3ONDA 2G82A 5KOIA 1T1RA 1ZEJA 1GCOA 1GQYA 2VOEA 4AJLA 2IYPA 3ZNPA 1N8KA 3JD0A 5TIIA 1LDYA 5L53A 2JD2A 4IGEA 2R00A 3F9IA 4MJLA 1JDJA 3ZHBA 3GN1A 5B12A 1DEHA 3IDSA 3OJEA 5IDQA 5IJZA 1DJNA 3AOEC 4FOSA 1GL3A 3VTFA 3OQ6A 4U7WA 4BQRA 1FMCA 2VTEA 3HHPA 2Q2WA 4XGNA 3D3WB 3D64A 4MIOA 4FJ0A 1ISFA 1UR5A 4XCVA 5JCJD 3E48A 1GUFA 3Q2KA 3WR5A 1XGKA 3ST7A 4MVJM 4BO1A 1G1AA 4I5FA 1N9GA 4TZTA 4JK3A 3MOIA 4YJHA 1Q7GA 1H9AA 1U2GA 1HYEA 2NTJA 4Z9YA 1V3TA 3JYPA 3AM5A 2I76A 2D8AA 3VOSA 1HYHA 3L0DA 1T26A 3SLGA 4JJGA 1SEPA 2QYSA 2WJPA 4MKZA 1YS4A 3HWRA 1FDSA 4BIIA 4TVBA 3WGOA 4EJ6A 5JS6A 4JX8A 4CMCA 1H5QA 4B4WA 3E9MA 2Q3EA 3ZU4A 2FN7A 4G5HA 3PJEA 4OM8A 4KWIA 3C24A 1F06A 3ZWAA 3MTGA 2D4AA 1PJ2A 3TRIA 1ZEMA 2EERA 1Y8RB 3GRKA 1VKNA 2EJWA 3CSDA 4XQEA 1SC6A 4FDAA 2OP1A 3AY3A 4WNIA 3GA0A 4LCEA 3VPFA 1Y5MA 4MKRA 3O4RA 4J9VA 2AE2A 1EVYA 3JYNA 2W2LD 2ZB8A 4CUJA 5A05A 1U5AA 4RL6A 2PD6A 4MIEA 4XGIA 1LEHA 3QVOA 3MJSA 3TZQA 3JQGB 1XELA 3INTA 3PRJA 5BNTA 5A9RA 3D5QA 1U1IA 4PLYA 4PCVA 4KTTE 3C7AA 5F1OA 2Y93A 1WMBA 3BHJA 3C7DB 1WPQA 1NAIA 2JL1A 1IHYA 1TB4A 4D79A 1PGOA 1JKIA 3FBGA 4PLHA 3D0OA 3TFQA 5KTKA 4M1QA 4RLHA 5DT9A 5A04A 5IFLA 3WJ7A 4JBHA 4BNKA 2CF5A 4WLEA 5HS4A 3RC1A 4MP3A 5LDHA 2NUAA 3EGOA 4AJNA 2EP5A 2R2GA 4HV4A 4GL4A 1R15A 3JQCA 4I5EA 2ZB4A 4OSOA 1RM3A 1LLCA 2EWMA 3NAQA 1ZKMA 3WB9A 1Z7EA 4IUYA 4RZHA 1Z7BA 2E37A 1Y8QB 1MGOA 4BHTA 2RH8A 1ULUA 3AOGA 4JLWA 4YWJA 4JJFA 4DQXA 2ZYGA 2WM3A 1Z74A 3DL2A 1M6WA 1YDWA 2D59A 3RBZA 2ZJ0A 4CLXA 1A7KA 4PG5A 1EK5A 3DZJA 2VWQA 1ZMTA 3ZWMA 1EVJA 2J3HA 3PHJA 2D5AA 4IMRA 3E03A 1ADGA 1U9JA 4BNIA 2X0NA 2P4HX 4TMFA 2R00C 1C0IA 1R37A 2VRBA 3C3XA 2DTDA 5GMOA 1ZSYA 4ID9A 3UFXA 2POQX 3NTRA 1GFSA 2OP0A 1GDHA 1Z45A 2JAPA 3DFUA 1RM4A 3FR8A 4XDZA 1Q2XA 3OECA 2XXJA 1HLPA 1PR3A 1A4UA 2FPIA 5DULA 4NJMB 3MTJA 3K73O 4QQRA 2X22A 5J23A 3PLNA 1P44A 3RUFA 1Y5RA 1M76A 2BHLA 1GY8A 4YRDA 1S7CA 3NUGA 4B3IA 3PYLA 4K9DA 4RF4A 2DM6A 4NQZA 3VH3A 1A5ZA 1VL6A 2O3RA 2QW8A 3DBHA 3FHLA 3PGJA 2PZMA 4CMJA 3JQ7A 2AQKA 4J0FA 1D1TA 3ZWPA 3QVWA 5A4DA 2FZWA 1U3WA 3EYWA 5TT0A 2VNSA 3OIGA 3PZRA 3PGXA 4OQZA 4I08A 3HUDA 3OA0A 4DQUA 4P22A 3WQSB 4RVUA 1HE2A 2GN6A 1P9LA 1QMGA 4I9UA 1XQ6A 3PEFA 3HSKA 2AHRA 5BR7A 1UDAA 2O3SA 1IYZA 3D4PA 3O26A 3GNSA 4DREA 4E30A 4R54A 2GN4A 3DFZA 3U4CA 4F45A 2JCXA 4R5HA 2EW2A 3AU8A 5IDXA 1PS8A 3ONFA 4BNGA 1DB3A 4E5YA 3BTUA 1DJQA 1DIAA 3M1LA 4IDDA 4XD2A 3E1KA 5GY7A 5FI5A 2W2KA 4CM4B 5EL0A 1DFGA 2Y05A 3JV7A 1BW9B 3GZNB 3FI9A 2GDZA 5KKAA 1SOVA 2QRLA 2NVUA 3COSA 3D7LA 2DVMA 4M54A 3HG7A 3RJ9A 4FC6A 4MPDA 4L4XA 3GF4A 4GQAA 3PDJA 1ADBA 1E3SA 1VPDA 4WEQA 2O4CA 3BAZA 1NP3A 4NK5A 5BNIA 4BNVA 3RUDA 5FYDA 4A0SA 5L51A 4I8XA 1WDKA 3QP9A 1U7HA 4NBWA 4XIJA 4FSHA 2PKRA 3I52A 4FFLA 3Q6IA 2OUIA 2WD7B 5AOVA 4ZGWA 4CR7A 1LRJA 4UVEA 2X8LA 1ENPA 4XYGA 2HMSA 4DQVA 3FPCA 3ZN2A 3ZH2A 1PR9A 3R6DA 4J49A 2X7HA 1B7GO 3QWBA 3QY9A 2GERA 4R1TA 5L7YA 4C4OA 2YDYA 2Y1CA 4BNUA 3HQ4O 1MC5A 1WMAA 1C1XB 4IS2A 3QWAA 1W8DA 4X54A 4II2A 4DIOA 5JE8A 1IPEA 2FP4A 3GOHA 3Q11A 4M49A 4MVJI 3TOZA 5DCWA 3H8VA 2B37A 1DIHA 4L4SA 1ONNA 5BSEA 4FOOA 2VYVA 3TZCA 4O6VA 2PV7A 4TRRA 4AJPA 3GRPA 3BMNA 3MJEA 1RPNA 2PNFA 5AXCA 5TC4A 1E92A 1ZK0A 2Y99A 3LF1A 2YDXA 4IDEA 4WCFB 1E0DA 5F5NA 4CM1A 3X2FA 4BO8A 1I2CA 5B4VA 2GN8A 3W6UA 2ZYAA 1WVGA 1WW8A 3I83A 8ADHA 1GYRA 1JTVA 4J4TA 1VLLA 4AJ1A 3ASUA 2IZ0A 1JWAB 4FR5A 2PR2A 1Z75A 2G17A 1PSDA 3QV1A 2XAAA 1E3WA 4R68A 3NRCA 3DBRB 3D5TA 3AUAA 2YQ4A 1CIVA 2V6FA 1PZEA 3OF2A 4GWKA 4AJJA 5KJ6A 4EEXA 1YBVA 5FWNA 3ZNQA 3ZCXA 2VUUA 4DPLA 3GEDA 1T2CA 2D0IA 4JBGA 4NPCA 1EBUA 2VUSA 1XLTA 3U4HA 2NTNA 4U6QA 5CDYA 1VI2A 1FDTA 2PZJA 1U7TA 4IZIA 1F8GA 5AQ1A 3DZIA 3LVFO 4HP8A 4KTVE 3MJ4A 4ZRMA 3LK7A 3G1TA 4CM8A 4MIYA 3F4LA 5H83A 4E2YA 4FFNA 2P4QA 4HUJA 1K5HA 3ASVA 1I5RA 1LSSA 3JD2A 2WDZA 4WOKA 1I3LA 3GVXA 3O8QB 4BV8A 3ORFA 3JQAA 4GVLA 1NPDA 1WDLA 3ZNOA 1W0CA 2DAPA 1R66A 1UZLA 1OMOA 5HTOA 4D7AA 2FHSA 2CDAA 1NR7A 1UDBA 3GNQA 4XYBA 3UAGA 2CFCA 2OXIA 1XIVA 2E48A 1SEVA 1T2EA 3BMCA 1GUZA 3GUYA 5KCZA 1VJ0A 2X4GA 2GR9A 4LVCA 5L4SA 2YHUA 4DXHA 2QHXA 4GX2A 3L6EA 1VRWA 3VHRA 3GPIA 2P91A 3KYBA 2VN8A 2AEMA 2V6BA 3RBXA 4D46A 3LC1O 4WK6A 3T4EA 3HDYA 2X0JA 1LSUA 3PWSA 4WOJA 3OFSA 3DTTA 2P5UA 3H9EO 2EKPA 3ZZNA 3ICCA 4GAEA 4MDHA 4BO7A 2W8ZA 4CMHA 1YVEI 3CMCO 3GK3A 3QVSA 4HY3A 2ZK7A 4FGSA 3DONA 3IP3A 3QJ5A 3VH2A 2HMVA 2B4RO 3BMOA 4BNZA 4P4NA 5GZ3A 4FQ8A 2EW8A 3A14A 3PDUA 4YAEA 3AW9A 2HJRA 2BFMA 4RDHA 1TXGA 4MVJP 3ZV5A 4A10A 3PIDA 3K5PA 3KV3O 4W82A 1N9GB 3T7EA 3BMQB 4A7PA 4YJHB 2WE7A 5FF9A 4P38A 3AY6A 3PWKA 3UF0A 3W8DA 4AVYA 1W73A 2I67A 4E0BA 4ALNA 2Q1TA 3WGTA 1YJ8A 3WOHA 2QZ9A 1KVUA 5EN4A 4MINA 3I9OA 2HKIA 1XYGA 3U3XA 3GHYA 1I2BA 4Q3EA 3EZLA 1X0XA 1HZZA 2QZZA 3F1KA 2AMFA 4E5MA 2WYWA 3GDOA 3WDSA 4BO5A 4J1QA 2HO5A 2EKLA 4E21A 2DUUA 3ZV3A 3ZWVA 3B1KA 1IZ9A 3GC6A 1E6EA 1SB8A 3NGLA 4TKLA 3G1UA 3ETDA 4IBOA 2NVWA 5JO0A 3DXFA 1Q0QA 3GEGA 1B26A 5U9CA 5T67A 2ZCVA 4BNWA 1HDRA 1BMDA 1YB4A 3U09A 2E4AA 2VUTA 1UP4A 1O8CA 3KEQA 3QE3A 1F8FA 1UUFA 3FNFA 4D42A 5DDIP 4DLBA 4EJ0A 1D1SA 4BO6A 5G2OA 4ZD6A 3PQDA 4O63O 4YRAA 2PD4A 1H6AA 3AI1A 3QW2A 3OJFA 5HRUA 5F1KA 4J1TA 4NBRA 3I9MA 2V7PA 2CVZA 3OEWA 1SOWA 1UXKA 2C7GA 3FBTA 3SEFA 3C8MA 2JFHA 3W6ZA 2H9IA 5KWEA 4AJIA 3IUSA 4XR4A 5G0WA 1PJQA 1DC3A 4J91A 2JCVA 1DO8A 2OBYA 5BT9A 1U8XX 4EEZA 1NQOA 5F3RA 1H2BA 5COBA 2Q99A 2EF1A 2C54A 4S1VA 5C7LO 3BXXA 3CH6A 3CXRA 1H0KA 4MVJF 1F0YA 2EP7A 3ITDA 4RPHA 3RU7A 3EMKA 2JFFA 4NIMA 3IKTA 1YGYA 2G5CA 1NQAO 3NV9A 3IKVA 2UAGA 4BGEA 2X58A 4QEDA 5EERA 3X2EA 3AOEA 3A9WA 1D3AA 1KY5A 1MFPA 2B0JA 1BGVA 2JHGA 1JN0A 1LLQA 3NDJA 4J4BA 3B20A 1ZJZA 3QA9A 2VYVD 4E31A 3H65A 3W8FA 1NFQA 1M66A 2X9GA 4CMIB 1YE3A 1QYWA 2NU6A 5MGBA 3VPHA 4UEKA 3DEYX 2X9NA 1PGJA 1VC2A 1KVRA 3GVIA 5I7VA 2HCTA 3MEQA 3GT0A 1VSVA 1EMDA 4IIUA 3KOUA 4XJSA 4J7XA 1K6IA 1U4OA 3NDRA 3NGXA 4AJOA 4KMSA 3MJVA 1AXEA 3DHNA 5T64A 4HFNA 3JQFA 1PS9A 3C1TA 2VTDA 4UUOA 3V1UA 5T5QA 4CLRB 4DC0A 5JO9A 1B8VA 4Y67A 4BKQA 1DFIA 1IUKA 3LT2A 3ZWXA 3BIOA 1ZCJA 3EVTA 4WEOA 5JAZA 1BG6A 4CUZA 2Q46A 4JGBA 1LQTA 4ND1A 3SJ7A 3WIEA 3AWDA 1N1GA 4E12A 3OIFA 1XEAA 4MKXA 1X15A 5AVOA 1KEVA 2CVQA 3DMTA 3HDJA 5JMWA 1DIGA 1NFFA 2CZCA 5TQVA 3K2BA 1QYCA 1EDOA 3GG2A 5CG1A 1Y81A 3WSWA 3KSUA 2B5VA 4DTIA 2BLLA 5JAIA 4LK3A 1K6JA 3FR7A 3DOJA 3O9ZA 4F46A 4LRSB 4OH1A 4R5MA 3DZBA 5F21A 1JLLA 1NX6A 2RH4A 3UH1A 3I4FA 3H3JA 4FFRA 4ALKA 3G0OA 1U3VA 2R6JA 4BNTA 4E6PA 2PTGA 4AICA 3JQAD 1LDMA 4R69A 3RFVA 5DP2A 2ZQYA 2VHVA 3LT0A 1ZMOA 3EZYA 1JWBB 1ZZEA 2FR0A 3HDHA 3DOCA 2EGHA 2W2KB 3DO5A 4FPXA 4MOWA 1YOVA 1DOHA 3ZDFA 2IEBA 4MO2A 4E5NA 2PZKA 2FPGA 4L0QA 1X1EA 3TJRA 4E13A 2WEKA 1C1DA 1QKIA 1HRDA 2NVUB 4BV9A 9LDBA 4DA9A 3GDFA 3GVCA 3FCOA 2C82A 2YV3A 1FDWA 1XR3A 1HE4A 4YACA 4I9HA 1XCBA 4YJFB 3JYLA 1G6KA 1E1KA 2HAEA 3PK0A 4AJ4A 4CLOA 1E5QA 3Q0EA 2NV6A 4DWVA 4EI2A 4Z9FA 1FDVA 2JFGA 5CDUA 4ZN6A 4MVJA 4Q3NA 3BTSA 4GI2A 4OOFA 5T8KC 1C0KA 1VJ1A 3W4JA 3E8XA 2OZPA 4CMEC 4Z0TA 1EQUA 5TF4A 4P8RA 2P9CA 5ER6A 4PLTA 5IZCA 1PGPA 3INRA 3GAFA 5L40A 3WTCA 3MWDB 3F5QA 4UEJA 2EHDA 4YCAA 4TSKA 2HRBA 3PHLA 4YRBA 3KB6A 1X14A 5I9MA 5G0TA 3TF5A 4PG6A 2UDPA 4TROA 2PKQO 1WP4A 3B1FA 4E2XA 1SNYA 1T2AA 1CEQA 3TOXA 1GEGA 2W4QA 1P1RA 1PJ4A 3T7CA 3V2GA 4CLEA 2WYVA 4CM3A 1Q7BA 1E7SA 1JW9B 1U28A 3TFOA 3WMWA 1R0SA 2I3GA 2Q2QA 3BMNB 4KDEA 4OSPA 1O9BA 4OO3A 4ND4A 2B69A 1OC2A 3JQFC 4QTZA 5GZ6A 2WD8A 1BXKA 1NTOA 1A7AA 2PLAA 1I33A 4NHEA 1CWUA 2OMEA 1T4BA 1MA0A 3QVTA 4BMNA 2Y0EA 3TSCA 2DPGA 2BH9A 4OAQA 1I24A 3VH4A 3UOGA 7ADHA 5JNLA 1NASA 2XXBA 5AXDA 1GPJA 5EIOA 1IE3A 5A3VA 4L8VA 4CLDA 5MDHA 1BVRA 3DMTC 4W7IA 3BA1A 4PLVA 3V8BA 1E3WB 2F00A 4YJDA 4KZPA 1E7MA 1KEWA 3I3OA 2GYYA 1BSVA 1FK8A 3CMMA 1KIFA 4ILKA 4LRTB 4W9NC 2FOIA 4WECA 5TS3A 1EFLA 1MP0A 2OOSA 3DB2A 1YKFA 4RVHA 5KKCA 2GNAA 2HK7A 4CLHA 4GLLA 4Q3AA 3TZHA 2Q2VA 1MXFA 4ZA2A 4YT4A 4KQWA 2X9VA 5ES3A 4CM8B 1DLJA 3WICA 3JQBA 3LSYA 2Z1MA 4BB6A 1XWFA 3P2OA 3PPIA 5ILOA 1BXGA 1SMKA 3GDGA 1EEHA 1PZFA 1K3TA 5BNFA 1WNTA 3TL3A 1XG5A 4DL9A 3JD3A 1Y6JA 1HT0A 3O38A 2QIOA 5F5LA 2VQ3A 2QRJA 3JQAB 4KUEA 2CUKA 2GCGA 3S55A 1KC3A 1P0FA 3S8MA 2I3AA 2IODA 1GADO 1WWKA 5T57A 4D0SA 3UVEA 2QYTA 3PFWO 5KJ1A 1WDMA 2AE1A 3OETA 3L6OO 1VM6A 5IN5A 2NADA 4ZICA 4B3JA 3HZZA 1QSGA 1GQQA 2HK9A 2DLDA 3QLJA 3IS3A 2FMUA 4PG4A 3GFGA 1DC5A 1IB6A 1R12A 4HADA 2NSDA 2OL4A 2B83A 2P9GA 1B8UA 4G65A 3RUEA 4QECA 3WX0A 1V35A 2QRKA 3GY0A 3I23A 3SVTA 2DBVO 3U62A 3ZWOA 4Z0HO 1D7OA 1GUYA 3PQEA 1YL5A 3H9QA 2Q1WA 3HFGA 1ADFA 1ZO8A 5AYVA 4Z3DA 1HF3A 2OFPA 4RCVA 1QYDA 1ZXBA 4I5GA 5IZCC 1QXSA 3IIEA 5I8WA 3F47A 4HNHA 1GR0A 2GD1O 2AEJA 4Q3DA 1ORRA 4N54A 4Z3KA 1I3MA 1UXIA 4BO0A 4NG5A 5A03A 4MVJG 1K89A 4R41A 2JAHA 4OGWA 2A35A 2B4TO 2J5QA 4WJZA 1ZW1A 3UCXA 2J5RA 3VDQA 1YBMA 4XJTA 5EMHA 4BNXA 3NT5A 4R9RA 1GV1A 4IGFA 1ZIDA 5ADHA 2CY0A 3HDQA 5L45A 2AXQA 1N92A 4OKIA 3MOGA 1NPTO 4BO4A 1I3NA 3WYBA 4CR6A 4RJTA 5LC1A 4WLFA 3GLQA 3B1JA 2PGJA 3HE3A 4EDFA 1I0ZA 1B0AA 4LISA 2H5LA 3ZHXA 4PFJA 3GQVA 3U4IA 3FNHA 4YVFA 2BFAA 3GR6A 1JAXA 2DQ4A 2PKQP 3ANLA 1MC4A 1YXMA 2C7VA 3GZ4A 4ITUA 4RVGA 3C1OA 1YB5A 3I4CA 3BTOA 1XDWA 4PVDA 4Q39A 4ZHSA 2O50A 2DFDA 4ALJA 5C7IO 2CDBA 2IRWA 3A28A 4MVJH 1SBYA 2Y66A 5JC8A 1LDNA 3SBOA 4YEDA 1JKFA 4XA8A 1NHGA 2P9EA 2VT2A 4HXYA 4BGVA 4D3DA 1N5DA 2CDCA 1ARZA 3JQ9A 1A9ZA 3Q9UA 1C0PA 5JY1A 3CEAA 5I9LA 1EVIA 3OJLA 4CQMD 1UZNA 4EYEA 1GCUA 4IQ8A 1QR6A 1XU9A 2Q4BA 1YONA 3ENKA 1LU9A 4MVJE 4A03A 4OQYA 3JQBC 3NDIA 4UUPA 3BZUA 4UULA 3NYWA 5I7FA 3ZV6A 1H9BA 1P33A 1YRLA 2XOXA 4QSMA 1LI4A 3NJ4A 4MVJD 4R4JA 4XQGA 5HWSA 4KUHA 1V8BA 4H7PA 4YT2A 4Y6SA 2OO5A 5JCXA 3M2PA 1TEHA 4A73A 3RQSA 5THKA 4GX5A 3ZNNA 3D3EA 4UUNA 1TT5A 2J6IA 3JTMA 2EJVA 4OXYA 3ROQA 2DTXA 4QFCA 3U4DA 3TNLA 5BQFA 3OSUA 3KYDA 4FFMA 2Y1GA 1YDEA 3BHMA 1JQBA 5TJ9A 1U3UA 3FNGA 5C5IA 1OFGA 5ITWA 5EESA 1DHTA 2ZB7A 1EK6A 3DBVO 2P2SA 1P3DA 2FR8A 3G17A 3ZI0A 1R4NA 3H6KA 4NK4A 3ETEA 2NACA 1QRRA 3H2SA 4W7HA 1NHWA 1P1JA 3PJDA 4WGGA 1RYEA 3LT4A 4WLNA 1E7YA 2Z95A 3M6IA 2GLXA 3JQ8B 3WIDA 4C7JA 2RCYA 2X5KO 4Y98A 1HDZA 2YQ5A 1PX0A 3VDRA 1P31A 3DZFA 3IC5A 4CV3A 1DSSG 1Q0HA 2Q4EA 3ONEA 2AQHA 2QG4A 1VKOA 3QWIA 5A9SB 4BQPA 4QUKA 4ZVVA 1GZ4A 3H4VA 3PVZA 3K96A 1P0CA 4II3A 4L75A 3D3WA 1NNUA 4IJUA 4JP3A 1HETA 1P74A 1W6UA 2RHCA 4JCOA 1DRUA 3KEOA 4WKGA 1UJMA 4F3YA 3EW7A 1SB9A 1VJTA 4OKNA 4RPKA 4EBFA 1GPDG 1UAGA 1LTHR 3DHEA 5IG2A 3RVDA 4YAIA 4LW8A 2B5WA 2VZ0A 4CQLA 1L7EA 2X5OA 3SLKA 3SC6A 1LRLA 2RHRA 4WASA 4RGBA 1DRWA 3CZRA 5L4NA 1P77A 4NI5A 2BGLA 1PL6A 3TN7A 3ZHZA 1VSUA 2Q49A 4BNLA 4O1MA 4G81A 3LF2A 4R3NA 4ZU3A 2NU8A 1IPFA 4H16A 3A1NA 2D1YA 1Y7TA 3CPSA 3RWBA 1Y8RA 3L07A 4E5PA 3PZBA 4AJEA 3K31A 1U4SA 2YFHA 1X1TA 3G49A 4IIVA 3S2GA 3UICA 3VZPA 1U8FO 2AQ8A 2C07A 5G4KA 5I9NA 1E1LA 3EY4A 1EZ4A 2HK8A 2XPCA 5CP8A 2VWGA 5A9TA 3KETA 1ZK3A 3JQ9C 2ZIZA 3NT2A 2AW5A 4N5NA 3QVXA 5BSFA 1E7QA 3ADOA 3IOYA 1DC4A 4N5MA 4R1UA 2WE8A 1PJCA 1PJLA 3FWNA 3DR3A 4LGVA 3WYCA 1LXCA 5JDIC 1YJQA 1R4MB 3GNTA 1TA4A 1C1DB 1IL0A 3I6IA 1RYDA 4D3SA 1PEDA 5THQA 3VC7A 3ENNA 4K26A 2NQTA 3GMSA 3I9LA 3KVOA 1DIBA 3W1VA 1ENOA 4IJKA 5JBIA 2CMDA 3DBLB 5JAMA 1AE1A 4IPTA 4YBZA 4J0EA 4BKRA 4BNNA 1GZ6A 3WTBA 4U5QA 3W8EA 1I36A 1QV7A 3OICA 3TL2A 5DOVA 1ENZA 2VZ8A 4NFSA 4UUMA 3CTMA 2ZCUA 5FI3A 1H93A 1DC6A 1D8AA 2E49A 3RC9A 1BHSA 1QYVA 1K2WA 3WWZA 5KVSA 3V2UA 1SAYA 1NR1A 4W4TA 1HEUA 3LYLA 2PH3A 1P1KA 3GUCA 4BNYA 4PRKA 5LDGA 1E3JA 1K6XA 3ROKA 3PLRA 1PZGA 2BI8A 1X7GA 1OC4A 4XKJA 1WAMA 5JMPA 3CKYA 3GFBA 3KLPX 1GTMA 3HN2A 2O7SA 2Y67A 3WBBA 3PXXA 4EZBA 1EBFA 4CPDA 3QWHA 5B4TA 5T6BA 3WNQA 4CM7A 1YBAA 1Y1PA 2IDZA 1ISGA 3QSGA 5L7WA 1P1FA 4QO7A 9LDTA 4I1IA 4CMBA 1E7RA 3LDHA 5IF3A 1HE5A 3LT1A 2AQIA 4LN1A 4IDCA 1X7HA 3SX2A 1AGNA 3UGKA 5BSGA 4RDIA 1CQJA 3L4BA 2QX7A 4PZDA 1ZVMA 1ISHA 1MLDA 3ZU3A 1QLHA 4Q3BA 1J49A 1LLDA 2VHZA 1HSZA 3UW3A 4DIBA 4OL9A 3PHHA 2WTBA 1KERA 4UREA 5JXWA 4FBGA 2LDXA 3RUHA 4J3FA 5DCUA 3T4XA 4CJXA 1KVSA 2LDBA 4NBUA 2GZ1A 1YQGA 4NJMA 3ZWCA 1LSOA 4FB5A 3ICPA 5CG2A 1RM0A 2BFPA 4K6CA 2GUGA 4K6FA 2IYOA 4PLWA 1PQPA 3OHSX 1YL6A 5IAAA 1O6ZA 4AJKA 2P68A 4RVSA 1J4AA 4XIYA 2GN9A 4NMHA 4PLGA 4EUFA 1WLYA 3WFIA 3OJ0A 3L9XA 4CM5A 5I7EA 3R1IA 5KJFA 2VYNA 5IDYA 5A5FA 2O3TA 3F5SA 2HQ1A 5A3JA 1LX6A 1BTOA 4J6FA 3ZWYA 2EGGA 4WPGA 4KWHA 3GHHA 3CINA 4R1NA 5CPFA 3QQPA 4PGFA 1VL8A 4JROA 4KOAA 3WMXA 3MCVA 2B36A 3CIFA 1HDOA 1PQUA 3JD1A 1YB1A 2FZEA 1ONPA 4UAGA 4W99A 4YAGA 4FS3A 1ISJA 5DCYA 4CMGA 1MG5A 4Z9XA 3RFTA 4JN6B 2TMGA 4O0LA 3RJ5A 3RIHA 3DOOA 3E18A 1PTJA 1QLJA 2HMWA 4PN3A 5L9AA 3GMDA 3EHEA 1A71A 5T8KA 2Q50A 3FTPA 4ALIA 3EK2A 4CMEA 4IS3A 2P5YA 3HFSA 3LLVA 5EINA 1JA9A 3K30A 4LMPA 3WQRA 1BXZA 1E1MA 1M75A 3ETGA 2Z1NA 2ZATA 3ABIA 2GO1A 2EXXA 4U8GA 2EG9A 4BO9A 3ZU2A 2HMTA 4CM9D 4ALLA 1DLIA 1H6DA 2GASA 2IXAA 4NU6A 4FC7A 3VPSA 5JSFA 4WUVA 3JQEA 1LC3A 2H6EA 2I6TA 3PYXA 3P19A 1Q7CA 4I5DA 5CHEA 5H81A 1DIRA 3WG9A 2DKNA 1TI7A 1NVTA 3MJCA 2Y1EA 1AXGA 3M2TA 2X6TA 2GZ2A 1YWGO 4QT0A 2YYYA 5HBRA 1CF2O 4BB5A 4OIMA 4PRLA 3AUSA 3K6JA 1HL3A 3KZVA 2GPTA 3FN4A 1Z6ZA 3E6AA 1EDZA 3AFMA 1E7WA 5JPIA 2DUWA 3K2EA 4HNGA 2NLOA 2PA3A 3DZHA 1MB4A 2EIHA 1FF9A 2RAFA 3G79A 4LSMA 4CM6A 4XRGA 1XKQA 4WCDA 4BGUA 1B8PA 2RIRA 4HWKA 3L4BC 4R51A 1PIWA 3NX4A 1J6UA 3DBHB 4A5OA 4KQXA 1U5CA 5C37A 2WYUA 3JQ7B 3ANNA 4M55A 3FRJA 2YFQA 6ADHA 3NEPX 2I9PA 4XQ9A 3EC7A 1GYPA 2A4KA 4W9NA 3I9JA 3E9NA 5A06A 1TLTA 5K6AC 5COQA 3F6YA 3AUUA 1AHHA 1NWCA 1CQIA 4IZHA 5GZ1A 2W98A 2AEFA 2X0RA 4FJ1A 3G3EA 1ML3A 2VWPA 3ITKA 4L4RA 1M6HA 3DBRA 7MDHA 4RF2A 1SCUA 3WLEA 3OM9A 1RJWA 4M87A 4GMFA 2ZTMA 3ZU5A 2YV1A 4U0KA 2TMDA 3H9JA 4PZEA 5ENVA 2C0CA 4IDAA 2HUNA 1EUDA 8LDHA 3WQQA 5C7OO 5FFFA 2FSSA 4RVFA 4YAKA 3F4BA 4ZQEA 3E5RA 1ZXLA 3PQFA 3GAZA 4J16A 2FSVA 2UUOA 3GEMA 4CR8A 3U5TA 1XA0A 4HFMA 4JXKA 4CQMA 4L76A 4D44A 1OBFO 4JJIA 2W90A 3AK4A 4DPKA 1KS9A 3C1AA 3QHAA 1LRKA 5DBIA 1HDGO 4YB8A 3DDNA 4GSLA 3HN7A 4DBZA 3Q1LA 1P1HA 4JNKA 3WSVA 4R16A 1O95A 4Z6KA 2HLPA 2H63A 4GGOA 4B7XA 1LQUA 5ICSA 4AJ2A 4IDFA 1PWXA 4RORA 3WBFA 3ZWWA 1DHRA 1E1NA 3BHIA 1O0SA 4R9SA 2DC1A 3KTDA 3NT4A 1IULA 3BTVA 4JP2A 3H3FA 5G0VA 2GGSA 2A9FA 4NH4A 4B4VA 1B15A 2PD3A 3OJOA 2NTVA 1I01A 4Q9NA 2I99A 3Q3CA 2CD9A 3UHAA 2I5PO 2ZTLA 2DTEA 3AJRA 1DBVO 4UVGA 5K9ZA 2WWRA 1F17A 5CEEA 2C5EA 4LSWA 3GG9A 3LLSA 5CEFA 2GSDA 3GPDG 4PIVA 1TT7A 2YHIA 3HNPA 4B8ZA 3FNEA 4FCCA 4U0JA 3CUKA 1WZEA 1PU2A 3A06A 1MV8A 1V6AA 4YJGA 1X0VA 3UN1A 3FSRA 5KVQA 3WJAA 5G0UA 1ISIA 1AN9A 3R0IA 3LZ6A 5IXSA 1E3EA 4TRJA 3B70A 4PLCA 4DYDA 3RD5A 2X5JO 3RC2A 2Y68A 1GQ2A 1VE9A 2BF7A 4AJHA 1EE2A 3BMQA 1T25A 1LDEA 3QIVA 4YTEA 1GU7A 1I3KA 1KC1A 2NNLD 2NU9A 4NNJA 1NBOA 5A02A 4DBVO 1UH5A 2VYND 4GSKA 4CQLB 4B4OA 3WS7A 2OORA 3W4KA 4YAJA 3WWYA 4NZ9A 4FJ2A 2HSDA 2VCYA 2YW9A 5AXAA 4N5LA 4NFHA 2FPPA 3Q9NA 4L74A 3PI7A 1B16A 1YH3A 4DMMA 3P7MA 2VT3A 5KVCA 1N7HA 2DPHA 4WCFC 2NWQA 2JD0A 2Y0DA 4G2NA 2I65A 2GF2A 4ND2A 1W4ZA 3VPGA 1HDYA 4EW6A 5JDCA 3K9QO 1E77A 1QORA 3QWFA 1SPXA 4BKPA 5G0SA 5B1YA 4DYVA 5G4KB 2D5CA 1HSOA 1GAEO 3ZWBA 4YQZA 3K92A 1ENYA 1ULSA 4IM7A 4NBVA 1GEEA 4XYLA 4PLZA 4RPJA 2X23A 5AXBA 3H7AA 3ZWNA 1KEUA 2PGDA 3FD8A 3KXDA 4J2OA 4ROSA 4F6LA 3FF4A 3KYCA 1YO6A 3DWFA 3D1LA 4MP6A 4TZKA 4D41A 4IXWA 2Q1SA 4I9NA 4LCJA 5G4LA 1MFZA 4NBTA 3D4OA 3TDKA 2PY6A 1M67A 3U0BA 5K0ZA 3R3SA 3ADPA 2OBNA 1DDOA 5CEJA 3ZV4A 2A94A 2B4QA 3BMCB 1BWSA 1V3UA 4PLFA 1I2ZA 3S2IA 3KO8A 1DAPA 1EVZA 1HE3A 3OA2A 4HBGA 1ONOA 1YQDA 4TWRA 5DP1A 3U49A 4BNFA 3I9KA 4IDGA 2O2SA 1T1SA 2ZKLA 4GKVA 3JQDA 4IQGA 5JY6A 1UP7A 4A27A 3I6QA 1LA2A 1UZMA 2G1UA 3HB4X 4ZJUA 1O5IA 4B3HA 1Y9EA 4GMGA 4KP7A 4HX5A 4BS9A 1RM5A 4QO8A 5HM8A 2Z5LA 4UVHA 3KLMX 3AY7A 5KVVA 3R3JA 3EUWA 2JKVA 3FWZA 3BMOB 3H9UA 1Q1NA 3KBOA 5TT1A 1LDBA 3E82A 3I5MA 4M89A 2AA3A 2J3IA 4GWGA 2BI7A 2PWZA 2UVDA 3GVHA 4TQGA 3KSZO 3OP4A 3ZHYA 1PJ3A 1RWBA 4DPMA 2DBQA 1PGNA 5KNLA 4D43A 4CMIA 3MJTA 1JAYA 3IQDB 5KJCA 4A26A 1JU9A 2Y1OA 4GVXA 1XHLA 5TGDA 4GH5A 2GRAA 4RQTA 1YL7A 1ZJYA 3WGHA 4UEOA 3H5RA 2NU7A 3WLFA 2O7QA 2YZ7A 1NQ5A 4EUEA 3E5MA 3A4VA 1F14A 4OOEA 4XZ3A 4CUKA 1A4IA 5L7TA 4XEHA 1DRVA 2O2YA 5ITVA 4DC1A 4CLRA 1Q0LA 1WXDA 1HDXA 1V9LA 1GYQA 1X13A 3C85A 4XWYA 4DLLA 3GVPA 4HFJA 3OQ1A 4IJWA 5U1PA 3H5NA 3WGIA 3CE6A 1IY8A 4O59O 3RUAA 1T4DA 2O3UA 2IE0A 4YPOA 5ENDA 2UV8A 4J2HA 1I8TA 2HRZA 1U2DA 4BO2A 4GKBA 4URFA 1EUZA 3S1LA 5TLSA 1MUUA 1E3IA 2VNAA 2H1SA 2O3QA 1J0XO 4OHUA 4IY1A 1H6BA 4L9RA 3VKVA 3GGGA 4AFNA 4UVIA 5DOZA 2VRCD 1RKXA 2ZB3A 1PZHA 3RI3A 4AL4A 4IINA 1ID1A 1Y9AA 1KOLA 5JDIA 1LJ8A 5JDCC 3AI2A 1DXYA 2A92A 1F12A 2ET6A 3H9GA 3RFXA 1NQTA 1C3VA 1XSEA 2O4UX 1ZBQA 2NM0A 4XYEA 4XGKA 2QQ5A 4HKTA 2VOJA 4ZQBA 2OGUA 5CDTA 3ZW9A 3L9WA 5A1TA 3PTZA 4W6ZA 2D3TA 3V1TC 4BOYA 3KHUA 4IXTA 3OQBA 2HU2A 3TPCA 5C3MA 3JD4A 2UYYA 3KRTA 4FFPA 3U9LA 3W4IA 5CDGA 5IZ4A 4CMAA 4B79A 3JCZA 4YXFA 3ZW8A 1HYGA 4BNHA 4RZIA 3DTYA 2BFOA 4FIZA 5TNXA 5CDSA 5B4UA 1I30A 2J5KA 3DC2A 3VZRA 5DN9A 1KETA 2YY7A 4FW8A 2ZTUA 3UXYA 4YJFA 5TSDA 1C14A 3RSHA 4P4GA 2EEZA 1PL7A 2EKQA 3F3SA 1EFKA 4RO0A 5TJHA 4DLAA 4DUPA 1PGQA 4P4LA 2C5AA 2PZLA 3OMLA 3VZSA 4BL5A 4BMSA 1R0LA 2E6UX 2Y0CA 3JYOA 3RUIA 2I66A 2C2XA 3KM0A 2VHXA 1PJSA 3RAJA 4K28A 4J1SA 4S3MA 4CM9A 1NXQA 1JKJA 1HLDA 3SXPA 1FDUA 1H2HA 3ZGYA 3GGOA 1O94A 3AM4A 1ZSNA 1OZAA 2AG5A 1OAAA 1V3VA 1ZFNA 3VZQA 5JYDA 1IOLA 4LMRA 1E6UA 3VVCA 4BMVA 4RQUA 4DVJA 1PJBA 2BGMA 4E2WA 4RLSA 5L4LA 1HTBA 5JC1A 4IJVA 2F1KA 3I1JA 3L6DA 4ND5A 3PHIA 1I32A 3H5AA 3JYQA 2BMAA 3OBBA 4YR9A 1CDOA 2EV9A 2FRDA 3VVBA 3NJ8A 1T2DA 1E3LA 4XR9A 2DFVA 2E82A 3WGQA 3GGPA 4B7CA 4GPD1 4BKUA 1ISMA 1LBEA 2BGKA 4B8WA 1ZK1A 5KIAA 1E6WA 4H3VA 1SZJG 4TRNA 1LUAA 1KY4A 5L95A 1DAOA 2C59A 4XDYA 2B35A 3AUTA 2Y1DA 1LLUA 1B3RA 3AI3A 1R16A 1HDCA 1NVGA 4RPGA 1PQWA 5JFOA 1H6CA 2Y1FA 3PFFA 4J4HA 2VHYA 3DQPA 3UUWA 3K8ZA 4XRRA 4D3FA 4DGSA 5EJ2A 3IJPA 3RU9A 4YA6A 4JQCA 4CODB 1UXGA 5HA5A 3RKUA 4BO3A 3INGA 5FEUA 5IXYA 1YOVB 4XX0A 5IN4A 3DAGA 1NYTA 2J3KA 1ZH8A 1K0UA 3JQGA 5I8ZA 4CV2A 4E32A 3NKLA 3LU1A 2WMDA 1PL8A 4DMLA 1NFRA 3H2ZA 3ON5A 1EUCA 3GH3A 4J7UA 2D2IA 3WGGA 4ZQFA 3UCFA 3IMFA 1HKUA 1I10A 4CQMB 4F6CA 3D4NA 1DPGA 5H82A 1LDGA 3IUPA 4IMPA 4OMUA 4BVAA 5KJEA 3DZKA 1QYXA 5TRTA 3TQHA 3VAZA 4CLOB 4OXKA 1OOEA 2AG8A 4N18A 3NTOA 5U4QA 4CL8A 5JW6A 2V6GA 1HWYA 1EQ2A 3B6ZA 2O48X 3DZGA 3PWZA 5DNAA 4CMKA 2C29D 4QX6A 1Y8QA 1M2WA 3N74A 5LCXA 4K1LA 3VKUA 1Z73A 5ILGA 4PG8A 2IEDA 4PG7A 4RF5A 2VHWA 2YV2A 1L1FA 5IDWA 3KSDO 1MG0A 2NQ8A 3DAFA 2JHFA 1G0OA 1H94A 2Q1UA 2G76A 2FR1A 2YUTA 1CJCA 4RF3A 1NPYA 1S6YA 2O23A 4BNJA 2G0TA 1ADCA 4R1SA 4BKOA 1PWZA 1ZUD1 3UKOA 1CETA 1EE9A 3V5NA 3STHA 1N7GA 5ER9A 3WNVA 4M8SA 3F46A 2YJZA 4R3WA 4QFDA 3V1YA 4QXMA 2YHIB 4TVOA 3JSAA 1T2FA 2ZYDA 1KEPA 3MZ0A 4GX0A 2IZ1A
chains in the Genus database with same CATH superfamily
5CJ2A 4IDUA 2ZQZA 3N8DA 1BN6A 3AEQA 4YJGB 3Q5DA 4UHFA 3RF7A 1Z28A 1E69A 4EFKA 2ZYSA 5C31A 5KYXB 2RE8A 4PZCA 4C7VA 1E5TA 2WF9A 1VJ5A 2A1TR 2A5DA 2C9YA 3F49S 3CEPB 3G2HA 5HHTA 3FH0A 4U2CA 4C1BA 4GXTA 2V74B 1SO8A 2DQSA 4ASUA 2HNKA 3JVEA 4YQYA 3DAPA 1J5PA 4XOUA 4IH1A 3PX2A 5EQFA 5M2QA 1Y1TA 2NMVA 2DBRA 1MR3F 4NL4H 3S2ZA 1SVWA 4JVOA 2PL9A 4RACA 3PEVA 1WE2A 3SQMA 1QG6A 4IDNA 4WCVA 2CJYA 4ZI7F 1XPUA 2Q9UA 4C7KA 4UPVA 5HP4A 4D0RA 1JR3A 4N40A 2QOEA 1QUFA 5ALXA 5EJMA 4PGHA 1EU1A 1NF2A 1PS0A 1DS6A 4OGLA 1T9KA 5DZSA 1IXRC 1Q74A 2CL7X 3EIFA 4EITA 3ZXIA 5BN4A 4YCSA 1YQXA 2RH9B 2Y6VA 4O5OA 3UKJA 1KQNA 1RE0A 3WP0A 4F04A 3Q2IA 1A8SA 2XF2A 2YY5A 5JSZA 4FWTA 5JLAA 5LU9A 1A72A 4ZO9A 3V00A 4BN5A 2G9ZA 4JYBA 1YIAA 5JLJA 2D5IA 3Q85A 3OU6A 1G2OA 1EA7A 4IQ0A 3BXFA 4KIJA 4LNUB 4BASA 1QX3A 4HDSB 3BRWD 1T0IA 2PANA 1FYEA 3GJSA 1LC0A 1VB3A 2EC5A 4OXNA 2SCUA 2AL7A 4J75A 2QJOA 3SJUA 1TTPB 1JJ7A 4O4HF 3KYCB 4ZT5A 4KN6A 2M6LA 1YAHA 1PFWA 1GPNA 2DBZA 2HXGA 4RMJA 5DBGA 3VR2A 2F48A 5FFMA 1IZ0A 1ZGAA 1E58A 1X1DA 4FMDB 4MPJA 5B3KA 2GPNA 4FYMA 3WLIA 1J99A 2BELA 1UMBB 2DJ5A 5HCNA 3S2EA 2NVBA 2CSUA 2V6MA 1Q7TA 2N47A 4WLVA 1WUTA 1P45A 1G17A 2CNNA 3WLPA 4H7HA 2QV7A 2A7QA 3OKCA 2V7UA 4IP0A 4UARA 2AFHA 3C5HA 2AOXA 3G7UA 1FQJA 3HUFA 1G5HA 4TMTA 1Z36A 1XZLA 4ESOA 1KAQA 1G8GA 4WNCA 4Y2YA 4B6PA 4WLUA 2IH2A 2AG6A 1CDZA 2HNAA 1ECJA 3ECAA 3O95A 3PXDA 3WWOA 2YIVX 4POOA 4CGZA 4N7RA 4UHHA 1N3YA 2REBA 4UEQA 3ZLUA 1O7JA 4O08A 3Q2OA 3AJAA 3PDWA 1JIXA 2R60A 4N0PA 3REQA 2WIFA 3FYUC 4J7CA 2YX1A 3H9BA 5BN1A 5J4KA 3QRWA 2NYVA 2WTNA 1VE7A 2I1QA 1MAAA 1QC5B 3IVAA 2AJDA 4EO4A 2DU8A 1SOUA 4MV6A 1T35A 3DF7A 1VMIA 3GB9A 4AY2A 1NA5A 4ERXA 4JS0A 3RT7A 1OZGA 3RASA 3AFIA 3JQ6A 3T7JA 1H65A 2BBOA 3HP1A 4CU5A 4HBZA 3E9CA 1OW3B 5DASA 1NIJA 2C4WA 5HQ3A 1R88A 1SG6A 3DL0A 5JNWA 3BYZA 4JLNA 2JRLA 4BFSA 2NO1A 3AH8A 2VXCA 1MQSA 3HADA 4L73A 2A0YA 2PS9A 2ORED 3DAHA 1AUOA 1E2PA 5DTEA 3BWYA 3DLHA 2V7XA 1JHPA 1XU4A 1YBHA 2H4YA 2ZI9A 3LUBA 3QLVA 3HCDA 4HAOA 5ALZA 4IV8A 3L6UA 5JJCA 3PUIA 1X1RA 3OX2A 4RSHA 3C7KA 2CXTA 5A9SA 1N6NA 2YNMA 3OCVA 2QGFA 1HOTA 4A2CA 2FSGA 1F8YA 3L8FA 1NM5A 4MW7A 5AICA 4EUHA 1XCGB 3LP8A 3A4NA 4P93A 3UHFA 4D56A 4RVOA 3HB1A 2O0KA 3QBDA 3RCBA 4DRYA 4WCFA 1B8NA 4M83A 5B1SA 1S3SA 5A4JA 1U2TA 1FMFA 3WLRA 3GH1A 4YV1A 4IMIB 4CF4A 2HBYA 4NLLA 3IP5A 4NCNA 1UK9A 2UZ0A 1LV7A 3PX3A 4E2ZA 4NJOA 3P4YA 3TB6A 1PW7A 3CW2A 3ZGLA 3G68A 4B32A 3FRHA 3EYAA 3TZKA 2PJDA 3R7BA 4L9WA 1UDCA 5FD8A 5I8PA 4RD3A 4CL3A 1HQKA 3O8OA 2WF8A 2CF6A 1QHHA 4XVHA 1CHNA 2H11A 2UZ1B 2XB6A 1EDDA 5EQJB 1M8KA 5AOCA 2ECKA 3D3KA 4URHA 1CRPA 2JCYA 4LBVA 2R8YA 2B25A 1BRMA 1S2LA 2RGNA 1D6SA 4IIDA 4KVGA 3TWOA 3PD7A 3UCEA 3VTZA 4Q4HA 2WHEA 3L7LA 3NETA 4YMVA 1BDBA 4JXJA 4DSTA 1NC3A 3KT0A 4FR0A 4GM1A 2A88A 3CVXA 3DV0B 3KEFA 2QQ0A 2ZTVA 3QEMA 1IUPA 5ALWA 1JG3A 3NKFA 3ZGOA 2VRCA 4ZP1A 1IN8A 3FYTA 3OU2A 2YFYA 2BFCA 2QW0X 3WXBA 1CFJA 4OEHA 2IV2X 1GRQA 4H15A 3QVJA 4BBZA 1L5WA 1ZQ9A 4EM6A 2B0CA 3RTDA 4DRXB 5JROA 1E0SA 2JEZA 2VP6A 3U7JA 1DAGA 3ROPA 1G0NA 1L5YA 3A3PA 1CRWG 1K3UB 3QV2A 3LC2O 1ZCFA 4L8WB 4X9XA 1UAYA 4XWTA 3ZTWA 4I9GA 2PMDA 1G6Q1 1E60A 2XOKA 1HFJA 1FSZA 3GFQA 4PTZA 3UJ9A 3RVOA 1I4LD 1I4EB 4YRZA 2DERA 1R4MA 1V25A 5IDVA 5D84A 1SG0A 2V9CA 2QLBA 5J40A 5KYUB 1G7SA 1T2UA 2OQRA 5JRJA 5DTRA 2FJ0A 1D4ZA 1CY8A 4LQDA 5I7SA 1X7DA 2XQJA 4LRWA 2ZU0C 1LD3A 4CV0A 1EJBA 3GOQA 2I2FA 5JS8A 5LZ9A 3IAHA 3ZOZA 1ZSVA 5FR2A 2GZMA 1S1CA 1R4NB 2VDVE 2PDAA 4YXWA 1FQOA 2X8BA 3DUWA 1CUIA 2VJKA 3FSGD 1M2OB 4L27A 2VBGA 5EGSA 1SCBA 1UWVA 2P4UA 3REGA 2BGGA 4M8KA 4C78A 2MSCB 8AT1A 1EWVA 4FUTA 3F6PA 5C8YF 4DR1B 1GQYA 3GYBA 1PUIA 5JYCA 4MRSA 1ULBA 1N8KA 1BDJA 3EISA 3HO8A 2G04A 2VXOA 2H59A 4ABYA 5L53A 2R00A 3F9IA 4LA4A 2W2NA 4YAUA 2WU8A 3GN1A 1UBGA 1HMYA 4IIGA 3EE6A 3F2VA 3OJEA 3QPUA 2BDTA 5IVHA 1DJNA 3DHVA 3NC4A 2AVNA 2R7AA 2PO5A 1W59A 4NOMA 5B5SA 4C0BA 2OVBA 1JIJA 3AJDA 4US0R 1XVTA 1UR5A 5JCJD 3E48A 3ILXA 4M7OA 3WR5A 4DWOA 4BO1A 1TM5E 3C87A 1WSBA 4JK3A 1H9AA 2NTJA 1FXWF 4Z9YA 3JYPA 3DAOA 3TQCA 5CA1B 1QHGA 1R6UA 3IBCA 3L0DA 1E3TA 3PXUA 3QEOA 2WJPA 4Q24A 4MKZA 3HNRA 4EKGA 2HU5A 2QWXA 2JLXA 4OX9Y 3I2JA 2IYLD 3D2BA 3WGOA 3NPAA 2HCFA 2WVJA 4X92A 4EL5A 1H5QA 2E1PA 1I4TD 3L8DA 3ZU4A 4Y9SA 4ETWA 5KNDD 3O8LA 4JWTA 2BPOA 1OYWA 4UU7A 4J8PA 3CWZA 1ITZA 2W8BB 2YJ3A 2D4AA 3CF0A 3QBTA 2I33A 2MJLA 1Y7IA 5ERGB 2R6AA 1J1ZA 4LJ6A 2EERA 1GL9B 1SBCA 2DGDA 3TCNA 5HE8A 2EJWA 4KO8A 4NQRA 1FDIA 4PSVA 4PZYA 3PJRA 1DBIA 4NPAA 2AXEA 3SF8A 4FDAA 2OP1A 3AY3A 3TRDA 4URVR 4N6NA 3GA0A 1KSGA 1EGHA 3VPFA 3LO5A 3QE9Y 1T4MA 5AIAA 1M2GA 1DJMA 1UMCB 4J9VA 2RDMA 4QLAA 1CPYA 5T6MA 2C58A 1EM8B 2W2LD 4H35A 5AESA 5KB3A 3DDOA 1O4VA 4RL6A 1U5BB 1U0JA 5HJ2A 1ECFA 2PD6A 4MIEA 4YUZA 1NW9B 1T5IA 2GESA 5KNCD 4DIKA 2Z2ZA 3W3AD 2OCPA 3MJSA 3V2IA 1FNDA 1XELA 1OAKA 2Z0MA 4IDOA 2CLEB 5A9RA 3RFFA 3E0XA 3HL0A 3IERA 2IYYA 1O6BA 3C7AA 4HLDA 4H6WA 4J0KA 4PLYA 5F1OA 3OF5A 4GL2A 4JT9A 5CW1A 2JL1A 2LPMA 4FFBA 4AUNA 3BSWA 1TM2A 3D6FA 3FBGA 4CKCA 3HJFA 2WSMA 1NVVR 4QODA 4XLTA 1G3RA 5KTKA 4M1QA 1TQDA 5B1IA 3VTAA 2ZVDA 1I5OA 2VF2A 4RJLA 3VOTA 4XUCA 2BRUC 2NUAA 2X7XA 2I7DA 2XR1A 4KQIA 4LBWA 4HV4A 5B2FA 4AUMA 4G0MA 4MAAA 2YMPA 5EKXA 1LLCA 5EWJB 2BM1A 2HA5A 3JPWA 2LKDA 3P26A 1S02A 4EBBA 4EGJA 5HF5A 1TVMA 1D4OA 1ZKMA 3USES 4KXYA 4J0HA 1Z7BA 2E37A 2NSJA 1QIFA 2VAWA 3G5TA 3EXHA 2CW5A 1P2DA 2B94A 1LGYA 2ZS7A 1DXHA 1XLUA 1QIGA 1Z5PA 2P40A 3KIPA 4UM8B 4YRRA 5FWYA 1SBHA 521PA 1ZKDA 1AXRA 4JHXA 3OQIB 3SVTA 5KPJA 3FYHA 1KIMA 1PAUA 1VYTA 2D59A 2ZWOA 3BBPA 3RBZA 4NJEA 3AF4A 2GNOA 3CR8A 4KQKA 4L2IA 5EP2A 5JNUA 1QH9A 5D5HA 3RYIA 2IHYA 4PG5A 1EK5A 3WKEA 3S40A 2VWQA 1IQPA 1NQUA 1YJXA 3IGFA 4AC9A 1CCWA 2FSUA 2J3HA 2D5AA 4W5HA 4W5TA 3ADCA 1P81A 3E03A 2YJNA 3OZIA 1N75A 1ADGA 4TTAA 4S04A 2OC4A 3EVCA 4RHFA 1U9JA 3PNQA 4JLJA 1T0BA 2VR1A 4LWPA 1D6JA 1A77A 1U7ZA 2IUTA 3I5UA 3NFYA 1KYIA 3IQFA 2XEDA 1E2LA 2Q1XA 1R37A 3C3XA 2G5PA 5JMOA 4TTVA 1CQJB 5J1TB 3H16A 2UXBB 3AINA 1N2GA 3GLFB 3UFXA 2PRYA 2BN4A 3HJUA 4N41A 5LB2A 1EP2B 3AV0B 3ITNA 4FYJA 4TQUS 2NT4A 2X8AA 3P97A 2Y0PA 3ZHTA 4RJJA 5EUBA 2OP0A 1GDHA 5F3DA 4ARUA 2C3PA 1LK5A 2QEQA 1NW4A 3F9CA 2VK4A 3DFUA 1K2VN 1JTFA 3C48A 3COPA 3GJ3A 3K6RA 1OJLA 1Q2XA 4AZVA 3NIDB 2IYEA 3MERA 3OECA 2R8XA 2Q5FA 1XQYA 1YZHA 3PBKA 5IKEA 1A4UA 1SKUA 4RIFA 3PFNA 4WZZA 3D1JA 1XF1A 3I64A 4MA4A 1P44A 1DG3A 2WIKA 4HNSA 1P19A 2PMEA 3HUTA 3BWEA 4YRDA 4A36A 3OQJA 5IKPA 2GCNA 3CKLA 2YXEA 1A5ZA 4YO8A 2C1EA 3DBHA 1H85A 2Q3BA 3WSTA 2QTBA 2PZMA 4C7OB 2DHDA 4Q02A 3JQ7A 1TUBA 3ELUA 4DMFA 3QVWA 4N3AA 3L4JA 1YR9A 3EYWA 4ZXPA 5TT0A 4QYIB 2P6NA 5EJ8A 3C5CA 3AVQA 4PQGA 1QG0A 2CJPA 1GJRA 2V3WA 3F74A 4P22A 5ALYA 3SYTA 1Z25A 1P9LA 1QMGA 1WL8A 4I9UA 4OVKA 1XQ6A 1TK3A 2XIQA 3PEFA 4EY8A 1ZLYA 2C99A 1YZYA 2O2DA 2O3SA 3D4PA 3CH5A 3GNSA 1QFZA 2ZVQX 3PG5A 2GN4A 2IP1A 3H6GA 2ZJ8A 2FB9A 3R77A 5T3YA 4JLBA 1QOQB 4BNGA 1AKNA 2H1OA 2PKCA 2OG1A 1M54A 3AR4A 5FKJA 2IW1A 3GJ7A 2PQ2A 2AKYA 3L49A 1KK1A 4P3YA 5ALOA 1OXMA 3CISA 3A32A 1A9TA 2HN9A 1RQ7A 1FFAA 2A1UB 3M9XA 4IEIA 1J8YF 5D01A 5FI5A 5IT5A 2QDKA 4R2XA 4UM9B 3EXIB 4P98A 2Y05A 1JSLA 3JV7A 3NNSA 1V26A 1BW9B 3GZNB 4X7RA 4V2IA 2GDZA 5KKAA 4C5CA 2CBZA 4BXOA 2VI5A 1XC7A 3DLBA 3ZXUB 4A9AA 1I6KA 2BSAA 4P82A 2NVUA 3COSA 5GONB 4QOFA 4LF9B 1YQUA 3LHKA 1QVWA 2HJWA 3HG7A 3RJ9A 3RK1A 1XPOA 4MPDA 2GBCA 3OE5A 3E8SA 4OI2A 1AO0A 3M6AA 4HB4A 1E3SA 4ZQCB 5I3ZA 3D3NA 4Q4DA 2XNCA 4WEQA 1RYHA 2JLSA 3O84A 3EASA 5I4BA 2JIZD 3P9CA 1H22A 4JJZA 3WMGA 3IAM6 2ZIFA 4BNVA 5BVGA 5C18A 1NVVQ 1XAHA 1ZD9A 4ZAFA 4ZAXA 1LBSA 1ZJJA 5FYDA 3ZJTA 5DX0A 1WDKA 5K4AA 4ESHA 1S3IA 4BPRA 1U7HA 4UHDA 4XIJA 1QBGA 3K70C 5FTMA 3K8QA 2LTAA 4ZV4A 4JCCA 5EZYF 1JEOA 2I3DA 5AOVA 2WD7B 3F97A 3QKRB 3IODA 4TYWA 2QU7A 3S44A 1K68A 4NP6A 2X8LA 1OT3A 2PBZA 2HMSA 3O8DA 4DLNA 3QJYA 4BWGA 1ANKA 2GEDA 3ZN2A 4O4JB 1PR9A 5CXUA 3VNBA 3D6AA 2E4YA 5EG5A 5JD4A 3NWPA 1B7GO 5IJAA 3OZDA 3MD0A 2GO7A 2Y1CA 5K3CA 3B5JA 3PGA1 3O2SB 4HLUA 1MC5A 4HLNA 3AV3A 4V0LA 3U7GA 1C1XB 1RI1A 4HXEB 2R6FA 5JNRA 3HXQA 4OAOA 4HN4B 1RI4A 3CNOA 2HQBA 4MCHA 4NBNA 4C21A 1NBEA 4Q9HA 5JE8A 5FOTA 1IPEA 1JT9A 3GOHA 2BEUA 4YGYA 4EG7A 2JLYA 1UPUA 2V7WA 4I0WB 4ZZIA 3A4MA 1Z39A 5FTLA 4EATA 4FOOA 7REQA 4ZTBA 3OTGA 2WTMA 2VYVA 4ZC8A 3TB4A 2XQVA 1B23P 1V7QA 1S2NA 2PV7A 3K0BA 4O6VA 1IVNA 2R8PA 2GEKA 3GRPA 3MJEA 1RPNA 2VJMA 4MWDA 3LYUA 5DBEX 2PNFA 1YOBA 1V7ZA 2H51A 2Z2YA 1E92A 4GFDA 4DSOA 1YZ3A 2CXPA 1W5FA 3NWOA 1N5RA 2YDXA 3NS7A 4TXHA 3UJCA 3BOSA 4KITB 1A8IA 4OIFA 1TW2A 5HIIA 1PT5A 3JWJA 3X2FA 1UBLS 1WXFA 3CN9A 3NBQA 4CM1A 5AQEA 2B1IA 2OKCA 4QASA 3M5CA 4DM3A 2GN8A 2WSYB 3W6UA 3I83A 1QH8B 1ZY2A 3O3MB 4ZOQI 4LTNA 3T3DA 1M7GA 1W93A 2VDMB 1JWAB 3P0JA 1XJWA 3NVAA 1G18A 2VBCA 4N3GA 5EKSA 2G17A 3RGGA 1XMSA 4L3VA 3TLGB 2TYSB 2PNJA 5G53C 1E3WA 1YIOA 1TMGE 4HAIA 3AHJA 4X61A 2YQ4A 1AV7A 1ZIOA 4NWIA 4LWOA 1TVKA 4HEA6 3STWA 1UADA 3Q98A 5FWNA 1TRHA 2VUUA 2YWDA 4JBGA 3FPEA 3LE8A 4NPCA 3ICEA 3WLLA 4IQFA 4JBYA 3U4HA 2NTNA 2YRXA 5K0BA 1FDTA 4PZLA 1U7TA 1EUDB 1RMYA 2IYSA 4HP8A 5FUMA 3PC8A 2F3PA 2XB2A 4ZRMA 3G1TA 4AULA 2QJRA 2CLCX 3TSAA 4R8VA 3GGCA 1KJJA 3F4LA 1FMJA 3CVJA 4GOLD 2J67A 1BJRE 4ZHQF 5KDOA 1ZG3A 3V7NA 2GI4A 2ON6A 5IVPA 4HUJA 4FB5A 5JSUA 1K5HA 1G2IA 4JI1B 4N3BA 3ESCA 1FFCA 3C8DA 2XVMA 2J0UA 4WOKA 3DLIA 4HB2A 5FP0A 5CAEB 4EY3A 4O2AF 2ESRA 2HFJA 3VKWA 3DULA 4C20A 1P39A 5FWXA 1WDLA 4RA9A 1P2TA 1T6NA 1R66A 1U7UA 1SKYB 2F67A 2XHZA 1HT1E 2AMVA 2P1DA 1X8XA 2X8JB 2FHSA 2ZWVA 3EOAI 4UPDA 1SCIA 4C14A 5JD6A 1KTIA 3LCRA 1UDBA 2FKNA 4BTEA 4XYBA 2CFCA 1XIVA 2GJAA 2PMCA 3B2NA 3GUHA 1L7PA 3IPYA 1T2EA 3KWLA 4RV4A 5KCZA 1Q0TA 4QXPA 2M6RA 2YASA 3GNLA 1FP1D 3ILSA 1LH0A 1QIKA 2GR9A 3JRWA 1OLUA 1T9DA 4LVCA 1PFYA 2P69A 3JVVA 3RS9A 3VRHA 2QHXA 3QOFA 5GOTA 5K0JA 1OFTA 1FQKA 3DUFB 4F0JA 3T0GA 4D46A 3RBXA 2GILA 1XX6A 1YZKA 4L3WA 1WU7A 1ZRMA 2BSXA 3RSGA 3NVKI 4FW9A 3RU2A 2P5UA 3H9EO 3HA5A 2E18A 2ZT7A 4L8YA 4BE9A 1AGRA 5BP7A 1VG8A 2OGTA 1YF3A 3ZDCA 4OI0A 3PVCA 4YP1A 4GAEA 5BUSA 1EE1A 1UBTS 4LZNA 1WQ4A 2I29A 4MUFA 4BBAA 3GK3A 3QVSA 4BEBA 2YBEA 2G7ZA 3DONA 1KI8A 3IP3A 3MAGA 4FGSA 4CKBA 3BMOA 5IJWA 2QMEA 4II7A 2DLNA 5BMOA 3HH8A 2EW8A 3PDUA 4YAEA 1N2XA 2HJRA 2HIHA 4MVWA 4RDHA 3TJZA 1BMFD 4RJ2A 4ROTA 3NXSA 2QTVA 2XTZA 4A10A 3VC2A 2GZDA 5J47A 1G8PA 5DBOA 3NHLA 1RFGE 3A1UA 2O1XA 4X00A 4HQNA 3S1AB 1E0KA 2I6GA 3GAAA 2YN4A 3QMPA 1R0BA 1WTCA 3P9IA 3LRPA 4L8LA 4MHSA 3AY6A 5FF9A 4P6VF 4DLYA 5LIPA 3KQHA 3N6RA 3K1AA 2NU9B 3ASYA 3VYRB 3K9BA 5K8CA 4PZUA 1YJ8A 1RMTA 4KK3A 1HDIA 1BKSB 2WSIA 1OIXA 3I9OA 2YOFA 3PL5A 2WV9A 2HKIA 3LQKA 1NDQA 3TUJC 3GHYA 5F78A 4FE3A 2ZR8A 4RKWA 3NRJA 4RHCA 3EZLA 1E4EB 4YJ3B 3T12A 4ENRA 3AWIA 4M1MA 3MUFA 3QNWA 4DUGA 5JAPA 2EKDA 3PKZA 1BGWA 4JKYA 4C0AC 4OYHA 2A1TS 1BO6A 3HVKA 1UPCA 4FQ5A 1CUHA 5HZGA 2EKLA 4NYMQ 1O97C 3VJKA 1HNNA 4XCXA 4PYNA 2H3HA 2ODQA 3GC6A 2IBSA 3CHYA 1MQAA 2RK4A 4X1KA 2POCA 4YC7A 5EWMB 3WNCA 3B1WA 3P0FA 4IBOA 4KPEC 4L4ZA 4JUCA 1H4TA 1A2OA 3IAXA 4J0IA 4BNDA 3ET4A 1AUXA 1YB4A 3IEXA 3U09A 1QGZA 1K8QA 2I6SA 1FNNA 1KK2A 2GF9A 4BMDA 2RGRA 1Y3DE 2PYDA 4KJZA 3ZE9A 3RIXA 4DLBA 4QLOA 2G5GX 5JTUA 4BO6A 3QUSA 4HGNA 3GGDA 1XLTC 1S8AA 1OWMA 4FEEA 1EESA 3MW8A 4YRAA 3FDXA 4BMZA 1E79D 3AI1A 2WJ6A 3QW2A 4XARA 3KXPA 3I9MA 1VHJA 4RK7A 2X77A 1G4UR 3NTLA 1PT6A 3I76A 4BFVA 5EJ9A 3OEWA 2JH3A 3OWHA 3FIJA 3S2UA 2C7GA 1F2UB 1FU7A 4YRMA 2CWDA 2CMHA 3A0UA 4YIKA 2CNOA 1SXQA 1NBAA 5KQLA 5KOYA 1XZQA 3G0IA 5JI3E 1D03A 3H04A 1UKCA 2FZ5A 4J91A 2PUHA 2H8KA 4MCAA 1JSCA 2FUG1 1AY0A 2JCVA 3VO1A 3CWCA 1U8XX 2CLFB 4MR8B 3L0PA 1Z29A 1H2BA 5COBA 3FWYA 1PJ8A 2NO6A 2GA8A 2IYXA 2Q99A 2GWHA 3KSRA 3LO8A 3NBUA 4OY3A 1E62A 1Q12A 4B85A 4NDZA 3CH6A 3MXTA 1II9A 2Q6IA 4RCYA 5JAHA 5LJLA 3FOAA 3ITDA 1FFXB 4RPHA 4WZ6A 4JI3B 2XYQA 3VUEA 3L8MA 5C1DA 2JFFA 3IKTA 1YGYA 4QDTA 3NH9A 1NQAO 3NV9A 2UAGA 2IXEA 4MR7B 4PHCA 1T10A 1ZNYA 2IYVA 3G7NA 5DW0A 5H3HA 2WHXA 3ZZ1A 4F2HA 1KAEA 4TV9A 1KY5A 1MFPA 3H8JA 3FPKA 3O92A 3W05A 2WZBA 5CCBA 2R8OA 5AVRA 3O1JC 3EPLA 4RMIA 3NDJA 5DH9A 3FPGA 5LLSA 3ZCPA 1K06A 3EQ2A 3HNOA 3FMPB 3KU1A 4GRIA 3NIGB 2QAGC 4J7AA 4X1IA 2JATA 1DV1A 1L4KA 5KAPA 1PF7E 1QANA 2FN8A 1SELA 2KLBA 3W8FA 3CR3C 1V41E 3QXJA 2X9GA 1J39A 1ES9A 3VPHA 4Y2UA 3MB5A 1U8ZA 3TLYA 4D9IA 1EM6A 3G5MA 3GVIA 4FHGA 1YRAA 1EMDA 1IMJA 2JK1A 2WT8A 4IIUA 2I9KA 3KOUA 4XJSA 4Y2XA 5HEKA 3W6PA 2FWBA 1TF2A 4WINA 4ADSG 4R2LA 1U4OA 2GUWA 2V4ZA 3DHNA 5T64A 3IMCA 2JW5A 4HFNA 2C97A 3W8NA 1C4WA 2OQVA 3V1UA 4UUOA 3GFTA 4Y1EA 5JO9A 1B8VA 1DFIA 1JQJC 4UTZA 1Y1RA 3F3MA 3VBCA 3HVJA 5AVWA 1KP9A 4GUAA 3TBHA 2JK0A 2FPIB 3MRTA 3W9YA 3STTA 1KRHA 2Q46A 4JGBA 3UWDA 4DA4A 3MS2A 2OESA 4WV3A 1LW7A 3OIFA 5HZHA 1IJBA 1GNPA 3CVVA 4ES6A 1A04A 2BL4A 3NBAA 1KEVA 4FSDA 5AVOA 1NQXA 1DIGA 1NFFA 4P0PB 3NKVA 3R8XA 4EQ6B 1XXLA 3E58A 3VU9A 1G5TA 1UWCA 1QYCA 2Q5JA 4CEJB 3LXXA 1SHJA 5DHSA 1DKRA 1E64A 2WFMA 3KSUA 3W7AA 2BLLA 4G97A 2JFOA 4LK3A 5F73A 5A4KA 3K1YA 1T29A 3UXEA 3K5IA 4LHZA 3FR7A 3KVRA 2RHWA 3WRYA 4REOA 4BVJA 1CLUA 1DE0A 1MO2A 4EYQA 3GA5A 4LRSB 4O2BB 4OH1A 2JLVA 4R5MA 3KUCA 5F21A 4C6RA 2HIMA 4B6EA 3H5LA 4K03A 3RVMA 5BVHB 4H59A 4TL6A 2P9TA 4FI3F 4PPGA 4FFRA 2AJCA 1W35A 2ZQ5A 1L7OA 2BFEB 1NXPA 3F98A 4DCVA 5IYZB 5JRZA 4N8DA 4KQMA 3M6XA 4X63A 2H8GA 1CV2A 3JVIA 4F2WA 1LCIA 4F93B 1VCMA 2AZ4A 5CFRA 3FLMA 3PXGA 3E05A 2WAOA 3LT0A 5DISB 1OPXA 4UD2A 3EZYA 1G5FA 1JWBB 2FR0A 4P3KA 3HDHA 1XB2A 5KMGB 3ZZUA 3DS8A 3JWPA 1LY1A 4PN3A 1G4HA 2GARA 2MSWA 3R3HA 3ZDFA 3MPOA 4E5NA 4DANA 1FP4B 5LYJF 5BOSA 1H4VB 4HL6A 2FPGA 2O0JA 4NOKA 2ERXA 2Z2IA 2L42A 1M8FA 3GLSA 4J1TC 4DCTA 4RA6A 4MR9B 1C1DA 4YUXA 1BA3A 3SHOA 2PSJA 2YFKA 3TXYA 1F2TA 2H7CA 3GVCA 2XGOA 2VBFA 3FCOA 3U7QB 1FDWA 4NABA 1HE4A 4N9QA 1WXGA 2OCAA 4Y2SA 4Z4HA 4XD7D 2H7XA 2QS9A 4R2WA 1E1KA 1JQDA 5CCXA 3MMNA 1XA3A 4ZEMA 1XO1A 2H1WA 1FNCA 3A05A 1VLHA 1UWLA 1NMZA 3ZDAA 1E5QA 5AFSA 1GG9A 1M1YE 2QSJA 3BRQA 4TMVA 1DAIA 1QAMA 2ZE7A 1U7DA 3PVSA 4NCBA 2BGTA 3FBWA 4DWVA 3A3OA 4EY7A 2E55A 2JFGA 3R0ZA 4QHTA 1WHSB 1JB1A 4PCUA 4U2BA 2JHPA 1P4AA 4MVJA 3CLSD 4D26A 3BTSA 1SVMA 2IIBA 3DOHA 1LQ2A 4Z0TA 2TMKA 4KFCA 3DB1A 1C5KA 4DHWA 3IVRA 5TF4A 2WD9A 4JC4A 5ER6A 4PLTA 3ZX5A 1I7LA 3GAFA 2X8WA 4U7TB 4DDMA 1TZ2A 2CK3D 1EHYA 4TSKA 3GRUA 3IYLW 1QQTA 2QZJA 3J7TA 3KB6A 2FWRA 1C29B 1JE0A 5G0TA 4LHEA 3AERB 2HF9A 2PKQO 1WP4A 1NJ2A 1EGMB 2COUA 2FP4B 4TROA 2EL9A 4P54A 1GEGA 1E2MA 1N5IA 4C87A 4CLEA 2PEZA 3SHQA 1Q7BA 3LQ1A 2FMTA 1NJFA 1JW9B 1U28A 5EQTA 3OOHA 2EARA 1H0HA 3IAUA 3KUDA 3WIUA 2IU6A 1T8SA 4QEKA 4XJXA 5JASA 2I3GA 2Q2QA 5HF9A 2WWVD 1HFKA 2QRMA 4IJMA 4ARIA 1MJGM 1OC2A 1Z47A 3INNA 5GZ6A 2CHFA 5BURA 2SKEA 3PGKA 3UAXA 3HUUA 1JRLA 4JT2A 1CWUA 3RS4A 2H0RA 3NAGA 4Q47A 2R8ZA 3QVTA 1MA0A 5LA6B 2P7HA 2BUAA 1CNEA 4IHKA 5KTSA 1S96A 1J8VA 2NUTB 1KZ7B 4N8SA 3VH4A 2FZKA 1L7BA 1UZAA 3MS7A 1NASA 3MJHA 2OMKA 1GPJA 4O2LA 3L0IB 4Z49A 3WI7A 1YIDA 3IR6A 3V8RA 5A3VA 2HA0A 2L69A 3BGOS 3ZBUA 1V6SA 4B6OA 1BVRA 5MDHA 2ACWA 2P5SA 4FFSA 3NBKA 1XQXA 1I3CA 1E7MA 5JOQA 4ZARA 3I3OA 5FT9A 3KQTA 1A8UA 2YXLA 1FK8A 1SUWA 2GEUA 3LQRA 4LRTB 1CDDA 2FOIA 3C16C 5K8LA 1F4PA 2A78A 2HA2A 3I3SR 1MP0A 2IPLA 3H9CA 2XCTB 1UPXA 2OOSA 2SHKA 3IDAA 3GJ0A 2HK7A 4CLHA 4F84A 5KKCA 1PK7A 2IELA 4Q3AA 1MXFA 2GYUA 3AUKA 3I28A 1P2UA 3T7RA 1N5JA 1Y7HA 4Z9BA 3AILA 3DXZA 4QSHA 3EH2A 3JQBA 1ZD1A 3ZVMA 1JPJA 2OLKA 4KR0A 2O19A 4IUCS 2Z1MA 1E5XA 1JTEA 4H0CA 1EUCB 2M6KA 3WBKA 2VFAA 4HDSA 3PPIA 5LKRA 1RXIA 3PXAA 3AR2A 1NMSA 3AEKB 2MMCA 1FTSA 1RAHA 3C2QA 5E1DA 5SZHB 3V7UA 5DHPA 5ALGA 1ZGCA 4FHCA 4WZAE 2QRJA 1X94A 4XSGA 5FULA 1PQ4A 5FPYA 5DGTA 2GCGA 3LBIA 1QK3A 3T3NA 2EKBA 4QVIA 4ZYZA 2Z08A 3FYUB 5BO5A 2I3AA 3S8MA 4ENVA 1WWKA 2P9HA 5T4BA 5KHOC 1S4MA 1RHQA 4KNYA 1UMBA 3JZAA 1A9OA 4RADA 5INTA 1YC2A 3O1HB 1CG6A 5KJ1A 1JYSA 2GVZC 3OETA 3OJWA 3GRAA 4J16C 5D3MA 5FNVB 1NR5A 2NADA 5DNYB 3A6PC 4B3JA 4ZCTA 1JBQA 1WEHA 2BGRA 1Y48E 2ZWPA 3TLZA 4YRIA 1MZPA 2QROA 2XUDA 3KOXA 1TECE 4AZSA 4B33A 3GFGA 1DC5A 1J2YA 3B6JA 1K8RA 1T8TA 2OHJA 1IB6A 4HADA 3OM1A 5CVUA 3OOYA 3T5PA 1UC4B 4UDYX 1B8UA 4MGKR 3EVFA 1PNVA 4LYFA 1L9KA 1GZSA 4ARCA 1WQ3A 4JC5A 4CF7A 3GY0A 1QBKC 3KJNA 3SYMA 3ZJ4A 2IKQA 1SXPA 3KSBC 3TXXA 1NJ5A 4BX8A 1PUXA 4Z3DA 5AYVA 3ZKAA 1ZAYA 2JI9A 2YS7A 1T9HA 4IIBA 4RCVA 1M6YA 1TAHA 1ZXBA 3NHZA 4O1IA 4W8OA 5BSUA 2IXDA 5IF9A 5IZCC 5BR8B 3CT6A 3FY4A 2GD1O 3SJZA 2CFIA 2I4OA 3GRFA 4N54A 3G13A 2REQA 3X1WA 3RK4A 3PENA 2UZ3A 4MVJG 1K89A 1NOKA 1SGWA 1YCGA 1YZFA 2IEZA 2JAHA 3SI7A 4MLPA 1AMNA 4WJZA 1ZW1A 2Z2KA 2J5RA 3S8EA 4ZU1X 2QUHA 4AD8A 3T4UA 3UOGA 4IGFA 3RIMA 1WQ1R 1ZIDA 3QI2A 1TMYA 4F71A 2CY0A 3HCWA 1D2HA 3HDQA 3L84A 5D3ZA 3TZLA 2EKZA 2FRXA 2QN1A 2Z5GA 4G6ZA 3I2HA 2PS3A 5EMLA 4CR6A 1I3NA 3WC4A 4EI9A 1M1NA 1QHXA 1G63A 3RM3A 4NE9A 1DINA 1H2WA 3PHCA 3UAZA 4B9EA 1H8EA 1HQYE 2WIGA 1ULAA 2H5LA 4LISA 2V0GA 4G5RA 4PAOA 4U02A 4UBLA 2CLMB 5GOZA 4JUIA 4Z8YA 1BXRB 3VSCA 2EGUA 3CNEA 4AMYA 2PKQP 4KRFA 4W5NA 1DTSA 1TTHA 1RBYA 2C7VA 3GZ4A 3UB4A 4D9EA 4FKBA 4ITUA 4E3WA 3TW6A 4ZYTA 4C0KA 4ZIRB 1XDWA 3BGVA 3V42A 2DCUA 3LH5A 5F2OA 2DFDA 1NF9A 1E2EA 4A8TA 2BCEA 4ZO7A 3ROXA 3BH7A 2IRWA 1K9VF 3CF2A 4RHUA 2XMRA 4KSBA 3I5AA 4Z2AA 1FZQA 1JU4A 2Y66A 3MCTA 3EEQA 5JC8A 3SBOA 2A14A 3L4EA 2ID9A 4K0KB 1NHGA 4HXYA 4C0XA 4NRDA 1NBIA 2UZ1A 3DPIA 4L6AA 3RRXA 4KE7A 3ZY5A 4PPFA 4S1TA 2AHOA 4G1BA 5T4HA 4Q16A 4RZ3A 4IFEA 4BUJA 3M6MD 3RDPA 5DLQC 3C6BA 4D4GA 721PA 4XUEA 3OJLA 3HP4A 1K7EB 4CQMD 3MQFA 1UZNA 2QTMA 3FDFA 4C3ZA 1CIPA 5KSPA 1QZTA 4DF3A 3G9ZA 2OBBA 4A03A 4OQYA 4Z4FA 1K9SA 3DV0A 2AN3A 2ISQA 1W9HA 2GT1A 4LJKA 5T41A 2OEPA 4AO8A 3DEKA 3WYAA 2B6NA 1N4DA 1H9BA 3HB7A 3RTAA 4IICA 2P11A 2B1JA 2XOXA 4OMDA 1X9GA 3TH5A 3ZVRA 1YZTA 4KUHA 1V8BA 4YT2A 3D2AA 2VEOA 5BV2P 3M2PA 3BD7A 4A73A 2F9LA 3B6EA 2INGX 3R09A 4GX5A 4PSKA 4EJSA 1SQSA 1Z26A 2IDKA 1GTL1 1X7XA 2J6IA 3AHIA 5CIYA 3RSLA 1Y42X 1YRWA 3QFCA 5EC8A 5EKDA 4WAUA 3ZD6A 3PT9A 3QFHA 1OFVA 1S8FA 3PDCA 4GZ3A 4GE0A 4FLMA 3TMYA 1T3TA 3TNLA 5BQFA 2QF7A 1WCYA 3G59A 3OSUA 4NYJR 1YDEA 1Q0ZA 4MYUA 1Z7WA 2YY6A 2QRZA 2A0FA 5BYAA 1EK6A 4O0MA 3T3GA 3ZD8A 1OKKD 2VPPA 3DBVO 5HIKA 1R4NA 3H6KA 4NK4A 4ZAZA 3T54A 4OV6B 3TI7A 1NHWA 3GL9A 4U9UA 1M2OA 2PA0A 4WGGA 1MT3A 4X94A 4D4MA 3FWHA 3NBMA 1E7YA 2FPOA 2Z95A 3M6IA 3JQ8B 4WLNA 3WIDA 1T15A 1ADJA 3FYCA 1PFUA 1QWSA 2XEXA 4ZREA 2X5KO 2FG7C 2ZJZA 2C5GA 1ML4A 1OI4A 1KH2A 4CG0A 1PX0A 2IU0A 1P31A 3T0FA 4X8MA 3DZFA 4HPJB 1I0LA 5C5EA 2HREA 3RYHB 1BRTA 1Q0HA 2A5GA 3ONEA 3P20A 2QG4A 3WLKX 1PO7A 2X14A 1P8AA 3QWIA 4IUBS 4XLZA 4BQPA 4QUKA 4YCDA 3EBPA 4Z86A 3KKOA 4PBTA 4PYKA 4DCSA 3MGGA 5JRDS 3K96A 1P0CA 4GDMA 4II3A 2Q28A 4L4UA 1SQ5A 1U4NA 3QU7A 1GRVA 2XZTA 5BQOA 4E51A 2GAFA 3A8TA 4IZOA 1E1RD 2VP9A 4JP3A 4DDWA 4JCOA 1A76A 2RHCA 2X3FA 5CGZA 5E95A 3KEOA 2HT6A 1ZUWA 1UJMA 2GXQA 4ZO4A 3UG7A 2XQIA 4F3YA 1VKJA 3BREA 1SB9A 1VJTA 2P2LA 3EW7A 4KPFC 3L04A 4EBFA 1GPDG 2A9OA 3EPRA 3DHEA 2ZJ2A 3AC0A 4JEHA 1PBTA 4OKSA 3CVWA 1P5FA 4IYJA 1R4AA 2Z58A 1U0LA 5H3CA 4ZI7B 1MEJA 3DP9A 1IHPA 2OYSA 4WASA 4EUNA 1PZMA 1ESDA 1UFOA 4US1R 4WK0B 4DCPA 2G8NA 3IT2A 3HYTA 4NI5A 3TD2A 4F5WA 3G2PA 1U8AA 1VSUA 2QE6A 5CLQA 3OEHA 2WMOB 4BNLA 4NDAA 2W8BA 1NW5A 1FX0A 2MYNA 5TVGA 3BK2A 3A1NA 5K8IA 1NBMD 1JLLB 1GGJA 2GM9A 3BUSA 3I09A 3SBEA 1E0JA 1Y7TA 3CPSA 3P2JA 3PZBA 4Y9UA 2QG6A 3K31A 1ORWA 1U4SA 2EWVA 1IWPB 3RODA 3UICA 2HV9A 2C07A 1P5RA 4IDHA 5C34B 5REQA 5I9NA 1A2BA 5TQ2A 2ZUSA 2L0XA 2HHJA 2P3OA 1TQ8A