1E7RA

Gdp 4-keto-6-deoxy-d-mannose epimerase reductase y136e
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
314
structure length
314
Chain Sequence
b'KQRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPEAIAKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQSAPDVVVWGSGTPMREFLHVDDMAAASIHVMELAHEVWLENTQPMLSHINVGTGVDCTIRELAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVTRLHQLGWYHEISLEAGLASTYQWFLENQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GDP-FUCOSE SYNTHETASE
molecule tags Isomerase
source organism Escherichia coli
publication title Probing the Catalytic Mechanism of Gdp-4-Keto-6-Deoxy-D-Mannose Epimerase/Reductase by Kinetic and Crystallographic Characterization of Site-Specific Mutants
pubmed doi rcsb
total genus 108
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.271: GDP-L-fucose synthase.
pdb deposition date 2000-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1e7rA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1e7rA02
4NJMA 4XJSA 4YWJA 4GH5A 1IULA 1F12A 1IL0A 4YB8A 2DQ4A 2GERA 3P5SA 1L7EA 3LC1O 3PJFA 3KVOA 3JCZA 5TGDA 1H93A 1HYEA 1NTOA 4YAKA 3D64A 1RKXA 1JKJA 3GT0A 3ZDFA 4J6FA 5AQ1A 5CDTA 5JO0A 3NTOA 2I3GA 3PWZA 4Z0TA 4YJGA 3WG9A 4QXMA 1P9LA 3DO5A 3FSRA 1T26A 4BNHA 3NYWA 1VC2A 2RHCA 2FWMX 4GL4A 4K28A 4LMRA 1B26A 3S2EA 5DCUA 1Q1NA 1H0KA 3ANMA 3WYEA 1E1LA 4CQMB 1JAXA 2YFQA 4WGGA 1IPEA 3OA2A 3ZWCA 4IIVA 1Z7BA 2GD1O 4OYRA 2IODA 2Z95A 5KKAA 4FFRA 4ITUA 1HDYA 1VE9A 4IDGA 2PV7A 4KP7A 3D3WA 4CLOB 5FI3A 4CMIB 4EEXA 1BXGB 3WLFA 2I6TA 5I9NA 4J43A 4ZRNA 4WNCA 4WASA 2O3JA 4CLRA 5KWEA 2VYND 1XEAA 2GSDA 1QYWA 4J2HA 3U0BA 1IOLA 1A27A 2X5OA 3VH3A 1A4IA 2W2KA 3GA0A 4I5FA 5IDQA 4R54A 1LDMA 1FDWA 3PHLA 1A4UA 1YJ8A 5JMPA 2UUOA 3LK7A 1DPGA 2X7HA 1K6JA 1MFZA 3UCXA 3GLQA 3QE3A 1E6WA 4AJOA 4OOFA 5A02A 4W9NC 1PJCA 1LSSA 3GVIA 3C1AA 1ML3A 2EIHA 2I9PA 3A14A 4ROSA 2GUGA 1ULUA 2RHRA 4H7PA 4QEDA 3GGPA 1HDZA 4JP2A 3S2GA 2O7QA 1LDGA 4RLHA 3AM3A 4Q3NA 5B1YA 4D42A 5T57A 5DT9A 2BGLA 4BMSA 5ER6A 2CFCA 2JD0A 1GFSA 1K3TA 3L77A 1NQAO 4TKMA 1NHWA 5CEJA 3SXPA 3H9GA 2AE2A 2CDCA 4M8SA 3C85A 2BFOA 2PZJA 3LVFO 1Q7GA 3VTZA 1C1XB 4Y8VA 2OL4A 4Z9FA 3WNQA 2WYUA 1DJQA 4R68A 4TVBA 1PGOA 3ZV5A 3WOHA 1H6AA 3ZWYA 2PGLA 4DMMA 2GN8A 4FN4A 2B4QA 3H5NA 3BMCA 2IXBA 1SO8A 2HMUA 3B20A 4YBZA 3DHYA 4CLEA 3ASUA 1BXGA 5BSHA 3BMNA 2NU6A 1GL3A 1WVGA 3G49A 3QJ5A 3AI1A 3U49A 4CM6A 1BVRA 3I6QA 1TEHA 3PDJA 3IC5A 2IEDA 1UUFA 1DC5A 5F21A 3ZH2A 1E7SA 4FJ2A 4C7JA 3FR7A 5EN4A 5L95A 5BT9A 5JLAA 4J2OA 4BKUA 1DSSG 2W2LD 3DOJA 2P9CA 1JKFA 3NAQA 3IUSA 1UXHA 1YS4A 3NRCA 3GUCA 4W82A 3DHEA 3TRIA 2CUKA 1JLLA 1XU9A 3M1AA 4CV1A 5ENVA 4WUVA 2PD4A 3D5QA 4GLLA 3HE3A 3U4CA 4IPTA 2VNSA 3TZ6A 4ALKA 1WXDA 3ADPA 5TF4A 1BMDA 4CJXA 4DPMA 1VSUA 4BHTA 4IJWA 2YHIA 4CM1A 3ANLA 3R3SA 3RD5A 3DB2A 3F4BA 2CSUA 3D4PA 2BI7A 4JJGA 2FSVA 2O50A 4E5MA 1Y8RA 2E4AA 3ABIA 3JQ8B 4DXHA 4J7CA 5IXYA 3GH3A 2B0JA 4YVFA 4XGIA 3UOGA 4BNUA 3I9NA 6LDHA 5I7EA 1YL6A 4ALMA 1D8AA 3GNQA 1CQJA 2C20A 2HAEA 4RVUA 1B8PA 1B7GO 3LLSA 3OEYA 5KJFA 2Y05A 5CEFA 4J0EA 1WZIA 1PL8A 1Z45A 4Y6PA 1ZXBA 2I3AA 1T4BA 4DLBA 4R5HA 4EITA 1JKIA 3GAFA 4E32A 4QFDA 4YCAA 1E7QA 2O4CA 3F4LA 4UVHA 5BQFA 4DTIA 4ZU3A 5JE8A 4PRLA 4GX0A 1F8GA 1GR0A 4IY1A 3U4IA 3OIDA 4B3HA 2VUUA 3C1TA 1LTHR 1PR3A 3DZJA 4BGUA 2UUPA 3NDJA 3AU8A 1XU7A 3ZWPA 4K6CA 1JVSA 2NSDA 1PS8A 1U3TA 4CM9A 1E7RA 2BHLA 3EZYA 4L4XA 1O89A 5ICSA 3GGGA 1D1TA 4KZPA 3BTSA 4EUEA 1YH3A 5HRUA 4RPLA 3BYZA 2AW5A 4IJVA 2B5WA 2ZYGA 1SOVA 1N7GA 2X0JA 4NFYA 4GWKA 3LF1A 1JAYA 2Y1DA 3V1YA 4H3VA 1NQTA 1UZMA 2GGSA 4WOJA 3IKTA 1X1TA 3MEQA 4U0KA 1TA4A 2YHIB 4AJ1A 3IS3A 4ZVVA 2H6EA 1HYHA 1R15A 1UJMA 3OJFA 5FEUA 5FWNA 3OF2A 3GRKA 3BMOB 2VYVD 3M6IA 2RCYA 1WW8A 3ONEA 4R16A 4RJTA 3NTQA 4I5GA 4KWIA 5DBFA 4NZ9A 2BFMA 4PZDA 2HMTA 1AXGA 2WD7B 1PJQA 2FR0A 2XF8A 3MCVA 1NHGA 5EINA 5CP8A 4AJPA 1YGYA 2DFDA 4EEZA 5ILOA 2Q2VA 2DTXA 5DZSA 2VYNA 4J91A 4BKQA 1MB4A 1FDUA 1Q7BA 2Y1FA 2GZ1A 4FIZA 1U9JA 4IBOA 3ZI0A 1ONOA 1KIFA 1U7HA 1SC6A 2DC1A 3JQ9C 4M87A 1UAYA 5I7FA 1LRKA 3Q11A 1X7DA 3WBFA 1QORA 3A06A 3BAZA 3GDOA 3L6EA 3ZHYA 1ENZA 4Q39A 1VPDA 3O03A 2BD0A 5B12A 2HU2A 2VT3A 1NPDA 2ZKLA 2NU7A 1P1JA 2WE7A 4EJ0A 1MLDA 4MO2A 4BL5A 3DZFA 1KEWA 1MUUA 2XPCA 1PQWA 1IHYA 2PKQP 3L4SO 4HX5A 5EQFA 3UAGA 4XIYA 4RCVA 2PA3A 4K1LA 4ZQGA 2VWPA 4WEQA 2HMVA 3KB6A 5LDGA 2DPGA 2A35A 1MG5A 4HWKA 2XAAA 1HF3A 4LW8A 1XCBA 2YHUA 2SCUA 4YDRA 2FZEA 2A9FA 2HO5A 3KXDA 3W6ZA 4GMGA 1IY8A 2AEMA 5T67A 4NG5A 5CDSA 1OFGA 3NGXA 4PRKA 4WCFB 4DLLA 1ZK0A 1YRLA 1PGPA 1GCUA 3NKLA 3QVOA 4XEHA 1KETA 1RYEA 1RWBA 2V7PA 4IMPA 3PRJA 1NPTO 5TT1A 1KC1A 3F6YA 3QQPA 3CEAA 4ALIA 2B5VA 3HQ4O 3NUGA 2D5AA 3VH1A 1KVQA 4XYLA 4CLDA 4DC0A 5JNLA 2BELA 4XYMA 3A28A 4Z6KA 3EUWA 2X6TA 2DVMA 4LRSB 3KSDO 4MVJH 4R1SA 5I8WA 4WECA 3DDNA 4FFLA 4YRAA 3WSWA 3SLGA 3V2HA 2G82A 2AQHA 3CUKA 3N58A 4NNJA 2ZYDA 4JNKA 1M66A 2VHVA 4HNHA 1J4AA 1I32A 1CDOA 2JCYA 3CPSA 3CH6A 1K5HA 3E8XA 3VZQA 3EHEA 4B3IA 1PIWA 1I2CA 3GVCA 2P5YA 3AUSA 1DLIA 4IGEA 3X2FA 3KYCB 4ZICA 3I83A 1U8XX 3OA0A 1B8UA 3WYCA 2O2SA 1B0AA 1I3MA 4IDFA 5TQVA 2DTEA 4ILKA 3ZU3A 1PSDA 4BO0A 4KOAA 4GQAA 3MOIA 2EGGA 3RU9A 3S1LA 1BXZA 3EAGA 3WXBA 1ISMA 3PHJA 1WDLA 1N92A 2HRZA 2ZCVA 4R9SA 4BNXA 2D59A 3A4VA 5JDCA 1I0ZA 4W99A 4R1NA 2QYTA 2Y1GA 4YEDA 3LF2A 3GOHA 3QVSA 5MDHA 5L7TA 5A9TA 4FFOA 4AJHA 1ENYA 5F5LA 2EW8A 4J9VA 3HB4X 4D0RA 2Y1CA 1P0FA 4Z9YA 3PLNA 3PQEA 3GRPA 3MJSA 2H1SA 3FN4A 3SJUA 4BMNA 1VRWA 2FP4A 3I9MA 4D44A 2B37A 4ZQBA 1VKOA 2R2GA 1GQQA 4BV9A 1BDBA 1ZMTA 2J5RA 4D0SA 2CF6A 3O8QA 1E92A 3K96A 3AY3A 1DC3A 1BRMA 3V2UA 1SMKA 4HFNA 4NIMA 4KUGA 5TJ9A 1Y5RA 1PGJA 2GYYA 1QYXA 4B7UA 3L9XA 4DBVO 5KVSA 3T4XA 3I4FA 4IMRA 1C1DA 1PJBA 2WM3A 1DHRA 3BMNB 1ZFNA 5JW6A 2X0IA 4MVJF 9LDBA 3TWOA 1GEEA 4RPKA 4UEKA 1HLPA 4A26A 3ENNA 3KRTA 2QRLA 1Y8RB 3EVNA 2VCYA 1AHIA 3Q3CA 4LMPA 4ZQEA 3DOOA 3OSUA 1UDAA 2YQ5A 1P44A 1GEGA 4GSKA 3E18A 3ROQA 3DZKA 4BO2A 4MVJP 3SC6A 3RBZA 3EGOA 3VPGA 1HDCA 2W90A 2D5CA 1ZSYA 3ROKA 2VHXA 4K9DA 4E2YA 1UR5A 4CMJA 4N5LA 2PLAA 1SOWA 4WEOA 5JDIC 2D2IA 2Q45A 2FPPA 3AK4A 1UDBA 3PGJA 3ULKA 3PQDA 5EMHA 3L4BA 4EBFA 2C7VA 1UH5A 3WSVA 1YDWA 1CWUA 4AFNA 4MKRA 2C59A 2HMSA 3BZUA 1Z74A 2V65A 3C7DB 4YAJA 5IZCA 1DOHA 3I9JA 3U62A 1DXYA 4YAEA 3KM0A 3TZCA 4YXFA 3BTUA 4PG7A 2NU8A 4XR9A 2Y68A 3H5AA 4PLWA 2Q1SA 4J4TA 1NFRA 3JQGB 2ZB4A 3DZGA 2W98A 4RL6A 2XOXA 1WNTA 5AYVA 1F0YA 2X8LA 1C0KA 5G4KA 3VKVA 3ZWVA 5C5IA 4CM8A 3DMYA 1VJTA 2X5KO 4A73A 4WLFA 4RVGA 3DBLB 4BO9A 1QLHA 1WWKA 1YVEI 3TL2A 1KOLA 3PYMA 3CE6A 4FOOA 2PR2A 4BNNA 3DR3A 5F3RA 3DEYX 3C8MA 4BOYA 4E5YA 3FD8A 1A72A 4HV4A 4CMCA 3RC9A 2JFFA 3W8EA 1Z73A 2ZTMA 4LN1A 3Q9UA 4MP3A 1IYZA 4WNIA 5AOVA 4J1NA 1X0XA 4OKIA 3H9JA 4PIVA 4JBIA 4QSMA 3SVTA 1Y8QA 1A5ZA 5IDXA 3JQBA 3LLVA 2BKAA 4JX8A 1NFFA 2AQKA 5F1OA 1OAAA 4JJIA 4I5EA 2D3TA 2Y0DA 3MJEA 1SZJG 2HKIA 4NJOA 3QA9A 5G0SA 5ILGA 4RORA 1HYGA 3VPHA 4BQPA 3JD2A 3Q2KA 1NVMB 4AVYA 1GPDG 3WIDA 1HDOA 5IAAA 2Q2WA 3DFZA 3K73O 2ZTUA 1KYQA 3ZNNA 5JC1A 4F3YA 1T1SA 1XLTA 3ETGA 4GWGA 1E3WA 1DRUA 4GAEA 4J90A 4UUMA 1U3WA 4JGBA 1E3JA 5JPIA 2AEJA 1U1IA 5A3JA 4YT5A 1WLYA 1IE3A 4YAGA 1LRJA 4CM7A 1LI4A 3PYXA 1N8KA 5KVVA 3ZNQA 3NT2A 2EHDA 1O94A 1EBUA 2OXIA 2FPGA 3EK2A 4B8WA 1LC0A 3F9IA 5HS4A 5EL0A 3OQ1A 1SEPA 2UYYA 1UP4A 4FDAA 5GZ6A 3QLJA 3TL3A 1K89A 1XHLA 1YQGA 4NU6A 4WCFC 4NK5A 1BGVA 4KQXA 4TRRA 3ZGYA 1W4ZA 2C2YA 5JMWA 1E3EA 3GZ4A 3AUUA 1R4NB 3IQDB 4IIUA 1SBYA 1GV1A 3FNHA 4GMFA 3TPCA 1Y81A 3AUAA 1DFGA 1GD1O 3FPLA 4I1IA 2VTEA 1H9AA 3BMQB 1PL7A 1PEDA 4RZHA 1RM0A 5BSFA 3H9UA 4YACA 3SX2A 2IYOA 3E48A 3VC7A 4CL8A 3RU7A 4A27A 1XWFA 1XSEA 1PJ3A 2P9EA 3IL2A 5C7LO 2JJYA 3QVWA 2Y1OA 3RBXA 3ROPA 3ZWXA 3PJDA 4ZJUA 2J3JA 2PFGA 3F46A 4PLGA 1Z75A 1DB3A 5FF9A 3C7AA 2QG4A 3ZHXA 4AJNA 3WYBA 4OJNA 4CL3A 2IEBA 4PLZA 4WCDA 5KVQA 4UEOA 3U9LA 3G17A 1BW9A 2RH4A 4EI2A 4GVXA 1U4OA 3F47A 7ADHA 2YYYA 4J4BA 3TSCA 1BSVA 4U0JA 3L4BC 4DC1A 3H6KA 4OXKA 4CM4A 1QSGA 4BNTA 3PWKA 3CXRA 3GY0A 2CVZA 1LDNA 3SJ7A 3HFSA 2VYVA 5A9SB 4F6LA 4XIJA 3DWFA 4DVJA 1QRRA 4BB5A 1YOVA 2BRUA 3AM5A 5FI5A 3FWZA 5L51A 3AFMA 2Q4BA 3VDQA 1C3VA 2DBRA 3GF4A 2YV2A 2J3HA 1KC3A 3UN1A 2I67A 4E6PA 1N9GB 4GKVA 1LC3A 2PZKA 4E5KA 3I3OA 1DIRA 1PJTA 3JD0A 4GX5A 1H94A 3QWIA 1EFLA 4FW8A 3V5NA 1EE2A 3GNTA 1SAYA 1W8DA 4NK4A 4FS3A 1E3IA 1EUCA 2PK3A 2Q1UA 4IXTA 3E9MA 3G79A 2V6BA 3BHMA 2WMDA 4NFSA 3IAHA 3JQ7B 2QYSA 4C4OA 4D43A 1T2CA 2OO5A 5IN4A 5A06A 1Y6JA 4Y9DA 4EDFA 1I2BA 4HUJA 3TJRA 3R3JA 2W4QA 3ZW8A 1GZ3A 1K2WA 2PGJA 3UW3A 4LCJA 4FCCA 4TZTA 5ES3A 1E3WB 3O8QB 3PHHA 2B35A 2CF5A 3SBOA 1AGNA 4LVCA 3Q0EA 4BNLA 3P19A 3B1JA 2Q4EA 3EZLA 2WEKA 1P77A 4XX0A 1U3VA 4YJFB 2VHWA 1IB6A 3RASA 2NTNA 1JN0A 2DBQA 3JQAD 1BW9B 4YJDA 2QX7A 1EMDA 3AJRA 2NV6A 4R41A 3ST7A 5C7OO 2HCTA 3IMFA 1U8FO 1SEVA 2HDHA 3C1OA 3FPCA 3RUIA 4M49A 3QP9A 5F5NA 3MWEB 1NASA 3UCEA 4MVJD 2P4HX 1NR1A 4XRGA 4OQYA 5DP1A 3ITKA 1NM5A 4M86A 3PZBA 2UDPA 5CEEA 1VL0A 2OUIA 3JQDA 5COBA 3QVTA 4RDHA 1FDSA 3OP4A 2HSDA 4EUHA 3UH1A 2EP5A 2JD2A 1KBZA 3DQPA 3PTZA 1GQ2A 4AJJA 3MWDB 3AU9A 1CRWG 2C07A 3KHUA 4CM5A 2BLLA 4MKZA 1NQ5A 4IQGA 5JC8A 5KJEA 4WPGA 3KLMX 2EXXA 4P38A 3ENKA 4P4NA 5GMOA 1XDWA 3E03A 3BXXA 1YO6A 2NUAA 3I52A 1FF9A 4WLVA 4JBHA 5TIIA 3DBHA 1DC4A 4BKOA 2JFGA 2QHXA 1NVTA 3AOGA 4QECA 4EW6A 4JJFA 3MOGA 3L6OO 4CV2A 1UXKA 3D4NA 3RUDA 1ZXLA 2X0RA 4Z0HO 4LK3A 2PKQO 1LX6A 5DOZA 1WDKA 2C5EA 2ZYAA 4E2WA 2XXJA 4PVCA 1AN9A 4JIGA 1HDGO 1NBOA 1PX0A 1FDTA 3DOCA 2EJWA 4E33A 5K0ZA 3UKOA 1KEVA 3I1JA 1N5DA 1RM5A 4AG3A 4D79A 1ADGA 3FBGA 3L07A 2H5LA 5C3MA 2X58A 2RH8A 1HE3A 2PZMA 4D46A 3QHAA 3DC2A 3TN7A 2CMDA 2P4QA 2FR8A 3DBRA 2HLPA 4PG4A 4BNVA 1MV8A 5KTKA 3RROA 4GSLA 3HJAA 4HY3A 3F5QA 3HDJA 3G0OA 2E6UX 3DXFA 4Q3AA 5IN5A 1SCUA 3JQFC 4MKXA 2WWRA 3Q6IA 3GVPA 2XXBA 1WAMA 2RIRA 1DFIA 2OORA 2FMUA 4CM3A 3OQ6A 4BKPA 1Q0QA 1LA2A 2GPTA 1EZ4A 5U4QA 5DBGA 1ZIDA 2D0IA 4WLEA 3ZV3A 3FTPA 2I65A 3HUDA 4J9UE 5L3ZA 1T25A 4WOKA 4BGIA 2P68A 4EJMA 1TT5A 3OMLA 4A5OA 4CLHA 3MJCA 1HRDA 5LC1A 4IDEA 4JK3A 1VL8A 4BNJA 2VN8A 3GG2A 1H2HA 3RC1A 4D3SA 2OBNA 4Q3EA 1JDJA 2X9GA 1D7OA 3JQ9A 2G5CA 4ND4A 4XWYA 4QO7A 3WQRA 3ANNA 1V3VA 2IYPA 3BHJA 1R37A 4DGSA 1QV7A 4NBTA 2WYWA 1M2WA 5GZ1A 3M1LA 5BNFA 3PK0A 2BF7A 2FOIA 1OMOA 2HQ1A 1W6UA 4MDHA 4R4JA 5G0VA 3EY4A 3EDMA 4P22A 1MGOA 3Q1LA 2YY7A 4IDCA 3RCBA 3CMMA 5COAA 2C0CA 1YL5A 3DBHB 2AA3A 3OETA 1CJCA 2Y99A 4BO3A 3O9ZA 3PI7A 3AOEA 3ZWMA 4CQLB 2Q46A 3GQVA 3OIFA 4XZ3A 1NQOA 3JTMA 4MOWA 1ZW1A 4GX1A 3T4EA 3TZQA 1NAHA 1I8TA 3K5PA 1ZEMA 1R0KA 2X23A 4FB5A 4IS2A 1I36A 3TOZA 2DUWA 1N9GA 2VT2A 4OIMA 1GUZA 3TZHA 4YRBA 4WK6A 3PEFA 4BNYA 4NBRA 1DRVA 4WJZA 4CLXA 3DZHA 4ZD6A 4IS3A 2GLXA 1ISHA 5JXWA 4HFRA 4FOSA 5JAQA 1Q0LA 1HE4A 2Q1WA 5CPBA 4G81A 2GZ2A 3DBLA 4TSKA 2FN7A 5A9SA 1ZVMA 3K31A 4CR8A 1H6BA 1O6ZA 3GK3A 3V1TC 3GFBA 3GGOA 2UV8A 2D4AA 4RVSA 3IP3A 4NHEA 1M6HA 3Q9NA 1HSOA 3K8ZA 1UDCA 2WD7A 2EEZA 2QRJA 1GYRA 2Q99A 3GPDG 5I7VA 3ZWOA 2CVQA 4O59O 1ISGA 2YV3A 1EUDA 3MJ4A 4OGWA 4J1QA 4KUHA 3QV1A 3RWBA 4JQCA 2AG5A 4DIOA 3KSZO 4ZHSA 1AUPA 5KJCA 2GCGA 4GGOA 1UZLA 3HNPA 1PZFA 1ULSA 3P2OA 1LLDA 5JCJA 5L40A 3QSGA 4OO3A 1M75A 3ZU2A 4BNZA 5KIAA 5JCXA 4KUEA 2Y66A 3H4VA 2X1HA 1EUZA 5G0UA 1YKFA 3CMCO 3N74A 4BIIA 5CG2A 3GDGA 2O3UA 4N5MA 4PLHA 3KSUA 4NU5A 5LDHA 1YQDA 4JCOA 4YQZA 1KVSA 3OJEA 4LSWA 5DN9A 1A7AA 4RF5A 1DEHA 4RVDA 4DUPA 3TOXA 5THQA 4I9UA 4AJKA 5JYEA 3PWSA 3SC4A 2ZB3A 5HBRA 1LUAA 4LVUA 4JXKA 4NDNE 3RJ9A 3K2EA 2E37A 4L9RA 4E5NA 1ORRA 5G2OA 3ETDA 3B1FA 3CKYA 1IZ9A 2Q50A 2VRCD 3E82A 4XQ9A 1E6EA 5AXCA 2BFPA 3B1KA 1D4FA 4IINA 1GV0A 2LDBA 3P2YA 1G0NA 3V2GA 4WLOA 2IDZA 3GVXA 3D3EA 3ADOA 5L4NA 2TMDA 2EGHA 4BMVA 5GY7A 4CUZA 2EP7A 4R3WA 3W8FA 3PYLA 2J6IA 3K2BA 1XKQA 3PLRA 1VJ0A 1E7WA 3AUTA 1CETA 4BV8A 3DMTC 2GASA 3AM4A 3BMCB 1R12A 4XYGA 1YB1A 4EUFA 4F6CA 1OOEA 2B69A 4IZIA 5FFFA 5IJZA 4CMKA 5G4KB 1E77A 3F3SA 3KYBA 4MVJI 4O5OA 4L74A 3H7AA 4JBGA 3WIEA 2GRAA 4BO7A 1DIBA 1QMGA 4J0FA 4K6FA 3KETA 3HB5X 4RF2A 3RFXA 4R69A 4QUKA 4PLTA 4OAQA 1I10A 3HG7A 5JFOA 2DU8A 4HFMA 1NR7A 3JV7A 4ND5A 3K92A 2V6MA 4XQEA 2ZJ1A 1SB8A 2ZATA 1G6KA 3P7MA 4N18A 4UVIA 5JCJD 1SNYA 1ZK2A 4R01A 4R5MA 3OECA 3AWDA 2GN9A 3RAJA 3VH4A 2Y93A 4PLVA 3LU1A 1B15A 5T8KA 3ZHZA 2POQX 2NM0A 5HTOA 1QP8A 5I8ZA 1ADBA 4W4TA 4IGFA 1U28A 2C7GA 4PG6A 1L1FA 5U9CA 2X9VA 4NMHA 2I66A 4AL4A 4B4OA 3GFGA 1LSJA 7MDHA 5K6AC 1K0UA 3IIEA 2OP0A 1I24A 5K6AA 2YDYA 1MXFA 1ZSVA 3UCFA 2W2LA 1DLJA 3QW2A 4YT2A 4YQYA 1GYPA 2LDXA 3IJRA 1LSUA 3T7CA 2D1YA 3PJGA 4ID9A 1X7HA 4FGSA 3LYLA 4L75A 4GBJA 2O7SA 5DP2A 2TMGA 1KEUA 1P0CA 2OGUA 3NDRA 3PP8A 4RGBA 4CR7A 3DTYA 4I8XA 3HDYA 1GUFA 1S6YA 2VWQA 4MIOA 4IDBA 3B70A 3RBVA 4CLOA 5IZ4A 5JYDA 3OJ0A 1ZBQA 4HXYA 3KYDA 4UREA 3RSHA 3VKUA 3WB9A 1X7GA 3TQHA 2AG8A 5BNTA 5AXBA 4RVFA 2W8ZA 2CDAA 2FPIA 1FMCA 5TC4A 2F1KA 1Z82A 2ZQYA 5TT0A 4B79A 5ADHA 5IDWA 2NVUA 5EESA 2B83A 3UGKA 4TWRA 4CQMA 1ADFA 3WDSA 3MTGA 5A05A 3LC2O 5A03A 1EK5A 3RFTA 2PGDA 4S1VA 4ZQHA 1MP0A 3ZWAA 3JQCA 1JU9A 4DL9A 1DIAA 4DQUA 3NJ8A 1HXHA 4E13A 4AICA 4IM7A 1E7MA 4PZEA 4AJIA 1EFKA 4CODB 5B4VA 3MJTA 4KDEA 5TS3A 5DBIA 1U5AA 1KVUA 2X0NA 1P45A 4XR4A 2AHRA 4U5QA 3WJAA 1A9YA 1J49A 3NT5A 4D41A 1ISJA 1V0JA 3KUXA 4PVDA 2FRDA 4FGWA 4Q3DA 3EMKA 3JQFA 1PJSA 2EWMA 3JQBC 1V3TA 1CF2O 1HE5A 2JD1A 3PIIA 3S8MA 4I9HA 2EG9A 2PD6A 2FZWA 4XCVA 3OFSA 8ADHA 5L4LA 4BO8A 2JFHA 4BNKA 5I9LA 1J5PA 3CTMA 3N7UA 4DA9A 4N7RA 4DREA 3INGA 5HS6A 5EQDA 4K26A 4XDZA 3WX0A 3PQFA 3R6DA 4F46A 3K9QO 1LQUA 1CERA 1YOVB 3ON5A 2DBVO 3FF4A 3FNEA 1AE1A 3A9WA 5HM8A 3O26A 2OZPA 2RAFA 4CUJA 4LSMA 3AFNA 3E5MA 4PLFA 1R0SA 3E9QA 4XYBA 1ID1A 1TT7A 1YXMA 2YQ4A 2VOEA 3TF5A 2O3SA 1M76A 1ZK4A 3U4DA 4A7PA 4ZN6A 3RUFA 3A1NA 4INAA 2WYVA 3GUYA 2FR1A 1ZH8A 1FXSA 3D1LA 2I5PO 3D4OA 1PL6A 1B3RA 2FHSA 5ITWA 5CPFA 2O3QA 1YBAA 4E5PA 5A4DA 3FI9A 2BGMA 3GG9A 4ZGWA 1E1MA 2DTDA 4G65A 3U4HA 4J1TA 1JA9A 4E2XA 5C37A 2I76A 5DOVA 5EJ2A 4OOEA 4TROA 4M1QA 4Y67A 4FSHA 4QO8A 1MA0A 2A4KA 1U4SA 2E49A 3WMWA 4CUKA 1Y9EA 1KY4A 4L0QA 3F1LA 1JVBA 2HK8A 2O3RA 3WFJA 4CMEC 2EJVA 3UUWA 2R00A 1KY5A 1RM3A 1A71A 3JQ7A 1DDOA 2QRKA 1LLQA 2GZ3A 4YT8A 4XJTA 3WGZA 3KOUA 1JW9B 3FBTA 3ZHBA 1UAGA 4DMLA 1ADCA 3GZNB 3HZZA 1LXCA 2DAPA 3GNSA 3FRJA 1DFHA 3PIDA 1Z6ZA 5A1TA 2YV1A 5B37A 1NAIA 2EERA 1VLLA 1I3LA 3I9LA 4UEJA 4XB2A 5T5QA 4BO1A 3NDIA 3R0IA 4Y6SA 5KCZA 2JL1A 2NVUB 1RPNA 1D3AA 1HDRA 1VM6A 4B4WA 1ZEJA 3GDFA 2FSSA 2FY8A 5JAZA 1SPXA 2UVDA 3QRWA 1EVJA 4M89A 3WGYA 3VVCA 2P9GA 1DO8A 1QG6A 1E0DA 2Q2QA 1OI7A 4W7HA 3H2SA 2HK7A 3WFIA 4B7CA 5MGBA 1E5LA 2JAHA 4MINA 1N2SA 4YPOA 1BWSA 4XRRA 1YBVA 5CHEA 3FWNA 1CQIA 5ICMA 2AEFA 1VKNA 3DL2A 3E9NA 1HTBA 1D1SA 1P1RA 3O4RA 5CAEA 5F1KA 4RPHA 1ZCJA 4Q9NA 3U09A 4RQTA 3INRA 4CV3A 4A10A 5BSEA 4KTVE 2A92A 3WWYA 2IZ1A 1P1FA 2G1UA 1LJ8A 2QIOA 1EQ2A 3DTTA 1FK8A 1PR9A 1HDXA 2GNAA 5J23A 1PWXA 4LISA 4I5DA 4MP8A 4RO0A 4JN6B 4YRDA 4BNWA 4BUCA 2V6GA 3PDUA 4AJLA 3FHLA 1EK6A 1BHSA 2Q3EA 2Z5LA 1LDYA 4RZIA 3JQ8A 4DIBA 2VZ9A 5JY6A 4IDDA 1Z7EA 2DFVA 2UAGA 4YR9A 1ONPA 3KYCA 3BMQA 4XA8A 3VPFA 1T2DA 3WQQA 3ZCXA 2RBEA 4Z3DA 1N1EA 4DIFA 5KVCA 3PHIA 1T24A 2EV9A 1ISFA 5A04A 4PN3A 4U8GA 5L7WA 4J7UA 2CVOA 4ZA2A 3NJ4A 2W2KB 4II2A 3ASVA 5JO9A 1DBVO 3WTCA 2YDXA 4UAGA 1V9LA 1LRLA 4BQRA 3ZU4A 2B36A 4GI2A 2VRCA 2H9IA 4QTZA 4BNIA 3U3XA 3EYWA 5DDIP 1B16A 3GMSA 1V3UA 1DIGA 5CDYA 3BIOA 4G2NA 1UP7A 3BHIA 3TFQA 2P5UA 1ENPA 2GF2A 4P8RA 2Z1NA 4OSOA 2VHZA 4IZHA 3GEDA 3GR6A 1YL7A 4FPXA 3CZMA 4NQZA 5IXSA 4L76A 1QR6A 3G1TA 3W4IA 1I2ZA 1K6IA 3QWBA 3I4CA 4PFJA 4RVHA 3H8VA 1JWBB 2X9NA 2JHFA 2NWQA 2IE0A 3ORFA 1GU7A 4MIYA 4NH4A 2PTGA 4G5HA 2VRBA 4YJFA 5IFLA 3NEPX 1P1IA 1PQPA 2AQ8A 3F5SA 3AY7A 3HN2A 3K6JA 4P4LA 2BH9A 4IXWA 2GR9A 2JCVA 1NXQA 1A9ZA 1P1HA 1TLTA 3ICCA 1C0IA 1QV6A 4J1SA 4R1TA 3QWFA 3WBBA 2WE8A 4MVJA 1QXSA 3WGOA 4YA6A 1IZ0A 1NX6A 3UICA 3RI3A 1BTOA 1QKIA 3OHSX 4DQVA 3DFUA 1K6XA 5A3VA 4CR6A 4BGVA 4HADA 1WP4A 1E7YA 1UXIA 3UVEA 4BNFA 1XG5A 5B4UA 3EVTA 2VHYA 3I9KA 4UUPA 3S2IA 3WR5A 3PFFA 1O5IA 3LT2A 4OH1A 3LT4A 2P91A 4E31A 2BFAA 3FTNA 3WGTA 3CIFA 4CMAA 2HUNA 3VH2A 3JYNA 4TRMA 1B14A 2J8ZA 2VOJA 3ROMA 4ALNA 1H6CA 3LT1A 3ZNPA 2GN6A 2P2SA 3HDQA 3MTJA 2Q49A 2ZJ0A 3IP1A 1L7DA 1LLUA 3JYOA 3OJLA 3RC7A 4C7KA 4FR5A 2X22A 3VZPA 4JLWA 1DIHA 4ND2A 4P4GA 5DF1A 3FNGA 1ARZA 1PTJA 1X14A 1C1DB 3GN2A 3R1IA 3RJ5A 1VSVA 2NADA 1G1AA 3SEFA 3V1UA 2EW2A 1NFQA 3OIGA 3IOYA 3WS7A 3S2FA 3JQAA 3L6DA 3PVZA 2Y0EA 2OBYA 2IXAA 3AY6A 1P74A 4RQUA 2VTDA 1N1GA 3B6ZA 4RV9A 4TRNA 1B8VA 1N7HA 1H9BA 1WMAA 5TX7A 3D0OA 2QZZA 2J5QA 4Q3CA 1LDEA 3RUAA 2VQ3A 3KV3O 1EDZA 1HE2A 1I3NA 2AMFA 3H2ZA 4EJ6A 4AJ4A 3ZV4A 1TXGA 2WJPA 2D8AA 2IZZA 4UVEA 1U3UA 4R51A 1I01A 5KKCA 1Y8QB 4BVAA 1T2FA 9LDTA 2C82A 3E6AA 3PZRA 2OP1A 1U7TA 4IUYA 3PHGA 1B2LA 3INTA 1LNQA 3PXXA 3D3WB 3OJOA 2PZLA 2B4TO 2C2XA 4CMIA 1M67A 4RPGA 3CZRA 3GC6A 2I99A 1EVZA 1F14A 4MVJG 4DWVA 5CG1A 1O9BA 1GAEO 3TZKA 2VWHA 1LDBA 2E48A 2HJRA 4XQCA 2ZQZA 4D3FA 1EBFA 3M2TA 2QW8A 4IJUA 4B3JA 4CV0A 4OSPA 3ZWBA 4UVDA 3QIVA 5DCYA 2G17A 4HBGA 1O8CA 4Z9XA 2H63A 2JAPA 4FD3A 4Z3KA 2A94A 1DAOA 1RJWA 1PZHA 1ZK3A 4QFCA 4CM4B 3RKRA 3H9EO 3DAGA 2VZ8A 4ALJA 2VUTA 3JD3A 5A5EA 3GHYA 4E12A 3MJVA 4RF4A 1PJ4A 1GZ4A 4NFHA 4W9NA 4GGPA 4QQRA 1ENOA 4OL9A 3LDHA 3NT4A 3D7LA 3BMOA 5B4TA 4GPD1 1DRWA 1PJ2A 5FYDA 4W7IA 3GVHA 5K9ZA 1LEHA 2YZ7A 4W6ZA 4H15A 1R4MA 2Q1TA 1ZKMA 2CDBA 4A2CA 3WNVA 4WKGA 5HA5A 1E3LA 2VNAA 3JSAA 3JYQA 4M55A 2YUTA 4NBVA 3GEMA 3NV9A 1KVRA 2OFPA 5TNXA 1RM4A 2R6JA 3RC2A 3JYPA 8LDHA 3NX4A 4XGKA 4TMFA 1MC5A 3GPIA 3DZBA 1P33A 1X0VA 2NU9A 2JKVA 4YT4A 4FBGA 4UVGA 1BG6A 1MG0A 3ZWWA 1JTVA 1FDVA 2BGKA 1HWYA 2JCXA 5H82A 1YDEA 3L9WA 1NP3A 1U2DA 4XKJA 1ISIA 4BKRA 1YB5A 2O3TA 3JQEA 5A5FA 4O0LA 5CDUA 5TRTA 3GZNA 1GDHA 2EF1A 1ZK1A 5BR7A 4R1UA 2PD3A 1HZZA 1I3KA 3AI2A 3CSDA 1LSOA 4EYEA 4I08A 3STHA 4CLRB 1PWZA 4TVOA 4FFPA 4U6QA 3H65A 4EZBA 4CPDA 1O95A 1PZEA 3ETEA 1MC4A 3W8DA 3JYLA 3OICA 4IDAA 3HDHA 2AXQA 1E1KA 4B4VA 1KEPA 1QYCA 3RIHA 2O48X 4TRJA 1R16A 1M6WA 4PG8A 1GYQA 3UF0A 1LBEA 2DM6A 4J16A 1IHXA 1YBMA 4L8VA 4Y98A 1CEQA 3QVXA 4RPJA 4DPKA 4ND1A 4J49A 3TNLA 5COQA 4CQLA 1HLDA 1P3DA 1R4MB 4KQWA 3HHPA 4NBWA 2WSBA 3QWAA 1R0LA 3PGXA 1I5RA 1YB4A 3W6UA 1X15A 2NTJA 1NYTA 5AXAA 1OZAA 4I9NA 4DPLA 5L45A 1XYGA 1VL6A 1H6DA 4CMEA 4J7XA 3OBBA 4MJLA 4NR0A 4H16A 4O6VA 4YTEA 2Y1EA 4QT0A 3I6IA 4NPCA 3DAPA 2DKNA 5EERA 4OXYA 3TDKA 3IKVA 5F1PA 2ET6A 1CYDA 1Q0HA 2Y0CA 1E6UA 2YJZA 3RKUA 3LZ6A 4ZRMA 3LT0A 4M54A 4U7WA 1MFPA 4GLOA 1P1KA 5JDIA 5JBIA 1HEUA 3U5TA 2IRWA 4HP8A 4BGEA 3DZIA 5IF3A 3BA1A 4BO6A 1UXJA 1V35A 2OOSA 5TSDA 3ONDA 2NNLD 1XR3A 2PH5A 2NQTA 4YYZA 2QZ9A 3DONA 5L7YA 4D7AA 1E1NA 1XIVA 3AOEC 1J6UA 3OH8A 4PLPA 4KTTE 5G0WA 1LQTA 3GN1A 3HFGA 4LRTB 1HKUA 5AXDA 1EEHA 1GADO 3BTVA 3HN7A 4PLYA 5JY1A 3JD4A 1Y7TA 5CDGA 5JSFA 3FCOA 2JHGA 5AVOA 2WD8A 4AJ2A 1E3SA 1AHHA 1QYVA 2C29D 1XQ1A 1ZZEA 3E5RA 1VI2A 5L53A 4J4HA 4N54A 5ITVA 3WGIA 4AJEA 3JD1A 1YE3A 5C7IO 2X5JO 2ZCUA 1QLJA 2CD9A 1Y5MA 1PZGA 4L73A 3RVDA 4CM9D 4ESOA 3ZW9A 3OQBA 1EQUA 3GHHA 1IPFA 5GZ3A 2ILTA 3DBRB 4E30A 2OMEA 4XD2A 4NJMB 4E3ZA 1NNUA 6ADHA 1E5QA 2O2YA 3ZU5A 4YJHB 3VAZA 2DT5A 1GUYA 4FC7A 2DBZA 3IDSA 1LLCA 4OHUA 3ICPA 5TJHA 1W0CA 5T6BA 3TFOA 4ZQFA 1G0OA 3GAZA 1AXEA 1WMBA 1O0SA 4JP3A 3PFWO 4OXNA 4CMGA 3LQFA 4KDFA 2PKRA 4CMHA 2CNBA 2EKQA 3C3XA 3D5TA 1ZSNA 1V8BA 3LC7O 4CMBA 5BSGA 5KOIA 2R00C 4KMSA 3KZVA 1BXKA 2E82A 4S3MA 1LU9A 3C24A 3FNFA 3OEWA 4QX6A 5DULA 3NTRA 4URFA 4OM8A 4E21A 1KVTA 4MIEA 4BS9A 1T2EA 5CFZA 1PS9A 3DHNA 4MP6A 4PZCA 4ND3A 1MXHA 2NQ8A 4HFJA 3QWHA 2PY6A 4EGFA 1ZJYA 5LCXA 1KS9A 3VDRA 1B3BA 2QQ5A 1S7CA 4IJKA 4YAIA 1HZJA 2Y67A 4II3A 5IG2A 5KJ6A 4FQ8A 1PGQA 1XELA 1MX3A 4A0SA 2F00A 2Z1MA 1UZNA 3NGLA 4DLAA 1HT0A 4R3NA 2G0TA 1C0LA 1GCOA 1Q7CA 3G1UA 2ZB8A 3X2EA 2DLDA 4FJ0A 3W4JA 1XA0A 3MZ0A 4ONEA 4CM8B 2NACA 4IQ0A 4B8ZA 4LCEA 1ZNQO 4DBZA 1DHTA 1YWGO 3H5RA 3VPSA 4DYDA 1OBFO 3RFVA 1JQBA 4FFMA 1A7KA 5TLSA 4XQGA 1WZEA 4L4RA 4E0BA 2OHXA 3DBVO 1C1XA 3AW9A 4PCVA 3WMXA 2VUSA 3M2PA 3JQGA 4OMUA 3HADA 2VZ0A 4WE3A 3W4KA 4DRYA 5I7SA 4GVLA 1GPJA 2EKLA 5JAIA 1F17A 4UULA 5U1PA 4L4SA 1R66A 5L4SA 3H9QA 1ZO8A 1GTMA 4TZKA 2AQIA 2GDZA 3COSA 3RUEA 1ONNA 1X13A 2HMWA 1PJLA 5ENDA 3ZNOA 4PLCA 2J5KA 3V8BA 1H5QA 3S55A 3FR8A 4YJHA 3GMDA 5IZCC 4BNMA 1EVIA 3GEGA 4O63O 1U5CA 1SB9A 4XGNA 2NLOA 1KERA 1I33A 1TT5B 4PGFA 3RQSA 3KYDB 2ZIZA 1GQYA 3I5MA 3L0DA 5ER9A 4HNGA 4OKNA 1Q2XA 3F1KA 4TKLA 4MPDA 3RUHA 1BVUA 3ZZNA 4RDIA 2GN4A 2DPHA 3C7CB 5KJ1A 5T64A 1FJHA 3H3JA 4PG5A 2B4RO 3IUPA 3E1KA 2HK9A 3KEOA 1ZMOA 4CQMD 3VPXA 3VOSA 1ZUD1 3WGQA 2GO1A 2G76A 2PWZA 5DCWA 1XQ6A 3PJEA 1T2AA 3UHAA 1CIVA 1BDMA 1PQUA 2ZB7A 4WLUA 3UXYA 4FFNA 5KNLA 2O4UX 2ZTVA 4N5NA 1TB4A 3VTFA 1T1RA 5H81A 1UP6A 4D3DA 1C14A 1YJQA 1JWAB 5IDYA 1R4NA 4R9RA 1GY8A 2X4GA 3EW7A 4GX2A 2ZK7A 4MVJE 2C5AA 5G4LA 1UXGA 3WQSB 1NVGA 4BO5A 4E2ZA 1NWHA 4FC6A 5JAMA 4YJGB 2C54A 4J3FA 1IUKA 4B7XA 3CINA 2V6FA 1YQXA 5DNAA 3LSYA 4XDYA 2HJSA 5JDCC 3SLKA 4IQ8A 3K30A 4BNGA 1VJ1A 3PPIA 3Q2IA 1W73A 1PS0A 3ZV6A 2NTVA 3OM9A 4DYVA 5THKA 2DUUA 3VVBA 1I30A 1J0XO 5EIOA 4DQXA 4TQGA 4RLSA 1EE9A 1U2GA 1P31A 3KEQA 3KLPX 3VZSA 4XYEA 2YFHA 4KWHA 1PU2A 1QYDA 1F8FA 4NBUA 1GZ6A 2PH3A 1OC2A 5I9MA 3H3FA 4MVJM 1DJNA 1C0PA 3WWZA 3ZWNA 1YONA 2PNFA 3T7EA 3KBOA 3VHRA 3I9OA 4JROA 1HETA 3HWRA 3WGGA 4LGVA 3W1VA 4FJ1A 5EPOA 1WPQA 2HRBA 2WDZA 3JQ6A 4WLNA 1HSZA 1DC6A 3EC7A 3KO8A 4UUNA 4F45A 4E4YA 4RF3A 4Y6RA 2CY0A 3G3EA 4ALLA 1OC4A 2O23A 4A03A 2IZ0A 4BO4A 3WLEA 3QY9A 1R6DA 1V6AA 1X1EA 2AE1A 2CZCA 3WICA 2EKPA 1H2BA 3DMTA 4OQZA 1PGNA 3RUCA 3BTOA 1EDOA 3ONFA 4X54A 3ITDA 5A9RA 1TI7A 1XGKA 2VWGA 5T8KC 5BNIA 1T4DA 3ZN2A 5G0TA 2YW9A 4O1MA 3O38A 4B4UA 4D45A 1NPYA 3AI3A 3HSKA 2J3IA 4BB6A 1Y9AA 2BMAA 5L9AA 2WTBA 1DAPA 1EVYA 3I23A 4U6SA 3UFXA 4Z0PA 1RYDA 1WDMA 1TVEA 3KTDA 5H83A 3VZRA 2X86A 1HL3A 4NI5A 1NWCA 2NVBA 3WGHA 5HWSA 5JS6A 2NVWA 2ZTLA 4Q3BA 4UUOA 4XB1A 3DAFA 3JQAB 2BI8A 1Y1PA 1ZJZA 1F06A 4GKBA 2J3KA 4WCFA 4HKTA 3WJ7A 3IJPA 3WTBA
chains in the Genus database with same CATH superfamily
1KL7A 1E63A 3QEKA 3WAJA 4GH5A 2J32A 4RD2A 2YKGA 4KQFA 3RYFB 5ALWA 3E9CA 4G1EB 2DQ4A 5DLEA 2VQDA 1KI2A 3NNSA 1S7GA 4R8SA 3LP6A 3PC3A 2H2IA 4Q21A 3X2SA 3KVOA 1E2EA 1SOMA 2YNMA 5TGDA 2XQKA 5JO0A 1JKJA 2ZEJA 5AQ1A 4J6FA 1WXEA 1IHUA 4O4IF 4YWHA 1JQAA 2JBAB 3PFKA 4EJ2A 4GW3A 1A96A 3WG9A 1JG1A 1WOYA 3FSRA 2XT0A 3BDIA 3LO5A 5B6IA 3NYWA 2CVFA 3EXEB 1VC2A 2GHQA 2L2QA 4B5LA 3CA8A 3LOPA 4M1EA 1THTA 1X92A 1R6AA 2AFIE 2VXYA 3FRIA 4ZDJA 4LMRA 1B26A 3S2EA 1Q1NA 2MU1A 3BIJA 4CQMB 2QA5A 4CYMA 1FTGA 2HF9A 4D8XA 3O83A 2YFQA 4YUWA 1IPEA 1W96A 3MD9A 3ZVLA 1ZWKA 5AOAA 3OUUA 3HVJA 2Z95A 3OF3A 5KKAA 3J81k 5DWQA 4UNQA 5LFAA 3SVLA 2YWRA 3L8MA 1AU9A 2OAQ1 5FI3A 4CMIB 3WLFA 4Z2YA 1DO0A 3B48A 3D7SA 1R50A 3LVRE 4TQAA 1RQ2A 3GLTA 2Q07A 2Q6IA 4ATNA 2QQEA 3IO5A 3QLEA 1V16B 3VH3A 5JISA 3L0YA 4LUCA 2W2KA 1W581 2X1LA 3HRHA 3GD5A 1JG3A 5IDQA 1WCYA 4PFKA 3DEJA 4IHKA 1LDMA 3GP5A 4QT4A 3PHLA 3BERA 1A4UA 3HP7A 3Q9LA 3U1TA 4BFCA 4B47A 1USWA 5TB5A 1T0JB 2OXRA 3NHUA 4TL8A 2CCJA 2VTKA 3QE3A 5EJ9A 1E6WA 1FLVA 2YXPX 4IRUB 1Z15A 3ZGZA 3G59A 4REOA 1LSSA 1L4HA 2I9PA 3A14A 1OA0A 2GFIA 1KBQA 1KAQA 1RC0A 1UJ5A 4MW4A 1T36A 2XXAA 1MQAA 3ZK9A 1JJBA 3GLHB 3S2GA 4KXQA 2ZU0C 4RLHA 3K9NA 3AM3A 1UPBA 2C5SA 2P6PA 4Q3NA 3B13B 2F8TA 3VR5A 1Y9JA 3ELUA 4DLWA 1SVLA 4WZAB 2CL7X 1KTVA 2A3NA 6Q21A 2Q4TA 721PA 1NHWA 2QV7A 1V8PA 3COYA 4ALLA 1MV5A 3FH0A 3CY6A 4O3MA 2HTFA 4ZHQF 1NM5C 2CDCA 2EZ4A 1JTEA 2C4VA 2FPWA 1V37A 1V5EA 3C85A 4M8SA 4CHGA 4CKYA 3GLIB 1H1LA 2QX6A 1QCDA 3CONA 4Y8VA 3WNQA 1Q0ZA 3SZUA 1DJQA 4R68A 3Q3IA 3T3HA 3CPHA 1D2RA 1PGOA 2P7HA 4OB7A 3RB8A 3WOHA 3ZV5A 1JR2A 4HSEA 3VR6A 2PGLA 3F6CA 5ADWA 1N7IA 1J2RA 1XAGA 4ZWNA 3H5NA 3M3DA 2HMUA 3T3IA 3KKEA 3E81A 2B2NA 3HEBA 4DLTA 5F7OA 3ZDYB 1BXGA 2J9FB 2VYCA 5BSHA 2GK7A 3BMNA 5K8TA 2XR1A 1QFXA 4NSNA 1T1EA 1DAEA 1XL1A 1RTTA 3N53A 5E8JA 3HJTA 3E9EA 4ZOEA 2W43A 2P27A 3VU3A 1IM2A 4YJ2F 1YASA 1P4GA 3EXFA 3IC5A 3QXSA 3E7FA 1DC5A 4O2BB 2JFVA 3CV3A 4QA9A 5AKZA 1CU1A 5F21A 3ZH2A 1E7SA 1RP1A 3DEKA 1IXKA 3QXGA 4FJ2A 5EN4A 4C7JA 4F9TA 2J4CA 1BO6A 1NVVQ 2KWIA 3KLOA 2W8BB 4F97A 1ACLA 2H2HA 2ZBRA 4HR7A 1YS4A 3IAFA 2H0RA 4HB3A 4CU2A 3N2ZB 3NRCA 1H1LB 2H0AA 4EK9A 2IIBA 2KBFA 1C9YA 1UBOS 4Q93A 1XU9A 3EG9B 4F2GA 2ECFA 1HYBA 1O08A 3EUEA 4ZI7F 1W93A 5ENVA 5I4CA 1KYTA 4GLLA 1XEWX 2X5XA 4MV6A 2GPYA 3TIFA 4JP1A 5C9ZA 2O2JA 4XE5A 3EULA 4G85A 4CJXA 3DE0X 8GPBA 3W6PA 2VJOA 3PVCA 5FL3A 1Z6PA 2YJ4A 4WA8A 3RD5A 1OFUX 2ZJ8A 2M6LA 4C2UA 3CNLA 3A70A 1JDZA 1KJNA 1P6QA 2H7YA 4YROA 2PWBA 4RZUA 4DMUB 4E5MA 3N6XA 2IEYA 4NTZA 1OKKA 1DQZA 2G7ZA 1GO2A 4J7CA 4LXQA 4V39A 3GH3A 4CWAA 3BH6A 3CUEF 1MH9A 2FWAA 3S8YA 2P67A 1YL6A 4ALMA 3P9PA 5G53C 4J0JA 1U7XA 3MA0A 4R8LA 1B7GO 2J9GA 3OEYA 1QAOA 2A8YA 1CDZA 1AK2A 4ETIA 3ZPXA 5KJFA 2WF8A 4J0EA 5CEFA 4H6PA 5JXJA 4PYLA 1WZIA 1LB1B 4KO4S 1JALA 3W3ZB 3DFIA 5C35A 3RC8A 3KT6A 3B6JA 1YE8A 2XZPA 1E9SA 4R5HA 2HDWA 1R5JA 5KOHA 4UVHA 4AWBA 1T5DX 2PM8A 2ZJAA 3MT8A 2IHKA 1NW3A 5JRZA 4M9ZA 2C3PA 1GR0A 4RD3A 1NBHA 1EFDN 1VJRA 2FW8A 2OHJA 4LXGA 3GT4A 4U2EA 4XCXA 2O8DA 1XDBA 2OQIA 2WHXA 2ZRHA 3G5AA 3KJQA 4HDSB 4YNBA 1BS1A 1LTHR 4FMCB 3WISA 5E3HA 5JALA 3NDJA 3WKAA 2JBWA 2NSDA 3BBLA 1U3TA 5K4GA 1XNJA 2HRCA 4L4XA 3GGGA 1D1TA 4KZPA 3UY4A 3WWDA 1L8XA 3Q8LA 2HA7A 1FFYA 3PPYA 1D2GA 1SKQA 2AVDA 2OO3A 3WGLA 1IEXA 3BYZA 5D7NA 3MCAA 2XNJA 1ULTA 2PVCA 4CCYB 2X0JA 2WPDD 4NFYA 1MO6A 2QP9X 3OFVA 4HDOB 3V3TA 4KN9S 2V9ZA 1O4VA 3EISA 3I01M 3HDTA 4WOPA 5FPHA 3T35A 4CF6A 4U2GA 3NASA 5L3QB 2YHIB 2HUPA 3IS3A 4KI7A 2H6EA 3V4LA 1UJMA 3T8YA 1LPAB 1XA3A 2ZI3A 3OWXA 1KOFA 2QY9A 3OF2A 3B3JA 3BMOB 3WIVA 5FWNA 3A2KA 1S4MA 5K6TA 1JPJA 4RJTA 1CZKA 1Q1QA 1TKAA 1ZVQA 2I29A 2OBXA 4L2IA 4ENSA 3CX8A 4I5GA 2R7NA 1XTSA 4NZ9A 5FBVB 4AKGA 4F11A 1AF4A 2BE7A 1AXGA 3SQLA 3DF9A 2NXWA 4QBGB 2MSCB 3MRVA 4AF8A 2ABWA 5HOEA 4HTFB 3GPLA 1NHGA 5HJ2A 5CP8A 4V38A 2IS2A 3BWXA 4Q47A 3MBOA 4AJPA 4INPA 4LZNA 3BE5A 1MOQA 3KUUA 4LWQA 1DU4A 4J91A 1JDSA 4WBXC 3FOZA 5JIBA 2QNRA 3A6PC 3K9LA 3VPAA 3LPLA 1ORWA 1U9JA 8MHTA 3B82A 5E7QA 4M38A 1ONOA 2P6UA 4NPHA 2PLRA 4Y2QA 5AI8A 5FL7D 1CP2A 1MQ8B 1MAWA 2PO7A 2CCGA 3JQ9C 3OLWA 4HVCA 4CIAA 3WAGA 4BPRA 3AF6A 1UAYA 1WMFA 1J21A 4UU1A 3Q11A 1JX6A 4RA6B 3W5HA 2H51A 1UC4B 1ZISA 4FYIA 4RKFA 1RXEA 1IOVA 4IDHA 2R1TB 4Q39A 4XPIB 2BD0A 5B12A 3GFVA 4FDVA 2ZKLA 3CW9A 4AZSA 1G64A 2XMCA 3I6MA 4MO2A 5ALGA 3DZFA 1U11A 2ZB2A 4JLAA 4OJKA 3FWHA 3COZA 4TZ0A 2BEUB 1GZHB 4HX5A 1DMSA 2N9UA 4L3VA 2WU1A 4X6YA 3T6KA 4TLMB 4HH4A 4K1LA 2K7FA 1EPUA 2VWPA 4YQEA 4E7OA 3G2OA 4RK4A 1QTRA 2AZ4A 3IALA 2BZGA 3H2GA 3PRHA 2DPGA 3PE4A 5HFAA 1M2VB 2PSJA 1W46A 1FUKA 4DZRA 3LDAA 1L5QA 2V3WA 3JYHA 3U9TA 1J2EA 1XCBA 2XZOA 4WHMA 3BFJA 2WTUA 5BQXA 2G06A 3HB0A 3MMPA 3X43A 1ILEA 2COEA 5T67A 3H87A 3LKZA 3TQSA 2RC5A 3DUFB 3LGAA 1AA9A 2ETXA 2ZYHA 3AL3A 3NGXA 4IIJF 4M88A 3S2YA 1PGPA 2YIJA 2BKUA 3NKLA 4C0XA 2H3EA 4FYWA 1RVDA 1RWBA 4IMPA 1X7XB 3PRJA 2EL7A 1X86B 3ZEAA 5BURA 5D85A 2P9TA 1T6XA 4RLQA 4ALIA 2XB2A 1PYOA 3S7TA 4P54A 4W5JA 2O9JA 3DJYA 3QELB 4MS3A 3VH1A 4JUIA 5HCNA 4JFRA 1EFHA 2ZWPA 4CLDA 3AF4A 2BELA 4RVCA 4UTRA 2I34A 3W6NA 1UEXC 1Z4IA 1QK5A 1U0RA 1TIBA 4MVJH 4P80A 4WECA 4EHIA 4C4XA 3TB4A 1ATIA 5CITA 1II0A 4M36A 5EJ8A 5K6RA 4YRAA 1YNSA 2OILA 5JASA 3G9UA 4RKQA 2WJZB 3SLGA 2G82A 1T8SA 2O14A 4QUJA 3MC1A 3FOBA 3TQFA 2AC2A 2XJ4A 3R44A 5TDHA 3K71B 3N76A 3NHFA 4JAVC 1OLUB 1MNQA 1VBMA 3GJ7A 1A9SA 1XQWA 4QLAA 1KH2A 1OREA 3UMVA 4DHEA 3UBTA 2BONA 2R1VB 3CPSA 4HNHA 5KTPA 3KZXA 3O4GA 3HYSA 3LCJA 3W2HA 3WGJA 3E8XA 4L8GA 1QRDA 1QQ5A 2PVSA 3CSSA 3VZQA 2JAOA 4B3IA 5JZSA 1LFAA 3TQOA 4Z4IA 2F55A 4GIBA 3BOSA 3CUUA 1R74A 2UUBB 5BXYA 5JNWA 3RTEA 5IC6A 3H84A 1XTUA 5TS2A 2F4NA 1J00A 1XNHA 2H48A 1DPFA 5AKJA 2OKCA 1B8UA 2GJ9A 1Q1ZA 3WYCA 3EVGA 2Z56A 1ZR4A 4A0RA 4JY7A 3OHMA 1LV7A 5EWMA 4CZ2A 2I3BA 1BCSA 3LZCA 4BO0A 5LU8A 2YX1A 3WXBA 1GWNA 4AYWA 1ISMA 2FG7C 5HBGA 2COUA 1OB5A 1J9EA 2YJ5A 4Y0VA 4EECA 3ILXA 3CWCA 4G23A 2GBPA 1FIUA 1CFZA 5KYUB 5CD1A 1ZWLA 2XYGA 1U7DA 1PD1A 3GOHA 1IM8A 5DMXA 5MDHA 1WA5A 1N6PA 1O94D 2ZPAA 4EG4A 2MYPA 4FFOA 5EHIA 1D2AA 4HVLA 3HB4X 1FW6A 2C2MA 2Y1CA 4MNTA 3GRPA 1H5UA 4BMNA 1LS1A 1VRWA 4FI3F 2QZJA 4X90A 1TTQB 1ZPDA 2JCBA 2HT1A 3NHLA 5E0KB 1BDBA 1R9NA 1XCOA 3LGSA 1IK6A 1V9CA 2AF4C 3L7AA 5BW6B 2CE7A 3TW6A 3OIUA 4NQRA 4Y3UA 1N5KA 3KOZA 3AGQA 3AR2A 1Z2EA 1DINA 1BRMA 3VI4B 4BGDA 2VPPA 2WSLA 2DR2A 4PR3A 3BE6A 4RA6A 2CJXA 3BJMA 3I37X 3T34A 1YRYE 4BDTA 2EQBA 4KUGA 1GQFA 4DHWA 1Q95A 4I50B 4ECAA 1ZIYA 1Y5RA 4ERXA 5ITZB 1CZHA 1ZNXA 2NXEA 1PNOA 3L9XA 3I4FA 2F9MA 4EH1A 2FV8A 2V5UA 1GU0A 1PJBA 2WM3A 3PXAA 4IMRA 1DHRA 3VR6D 4KXUA 2BMDA 4RAQA 3DVLA 4CIWA 2ENUA 3FPFA 1XYYA 9LDBA 1GEEA 4UEKA 5EP4A 1FLDA 2GJKA 1G8KA 1T3ZA 2NZ8A 4BRUA 1OXBB 5ALNA 3TOCA 3USCS 2VCYA 1XTZA 1AHIA 4L5AA 4RKWA 2FN3A 4O33A 1TMOA 1VJCA 3L8HA 1N7JA 4H17A 4K9LA 4KQ9A 2KI5A 4KAXA 1D5CA 4MGHA 2WJVA 3HN6A 3DZKA 5ALTA 2VF4X 3D0KA 4MVJP 2IXGA 2J3DA 1J90A 3EGOA 3RBZA 1JR3A 5HKOA 2C7RA 4PFQA 1HDCA 2W90A 3QYJA 2CJYA 2VJKA 3TEFA 3ROKA 4YP7A 3OZIA 4WD3A 5A4AA 1UR5A 2HEGA 3EYAA 2PLAA 1SOWA 4WEOA 3EXIB 3K15A 3QUAA 4ZJYA 4O2AA 2B1IA 3R8CA 3AK4A 1UDBA 1SQSA 3E2MA 3OZEA 5BV1A 3PQDA 3L4BA 4TYPA 1CZUA 2HNKA 4PYQA 4EBFA 2G28A 3GH1A 2C7VA 1KA9H 1UH5A 3V9PA 4KNWA 5IPFA 3BL6A 3JWJA 1E3MA 4J1JA 1MVLA 1Y5NA 3BZUA 5IP5A 3ZE1B 1JH8A 2GM3A 3MG9A 1NX9A 2JFWA 4YAEA 4JFAA 3BTUA 1L5GB 3MXTA 1T0UA 3O91A 2Y68A 2LKDA 4PLWA 2BRUC 1JDPA 5EJGA 1Y4DE 1NFRA 1YS2X 2GEKA 4H4CA 2O19A 2ZB4A 1XFDA 3DZGA 2I6UA 3NO4A 1WNTA 4GD3Q 1F0YA 4Q4HA 2QRHA 1ORIA 1Z07A 4OGFA 1T5LA 5EUCA 4XVUA 2ZANA 3IBSA 2P5SA 1GPH1 5E4TA 3UB2A 4AMGA 1L4LA 1VJTA 2GFQA 1PW7A 4OK5A 3UANA 3V32A 3ROFA 4A73A 5AJHA 1ULAA 1L5YA 3B3QA 1YVEI 1B8NA 4UHBA 1FYVA 3PYMA 3LQYA 2KJQA 2CYCA 5ILQA 3SYTA 5B3AA 4Q48A 4BNNA 1Z17A 3DR3A 1PE0A 5LZ5A 5K0EA 1RAAA 3C8MA 4RHYA 2C83A 1V7PC 4C4PA 4E5YA 1UL1X 4HV4A 3DLCA 3QF4B 3S44A 4B9AA 2GF0A 3FYUA 3MGBA 4JWKA 3B8EA 5C5DA 1SHLA 2AZXA 3FYTA 4MP3A 4BCDA 3KPJA 2W6QA 4WNIA 2QIPA 5AOVA 3ZX4A 4YLYA 5K0GA 4J1NA 1J2JA 4YH1A 4JJ6A 4QSMA 4AMYA 5B7GA 1L4FA 1Y8QA 1A9TA 3LNCA 2XF2A 1NFFA 1XZAA 2IYLD 1UK9A 1N0HA 3MQFA 3TX6A 2QUKA 2W2QA 1SZJG 3KHTA 4CF4A 3QA9A 4MV4A 2WI8A 1T34A 1EAYA 3VVLA 2CV2A 3R41A 4XLZA 2VQFB 3VPHA 4CN8A 4IFEA 3HCCA 3ESYA 4DWOA 2ZJ5A 4KYUA 2P3OA 3UBMA 1CHDA 3D6FA 3ZVRA 1W4RA 3ITNA 3U3DA 1QIIA 2DQZA 1UMDA 3N9IA 4GQIA 4LSGA 1KDOA 1Z8NA 1VHTA 2GK4A 3N2KA 1G3MA 5F5XA 3W2FA 4ER3A 4EYQA 1SBZA 1Y4ZA 4OA5A 5FEMA 4JI8B 2Q8QA 3K94A 3ZNNA 3PR1A 4M7PA 4F3YA 1T1SA 4L8LA 1FP6A 2NYAA 3ETGA 1TUGA 5CR9A 3V34A 4FU0A 2R8BA 1XT6A 2X0FA 2J6CA 5FA6A 4ARSA 4C0QC 1MAHA 4LHWA 2PJRA 2AEJA 3NHMA 4Q19A 4B76A 3PEWA 3F73A 1IUPA 1UFRA 3DMDA 3IDQA 4EF6A 1WLYA 3BE4A 5I7OA 2PUGA 1Z7YA 5JU6A 2JJ2D 4YAGA 1EB8A 3IP8A 4PXAA 3A05A 4L0CA 4TQUS 2IZ6A 2IBTA 4X71A 2H1FA 1LC0A 2A30A 5EL0A 4B3MB 1TYZA 2E4ZA 3FI0A 1P0IA 1UP4A 4D6YA 1DELA 2V8OA 3QLJA 1RYYA 2DFLA 4RVOA 3TL3A 1GT91 4OLFA 2QL6A 4NK5A 2FWBA 4KQXA 2CHGA 1U0NA 4YAFA 4ZXFA 2C2YA 3EDQA 4IMIB 1LWOA 4LQ4A 4NF2A 4K1XA 3SBXA 3W5AA 2YVUA 5BRNA 2AZTA 1CVLA 1JSCA 1ZU4A 4IIUA 2R8RA 5EXEA 4DV7B 3IEVA 3FNHA 1QWOA 4L4UA 3MQ4A 1Y81A 3N8NA 1QIGA 1GD1O 2R5NA 3ETLA 3KTFA 4N0PA 2VTEA 3BMQB 1PL7A 2IHVA 4ZAYA 4JA2A 4PFSA 4BC0A 3L84A 4D9KA 3K1JA 2IYOA 2HLDA 2ZSIA 3KQYA 5DGHA 2QAGC 4QHTA 3NC0C 4NWIA 4QREA 3RU7A 3VYVA 4C0JA 4ZCRA 5CFMA 2D1QA 3JZFA 4W5OA 2QKYA 3R7WA 1XSEA 5JWRA 3IL2A 4TXHA 4GXRA 2JJYA 2QLTA 3ZWXA 3SF8A 3UGQA 3EGVA 1FXWA 2NP6A 2OXFA 3NWOA 5M5BA 4D4KA 2PFGA 3G9TA 2FZKA 1ZP6A 2ZBGA 3G7NA 4BATA 4DNPA 4WDRA 1N6KA 3C7AA 4RMJA 2IBMA 1YS9A 3IVMA 3K5HA 3EEOA 5J2UA 3TBFA 2FMFA 2H0QA 3ET5A 1PEAA 2IEBA 4FDMA 4WCDA 1PJAA 3OE7D 2AOWA 4UEOA 5KVQA 1VCNA 2P0EA 1BW9A 1Z0ZA 1MJHA 1H05A 4GVXA 2VH1A 5C7YA 9ATCA 3K9GA 3P0FA 1CY0A 2OB2A 1F1BA 1R00A 5LIRA 3T5BA 4NECA 3SEZA 5EJ5A 4DC1A 2J33A 4HMPA 4NL4H 1EP3B 1E6LA 4OXKA 4Q3LA 4BNTA 2ARKA 3PB3A 3P5BA 4LKOA 2OVFA 1G2OA 1VB5A 2CVZA 2VFAA 3N2IA 4RH1A 5D3MB 3CYFA 3EGDB 2IYFA 5AJVB 1JMVA 2ZUDA 1QF6A 3H16A 4DMHA 1ULBA 1EH5A 4IGAA 4C1NA 4EVRA 1T6BY 4A0GA 5DLYA 4F6LA 4ENPA 1BOOA 2PQMA 2OGWA 4LC0A 4DVJA 2O0LA 5EIHA 5JZOA 1SVMA 1YOVA 2BRUA 3A1UA 4PCLA 1IK4A 1QE0A 4LF4B 1O95D 2LWIA 1NUSA 3UG6A 5EHZA 3QVUA 2WAMA 4Y0AA 1C7ZA 2FPXA 5CXSA 2OHGA 2QVYX 3FDZA 3OX4A 2IUSA 4FTWA 4LBYA 4NEGA 1KC3A 2RHBA 2I67A 5G3YA 3T9FA 1N9GB 4GKVA 2CEKA 4DNOA 3WDLA 1RLJA 4D4MA 3EOAI 2QN6A 2WVJA 1F38A 1GZ5A 2HFJA 3ABZA 4RHFA 5K5EA 4RMIA 3W78A 5K8LA 4DIKA 1DEOA 2DULA 1U0EA 3O9MA 2SKCA 2GD6A 4IIEA 4F96A 2VQSA 1JQEA 3VNVA 3V5NA 1GPMA 1KF0A 3EXHA 3GNTA 3GRVA 4HF7A 4Q00A 3ICOA 4L2IB 1ODJA 2JEZA 2RGGA 2PK3A 2Q1UA 3CKMA 1JDBB 3OM1A 3KDPA 2V6BA 5LQMA 2C8JA 3IAHA 1S0UA 3FCXA 3JQ7B 3UWPA 1PK8A 3PPWA 2BM0A 2AXPA 2W0SA 3HYCA 3IAXA 4N5IX 5IN4A 5A06A 4Y9DA 4EDFA 2XCQA 3OFND 4PO8A 3UMYA 1FTWA 1OE0A 2W4QA 3CF0A 2GH1A 5JJCA 1GZ3A 3SDZA 3AG6A 3UW3A 3PC8A 5F7ZA 4ZDIA 1RXUA 5DEIA 1H69A 3NM5A 3TVYA 2ZRNA 2PNJA 3JQQA 2OK7A 4V1CI 2AL7A 5ELXA 3STTA 1XEXA 2NGRA 4I55B 3PHHA 4KAFA 3MLEA 4I5IA 1H5NA 4BMCA 1K8YB 1XMOB 1YBFA 3W2IA 1PCXA 3WJ2A 3LG2A 3GYGA 4AO8A 4BNLA 1KEKA 4RTJA 3B1JA 1JEYA 4U1RA 4PC1A 2IPOA 2WEKA 1P77A 5C51B 2UXCB 4PAQA 2VH2A 2Q8PA 2WUDA 3MJRA 1UM9A 1C4OA 1MOPA 3NU1A 3WGUA 4ZVTA 3RHSA 3AONB 1JN0A 3H4MA 4KX5A 1BW9B 2BN4A 2QTZA 2QX7A 3A27A 4KFSA 5DHQA 2O0JA 4EF4A 3IEXA 4UJ3A 3M8KA 3D3NA 2QRUA 1F0PA 4FM9A 1NVEA 2AJCA 3A3YA 3IPRA 3I2HA 4LE0A 5KOJB 3O2QB 4B6QA 3RUIA 4M49A 5FDFA 3EEBA 2HXSA 4GDMA 4EKIA 1AC5A 4TWJA 2D0OB 5DU2A 5I7WA 4MVJD 1NR1A 3S0JA 3BWEA 4XRGA 5JI3E 3PFCA 4Z4GA 4FMDB 4DY6A 5JJBA 2UDPA 4PZZA 3G5MA 3IEMA 2OUIA 2FUG6 3U80A 2Q5JA 4DLSA 2IUYA 4H0FA 1M1ZA 3UHFA 4RDHA 4JI0B 4X7RA 2YMPA 1E2IA 1MB0A 4BFTA 1UOOA 2RJ3A 4A8JB 1OB2A 2PQ2A 4ZVMA 3UH1A 1EUCB 4OA8A 3ITEA 5FUWA 2EP5A 1E60A 2OE2A 3PTZA 4M83A 4X20B 4FYHA 2JASA 3KHUA 2PX6A 4MKZA 2EFJA 3P4UA 2F7SA 2JGNA 3H5OA 4WPGA 1UBJS 1CBUA 2AX4A 4P38A 1TIKA 4P4NA 3FZGA 3ERCA 1E2UA 3BXXA 1YO6A 1V39A 4CEJA 2O8CA 5TIIA 1HQCA 3DBHA 1DC4A 1KARA 1SCAA 1XZEA 4UXIA 4BKOA 4Z7QB 2CB0A 3THRA 1XZNA 1F7VA 3L0PA 1YQ9A 1NVTA 3AOGA 1N4AA 3U3KA 5ALLA 2R0QC 1Q0UA 1M0EA 3NHAA 4ARCA 2WC1A 1QIHA 1ZXLA 1M2FA 2X0RA 4LK3A 3NMUF 6NULA 2JS7A 3VFDA 3TGPA 1N25A 3HKCA 1ORTA 1V1RA 2C5EA 2FCRA 3R6WA 3JWHA 4KPUA 4LBZA 4MH0R 4PX5A 3LHSA 4KC0A 4CIBA 3Q7QA 2PUJA 4LJ6A 2HMAA 2Z8YA 4H6XA 2FWRA 2EJWA 3A1EA 4HDNB 1TRKA 3ASYA 1EP1B 2PH7A 1TJ5A 4X0EA 3VJMA 4CTJA 3D8TA 2FPPB 5I4KA 1GKIA 1FU4A 5C3MA 1LQ2A 1T4GA 3CFYA 4DR2B 3KPWA 3NANA 3N2KB 1AMNA 3WLMA 2B61A 3BX1A 1ZGZA 4HK4A 1P29A 3RIGA 1WG8A 2HJ9A 2JGMA 5EKDA 2HLPA 1P5ZB 1RMQA 2AB0A 2QROA 4WY8A 2OZEA 5FTJA 1MV8A 4BNVA 2IYWA 5D00A 2R751 5KTKA 4BB9A 121PA 4QAQA 3T99A 3S2ZA 2E6UX 5T6MA 3UB4A 2VP0A 2EWVA 3CKKA 3LY9A 3Q6IA 4MKXA 4X7BA 3KT3A 1W52X 3JPYA 2WIFA 2VHJA 3ND5A 4NENB 1K4YA 1RABA 2RIRA 4DG5A 1LBTA 5GJVC 1SU7A 2FMUA 1OZFA 2I6FA 5LPNA 4KSCA 2X5NA 2B8NA 4Q4CA 4NBKA 3ED1A 2GPTA 4C88A 3T9BA 3ABSB 1F4LA 2XYVA 3VX4A 4DUGA 5LKAA 3ESDA 2C9YA 3NM4A 5U4QA 2LCFA 1XVAA 5AK0A 2EFHB 3OZBA 4C20A 1SC3A 4EYGA 4WLEA 4TLBA 2NU9B 3LWZA 3V7WA 5EXPA 1SG0A 2FLKA 3HUDA 2J59A 4M46A 2QMOA 3CRNA 4EJMA 1TT5A 1X1BA 3FVTA 3IHTA 3OMLA 2ZKIA 5H02A 3MJCA 2PUTA 4N0QA 4OREX 5B64A 1H9CA 5LC1A 2ISCA 3MM4A 4RZSA 4HYQA 4TTIA 1Z36A 2LTAA 4IDEA 2F17A 3KZMA 1DKQA 4JK3A 3GG2A 3RVOA 3M7IA 3QGMA 4Q3EA 1TQ8A 4DLKA 1JDJA 1W4BA 1RQXA 2X9GA 3FNRA 4K9SA 2G5CA 1Q74A 1TUEA 2JNWA 4D26A 5J2TB 5AP9A 3ANNA 3BHJA 4KXFB 2XQIA 3GB9A 1SUIA 1FVOA 3ZE0B 2GM5A 3ZOZA 4HYYA 4BFUA 4C5CA 1W87A 1KDYA 2O1XA 1F2TA 5HCUA 3F8TA 3HVKA 3TLBA 5A5VA 1CUYA 1GKKA 5ULLA 1L8LA 2PZ8A 1PFUA 3RCBA 2UU9B 2ZJYA 2DP4E 1ESDA 4GPBA 1J07A 3VI3B 4HDQB 5COAA 2C0CA 2W2MA 4MWTA 1W4CA 1U3CA 2AA3A 4JDUA 2EJUA 5JS1A 3I8OA 2MINB 4JLUA 1JSLA 2ZR0A 3DH0A 3A6ZA 5EIBC 3U3MA 5BOSA 1IY1A 2G4LA 1Q3HA 3B7GA 3ZWMA 4OUKX 4C9BA 2Q46A 2QUAA 1DX6A 3JTMA 3WGOA 4B6RA 2EYUA 2W4IA 3K5PA 4UXHA 2BR5A 3D02A 4IS2A 3JAMA 1I36A 2QP4A 3EVFA 3TOZA 5E4YA 3O5AA 2HRQA 4OIMA 4B84A 4MWDA 4YRBA 1W2GA 3LFTA 3O2JA 3NWPA 4WZBB 4P0QB 3DZHA 4EMUA 3VKHA 3NW9A 3Q98A 4DIEA 1M1YA 1OILA 3QXJA 3A4NA 2GLXA 2O1WA 1B8OA 4ZT3A 5G1NA 4BEVA 5E95A 1BMTA 1NUAA 4HH1A 4REMA 4G81A 1HPLA 2EW1A 1AS0A 3A6JA 3L49A 3TRHA 5IJ9A 1A8SA 2XUPA 4X64B 3RT7A 4CR8A 5FORA 5BYJA 1GAWA 1P60A 1ZGJA 1TEVA 2UV8A 3ZDCA 2D4AA 3L7YA 3RSFA 1TGYA 4Q34A 2XYPA 3LHDA 3K8ZA 2GESA 2BEVB 1ESMA 3KQVA 4G84A 4NZZA 2J4FA 4RY0A 5C8YA 3CLSD 1TF7A 3ML1A 3MRXA 3H97A 1UQUA 4JLJA 1C9EA 5GONF 3U7HB 3HB1A 2CVQA 3A4YA 4C2BA 2CLMB 4UHCA 1ISGA 2YXLA 1KI6A 3ANXA 1P9OA 3QVMA 1KAMA 1MTZA 3R5JA 4JQCA 2AG5A 1T2VA 3FOCA 3QEJA 4JLNA 4TKUB 2GCGA 1Z4QA 2WF5A 3PNPA 3OLYA 3HNPA 4CF7A 3M6VA 4FKZA 5ALQA 4EB3A 4WZAA 1PZFA 2R7KA 5JZBA 2Q7XA 2V7TA 5E7IA 4DB4A 2JLSA 1AHNA 2Q5QA 2B1RA 5E4FA 3CJRA 3QZUA 3UAXA 5H5JA 5AJXA 3JWGA 4JITA 4BVHA 4FNOA 4GI7A 2Y66A 1KRHA 2YRXA 2ICAA 2VJPA 3AZOA 1Y3AA 2XXAB 3REQB 3MJFA 3D1VA 3GFQA 2K4MA 3BB1A 2XNKA 3QVGA 1KYIA 3I04M 3O26A 3OTQA 1HFEL 4KMMA 4N5MA 1W36D 4PLHA 2OCGA 1W7AA 1LTKA 4BVFA 1PNVA 1JRLA 2MTBA 3PV0A 4JCOA 4YQZA 1RKBA 1HEIA 3WWPA 1JMKC 3OJEA 2QLMA 4GZ6A 5DN9A 3OQNA 4RF5A 3HXKA 3LUCA 1P62B 3NHSA 5A3QA 2PMDA 3LUDA 3TOXA 5THQA 6AT1A 2X1VA 1Y37A 4EG1A 4I9UA 3KJGA 5E9AA 3ZDBA 1UMBA 2ZIXA 1LUAA 1XAIA 1NY5A 4IHJB 4NDNE 5DIZA 3KKKA 3RJ9A 1QG0A 4WOCA 1XTBA 3RAGA 4HNQA 1PVOA 2YYZA 1Q7RA 5BQOA 1ZC3A 1SUBA 3SSAA 2UVPB 3DAOA 3LRXA 4LHEA 2W6IA 1VG0B 5G2OA 5FADA 5EEGA 2Q50A 3E82A 1E6EA 5AXCA 2ZI9A 3BIFA 3VBEA 4NCBA 2WRZA 3JZDA 4ZT2A 1D4FA 4AG5A 4LJYA 4ZPXA 3PEVA 4TXLA 4PPGA 3QVJA 4WLOA 2UZIR 5F33A 1NNSA 2CNLA 2O59A 4WESA 2Q3MA 3HGQA 2X42A 3SZGA 4KQGA 5LBTA 1P3JA 2EGHA 4CUZA 1O5TA 3KEGA 3W8FA 3B5JA 3TXAA 2J6IA 4YCNA 1XJ5A 3PLRA 2Y77A 4BV8A 1FC0A 1H8HA 4IEFB 3JAKB 4LTDA 2REOA 3H0EA 1DT3A 1VCIA 1OOEA 4H0CA 2IOFA 5FFFA 3Q0IA 4E5UA 2Y4OA 5G4KB 5IJZA 3IQXA 3KSMA 1VYTA 5DTIA 5C2JB 3H7AA 5IVIA 5CA1F 1XN1A 2EG5A 4GYWA 3FLMA 3FPAA 1X19A 2FW9A 2KLBA 1W0JA 2OFOA 1DIBA 2Q27A 4OYLA 1VKZA 4Z9AA 5FOUA 4E6EA 3UH0A 3HB5X 3RFXA 4BN0A 3OZUA 4QUKA 4C7BA 3OCXA 1OZ0A 3QIAA 4RSHA 4OAQA 3HG7A 2VDMB 3W3AH 5HFNA 2PGXA 2OGTA 3OOEA 1EIWA 1IN8A 2N3ZA 1RZ3A 3QFTA 1QGUB 3PF8A 3W2TA 3H04A 1VKJA 2V6MA 3N39C 1GPWB 1NUPA 2C1XA 4QLOA 1Y3DE 1X87A 4XQEA 3Q88A 1SB8A 4N18A 4Y6LA 4AAYA 3K6SA 2VYQA 4V0KA 1F9EA 1IAVA 1BCSB 4R01A 4CEHA 5ECWA 4OYHA 4JNGA 1JNYA 1NI4B 3NAGA 3R4VA 1XB2A 1G5HA 3FGNA 2GN9A 1JF8A 3IUYA 1K5DA 2A0UA 3EMBA 1B15A 3F98A 5A3SA 2ZM6B 1CR0A 3ZHZA 5I7HA 2POQX 3WLRA 1QP8A 1MJGA 4OKSA 1V5IA 2C7GA 1L1FA 1LX7A 4QOHA 2X9VA 4NMHA 5HZHA 3G1WA 3HNRA 1CVIA 5I9BA 3SX0A 2H9AA 3E70C 1IBMB 1K0UA 1DJLA 2OP0A 5EEHA 5K6AA 1Z7WA 4MI6A 5KQSA 2YZ2A 1A76A 1I7SB 2Z4TA 3HB7A 3HBFA 4G0PA 1RCUA 4C30A 4YT2A 3KB8A 2JFBA 3TI9A 1EK2A 1GYPA 1J8VA 1SXIA 4EM6A 2WHPA 2E2WA 4AMVA 2I78A 1X7HA 1WW3A 1JBEA 2QTRA 4HS9A 4FGSA 3AB8A 3AETB 4L50A 1VG1A 2IQ5A 3A2LA 5F1YA 5DP2A 4EYSA 1HE1C 1P0CA 2OGUA 4PTZA 4X3OA 3R7SA 4RGBA 3MHTA 2RHTA 1VLHA 4I8XA 3HDYA 3VR3D 4FKBA 4DCNA 5FTKA 1O54A 3X2FA 4MIOA 1NN0A 3B70A 2L18A 4HXYA 3RSHA 1G55A 3WB9A 4HNAA 4WZ6A 3ZUPA 5IBQA 5CDSA 4WFJA 3IPCA 3QVGB 1FMCA 2F1KA 1Z82A 2ZQYA 3U81A 2FSIA 3ECCA 4K7JA 5GAJA 1ATZA 4AMBA 3IPLA 3ZEIA 1PZXA 3JASA 1FCJA 4AQ7A 2AYXA 3DE5X 1ICIA 1JAIA 3WKBA 4ZEVA 5AW3A 3RFTA 3WK7A 2KQUA 4TM7A 5AQEA 5NULA 4UARA 1E62A 3H1EA 3OCVA 1MP0A 4BFLA 4B3RB 1JU9A 4QJIA 1N5IA 4HAYA 1FRFS 1N2IA 3DXXA 4MW6A 5DYTA 4DQUA 4N6OA 2XODA 1HXHA 1R8SA 1X74A 2ZJ2A 4IM7A 1E7MA 4F5DA 1OGJA 3O7WA 2QTBA 2X0EA 4ETWA 1RWKA 2WMNB 5J40A 2VPQA 4JEUA 4PNHA 3R7AA 3WQHA 1U0FA 2ZR9A 4E07A 1FSGA 1J2TA 5AVSA 1SZDA 5M34A 2IHUA 4QTUB 4HAOA 5TPZA 1LBHA 4U5QA 3WJAA 1NW8A 2GRJA 4ZDWA 4B3FX 4D41A 4C1BA 4AG6A 2Y8EA 1TPYA 4FGWA 1XZIA 3VSCA 1PJSA 2GFHA 4ZOLB 1V3TA 2WHRA 2DR3A 2BUBA 3LCMA 2PD6A 1SRRA 4NCKA 1JHPA 3OFSA 2ZBUA 4UQOA 1G6Q1 2Z2JA 3HL4A 4JZYA 5LQNA 3DXYA 3O2SB 3QX7A 5IWAB 2IS4A 4DR1B 1CY2A 1MRZA 4M1TA 1WY5A 2FYTA 4X97A 2P65A 3MUFA 3V42A 1N32B 1XRPA 3K9FC 3R6DA 3C2QA 3V2IA 5FNVA 1B23P 1YRWA 1KBOA 5EJEA 5A2QA 3FNEA 1AE1A 1NVBA 1ISPA 1IXRC 2OZPA 2RAFA 3WBKA 4KN6A 1R0SA 2JC3A 5IJAA 4MVXA 1T8WA 4IQFA 1KY2A 1YXMA 1DT5A 4KDRA 4ZCIA 3GEIA 3ZY3A 3CT4A 5ALSA 3RVKA 1E2BA 1ZL2A 2ES4A 2NTYC 3M3HA 1BQ3A 2HA3A 4ZN6A 4JYZA 1DUSA 1SH7A 1IVNA 2X4DA 1I3OA 2ZYVX 3Q6MA 3GJSA 2RG1A 5TQ2B 2J5BA 3IE0A 4GBMA 2ZS7A 4L07A 4EB6B 4CEIB 1G2QA 4DMGA 3K72B 3SM9A 5FOTA 5FKJA 3T9DA 1ORDA 1CYEA 2XX3A 5T4EA 1A5AB 1KXJA 2L17A 4BQIA 4ZGWA 4G65A 1XZCA 1XP5A 2RI6A 3I09A 3M3PA 1URPA 4J1TA 4YJ3F 5G0WA 3U4HA 4LF5B 5CHYA 2H54A 2I76A 5DOVA 5EJ2A 5DGTA 4EY4A 2VKQA 3Q41A 4QO8A 2C3YA 1VB3A 5I7UA 4B48A 3E23A 3EWAA 1Y9EA 4JL8A 2EDCA 1K7FB 2ADOA 1UZAA 3R3HA 3QEMA 2IDMA 4X6UA 3RHFA 3WFJA 5HKAA 3HV2A 4CMEC 2P6MA 3DTNA 1FFXB 4H3HB 1A7JA 4D97A 5T3UA 3DT8A 5CK4A 5ICGA 3VTKA 4IJQA 1Z37A 2GZ3A 2OYSA 1UWCA 3AP1A 3RREA 5KZMB 2C2WA 3AZPA 3PENA 1WSWA 1P9RA 3M4JA 2C8LA 3Q2OA 2REQB 2BEVA 3IFSA 2BZ0A 2FF7A 1KP9A 1G5TA 3DE6X 3MLBA 3NFYA 5K0BA 2WP8J 3BC1A 3GZNB 3L5OA 4CE6A 5C1IA 3GNSA 3UMRA 1V5WA 5EFZA 5A1TA 2YV1A 4FGLA 1NAIA 4JENA 4DIUA 1T5IA 1VLLA 4NMMA 1I3LA 4BO1A 3Q8KA 4FI3C 4RS3A 5CCEA 3R0IA 4LK2A 4Y6SA 3N0TA 1NUUA 3AR3A 1MO2A 2WQ7A 1QNFA 1V4VA 1VYHA 1W5SA 1VM6A 3O3NB 4DJDC 1CEEA 1ZEJA 3DV9A 4M6WB 5JAZA 2DWQA 1LCIA 3DLPX 1UC8A 2R6R1 3R0VA 1XTVA 4M89A 4UD6A 4KV7A 2H17A 1DO8A 2Q2QA 2RJOA 3HVUA 2HR1A 4W7HA 2C5GA