1E7YA

Active site mutant (d177->n) of glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides complexed with substrate and nadph
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
485
structure length
485
Chain Sequence
VSEIKTLVTFFGGTGDLAKRKLYPSVFNLYKKGYLQKHFAIVGTARQALNDDEFKQLVRDSIKDFTDDQAQAEAFIEHFSYRAHDVTDAASYAVLKEAIEEAADKFDIDGNRIFYMSVAPRFFGTIAKYLKSEGLLADTGYNRLMIEKPFGTSYDTAAELQNDLENAFDDNQLFRINHYLGKEMVQNIAALRFGNPIFDAAWNKDYIKNVQVTLSEVLGVEERAGYYDTAGALLDMIQNHTMQIVGWLAMEKPESFTDKDIRAAKNAAFNALKIYDEAEVNKYFVRAQYGAGDSADFKPYLEELDVPADSKNNTFIAGELQFDLPRWEGVPFYVRSGKRLAAKQTRVDIVFKAGTFNFGSEQEAQEAVLSIIIDPKGAIELKLNAKSVEDAFNTRTIDLGWTVSDEDKKNTPEPYERMIHDTMNGDGSNFADWNGVSIAWKFVDAISAVYTADKAPLETYKSGSMGPEASDKLLAANGDAWVFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Examination of the Role of Asp-177 in the His-Asp Catalytic Dyad of Leuconostoc Mesenteroides Glucose 6-Phosphate Dehydrogenase: X-Ray Structure and Ph Dependence of Kinetic Parameters of the D177N Mutant Enzyme
pubmed doi rcsb
source organism Leuconostoc mesenteroides
molecule tags Oxidoreductase
molecule keywords GLUCOSE 6-PHOSPHATE 1-DEHYDROGENASE
total genus 176
structure length 485
sequence length 485
ec nomenclature ec 1.1.1.363: Glucose-6-phosphate dehydrogenase (NAD(P)(+)).
pdb deposition date 2000-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00479 G6PD_N Glucose-6-phosphate dehydrogenase, NAD binding domain
A PF02781 G6PD_C Glucose-6-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1e7yA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1e7yA01
3WX0A 4NH4A 3JYLA 4K26A 4WE3A 2VYND 4MVJF 5CFZA 4GWKA 4L9RA 5DBFA 1QV7A 1HE4A 1XELA 5DCUA 3BTSA 2VWHA 4CMJA 4NNJA 4WUVA 3U9LA 3NT2A 3VZRA 5BSGA 1EFKA 1TT5B 2O4CA 2J5KA 3L4BC 4CM8A 3C3XA 4IUYA 3V2UA 1HDZA 4I9HA 3I9NA 2O7SA 3WICA 3KRTA 2W2KA 2PTGA 4FPXA 4L4SA 4NDNE 3MZ0A 3G1TA 1NWHA 2BF7A 2DTXA 3CXRA 3TL2A 1D3AA 3EW7A 3QSGA 4BMVA 1I24A 3QWHA 4CPDA 3AOEC 4EJMA 2HK9A 2PD4A 3JYPA 4JGBA 4OOEA 3GR6A 1QKIA 4U0JA 2PH5A 4EDFA 4MJLA 2X4GA 3M1LA 1GAEO 1W8DA 1VL0A 3ENNA 3UOGA 4KTVE 2I76A 2XXBA 5L3ZA 2EV9A 4NU6A 1Q7CA 1E5LA 2QW8A 2ZTLA 4QO7A 3KVOA 3GHYA 2PK3A 4WLOA 4AJNA 1T2AA 1X1EA 4BKRA 1ONPA 4HBGA 3GDGA 5T67A 4BV9A 1DFGA 4OIMA 4CUKA 3PFFA 1UXKA 1VKOA 4Z0HO 2YY7A 4LSWA 4RDHA 1B15A 2A94A 3KO8A 2Q1UA 1KC1A 3OF2A 4IMRA 1AXGA 1G0NA 1R0SA 2JFGA 1K89A 3HUDA 3LLSA 3UN1A 1YQGA 1T2EA 4BV8A 5JXWA 4PLGA 3DOJA 4FW8A 2BELA 3L07A 4I5DA 1IUKA 1HE5A 4JK3A 4NFYA 4ZQHA 2X1HA 1JDJA 3FBGA 2VN8A 3PGXA 4MPDA 4J2HA 1C3VA 1X13A 4E4YA 2O3RA 3L9XA 4CMCA 2VYNA 3UKOA 1V6AA 2ZCVA 2CDBA 2BD0A 1EBUA 3U5TA 4UUOA 5L40A 4IPTA 1RKXA 1HL3A 3GG2A 5FWNA 3F4BA 1LLDA 3JQEA 4A73A 2X5KO 5L45A 2HMWA 1RM0A 2ZKLA 1I3LA 3P5SA 1LSSA 1YB1A 3Q2KA 3WFIA 4BMNA 3GGPA 1GUZA 4PLWA 4Q39A 1IULA 4RO0A 4ITUA 1E0DA 3QQPA 4J6FA 4PG8A 2JCVA 4ZQGA 3DZIA 1DIRA 3E9QA 2YDXA 4U6QA 2R6JA 1YOVA 3WS7A 2HLPA 4DUPA 5K9ZA 3RJ9A 5COQA 1ZK2A 3RASA 5DF1A 1GL3A 3EVNA 4TVBA 3DMTA 5THKA 1ZMTA 4TRMA 4GI2A 1U9JA 2YQ5A 1PGOA 5TC4A 4UVGA 1SBYA 3EGOA 3QRWA 4EEZA 3RC7A 1MA0A 1JN0A 4L4XA 1YL7A 1W6UA 1LRJA 4BGVA 4IS3A 1FDWA 3NT4A 5TNXA 2ZB8A 1EQUA 2GUGA 4ID9A 1N9GB 5I7EA 3PJDA 2W2LA 3K2EA 2E4AA 1ZH8A 3ZWOA 4DRYA 4U8GA 4B8WA 4YT8A 2R00A 1LSOA 4DBZA 2NVUA 1F12A 2Q2WA 1PSDA 3I6QA 3QWIA 3RUIA 1ZUD1 4EZBA 3IQDB 3R1IA 3VZSA 4ESOA 2Y0DA 1ONOA 1KOLA 1N2SA 2HRZA 4UEJA 3G49A 4FC6A 5HRUA 2PFGA 1PGJA 1HF3A 3GZ4A 2AMFA 3ROMA 1DIBA 4XGKA 1LRLA 2X7HA 4OYRA 2NLOA 3L4BA 5B4VA 3E82A 4RF3A 4YCAA 4R5HA 3RBZA 1ZK1A 3U4DA 3ZNNA 4DREA 5CAEA 3WGIA 4WEQA 2RHRA 5LDGA 3UCEA 3PLRA 4HX5A 4LRTB 3KV3O 4B7UA 3RKRA 4CLHA 3Q6IA 1LQTA 1XR3A 1UDCA 2NTNA 4B3JA 1G0OA 1U28A 1MXFA 4TZKA 5LC1A 4PLHA 3L9WA 1JWAB 3TZCA 4ZN6A 1DOHA 1HDCA 1I2BA 4HFMA 3F46A 3DMYA 2H5LA 1M6WA 4YJHB 1SOWA 3SC6A 3UF0A 4HFJA 2WMDA 3RBVA 4GSLA 1N7HA 2Q99A 1LLQA 2ZQZA 3OSUA 3RUDA 3HB5X 4HFNA 4TKLA 5C3MA 3PYXA 4J91A 2UYYA 2CD9A 4KDEA 4O6VA 2YV2A 3UH1A 2GN8A 4D41A 2Q3EA 5BSFA 1O5IA 3QVSA 4MOWA 3TPCA 4YXFA 1MV8A 3W8EA 1N1GA 1QXSA 2GDZA 3KLMX 4E5KA 2NU8A 4MVJD 2I6TA 2V6MA 1K3TA 2PNFA 3HFSA 3KB6A 4N5NA 1Q0LA 1N8KA 3A14A 3O26A 4OXKA 3NTOA 4XGNA 5JC8A 1R4MB 1NFQA 4FBGA 3UW3A 4NJMA 4YRAA 3OIFA 3UXYA 5IFLA 4XA8A 4CMKA 1CQJA 3O03A 4WGGA 4O59O 3RBXA 3ANNA 3DHEA 5BR7A 1BMDA 1U7TA 2ZQYA 1RM3A 1HSZA 3WQSB 5G4LA 2EF1A 4L8VA 1GADO 5CEEA 2I3AA 4W4TA 3E8XA 1UZNA 2FPGA 2VYVD 4NK5A 2DBRA 4FFNA 3LT1A 2AXQA 1ZEMA 4L0QA 1YS4A 3DBRB 3EDMA 1DC5A 1QV6A 4LMRA 3ITDA 1JU9A 1QSGA 4E3ZA 4PGFA 4Z9YA 3HE3A 2PZMA 3GAFA 1XU9A 3N58A 2UAGA 1DC4A 3ULKA 3U4HA 4HUJA 4D7AA 4IS2A 2JHGA 3K8ZA 4NBTA 3TQHA 2GF2A 4M54A 4YPOA 2EKLA 4BNTA 2HJRA 5CG1A 4KTTE 3HSKA 3UGKA 4EGFA 3LT0A 3RAJA 3S55A 4LSMA 1JA9A 5A05A 4J9UE 2JD2A 1A7AA 3KHUA 4OKIA 2DTEA 1V3VA 2X86A 4GLOA 3MCVA 1TEHA 4J7CA 1DEHA 2IDZA 4RQTA 4BNXA 3KM0A 4L4RA 3TZQA 1GQ2A 3EAGA 2J6IA 5KJ6A 3WYBA 4IZHA 3B1JA 1VE9A 3T4EA 2P4QA 2HO5A 4NBWA 1WAMA 2UVDA 3PYLA 1BSVA 2NQ8A 4RLHA 1YONA 3WMXA 4D3FA 4HADA 3NJ8A 3UFXA 1ZMOA 1UZMA 5C7OO 4BO7A 3RCBA 3IUPA 1P1HA 2GNAA 5KIAA 3PWKA 3AOEA 2Z5LA 5TS3A 3HN7A 1DHTA 4GPD1 4I9UA 3QHAA 5IXSA 2HDHA 2WTBA 1ENZA 4Y8VA 3DBRA 4IXTA 5G0VA 1T26A 1HETA 1J0XO 3IP3A 1E7YA 1N9GA 4YBZA 3TWOA 3KEOA 3ANLA 4FC7A 3RFXA 3KYCA 4A26A 3I83A 5K0ZA 3C24A 4OXYA 3NJ4A 4M89A 3NDRA 1A4UA 3UAGA 2FPIA 3WGGA 3ROPA 3ICCA 2CDAA 3IUSA 5EQDA 1HYGA 3GN1A 4IDGA 2JCXA 4PRLA 5EJ2A 2B4TO 2Z1NA 3BHJA 3O8QA 1QYWA 4Q9NA 4Z9FA 1ZFNA 4W9NC 4E30A 5L51A 1QMGA 4IQ8A 1I01A 1UXJA 2UV8A 5AXAA 2FY8A 3ZZNA 4EUHA 3HZZA 3OMLA 3FRJA 3JQFA 4D42A 5IG2A 2O3UA 3ZU3A 3K30A 4XYEA 4J4BA 3TFQA 5L4SA 1ULUA 3FHLA 3D0OA 3EUWA 4HY3A 3WGQA 4WEOA 2GSDA 4JP2A 1E1NA 5IXYA 5JBIA 3PQDA 3JYOA 4PN3A 4NJOA 4XD2A 4CLEA 2VOJA 3PEFA 2EHDA 2V6GA 4LN1A 2HMUA 5CDYA 2GPTA 2IODA 1J5PA 2HSDA 1BRMA 4YJHA 4UAGA 4UVEA 1LDNA 5HTOA 1MC4A 2DVMA 2YHIA 4H3VA 2HCTA 4YR9A 2W2KB 1WZEA 3GG9A 3ETEA 2GZ1A 3RWBA 4R01A 3UICA 4DLLA 1JKFA 2O4UX 2DC1A 3F6YA 3I5MA 3KTDA 4Q3DA 3C85A 4FOSA 2DPHA 3IDSA 4WOJA 4HXYA 1I5RA 4ROSA 1VPDA 2NNLD 5F1KA 4PVCA 4CM5A 4FSHA 3V1TC 4PZCA 4CODB 5BQFA 3FNFA 1GV0A 1OZAA 1R4MA 3DXFA 3FWNA 2WEKA 3LSYA 5F5NA 4CM7A 1SEPA 1PS8A 3ROKA 2W2LD 4D45A 5T73A 1GUFA 3C1OA 4LW8A 5ENVA 4RORA 1TT5A 3VZQA 4Y67A 4W6ZA 4BNKA 4CM8B 1PGQA 4CV3A 2O2YA 4IGEA 3EK2A 1C0IA 3S2FA 1R66A 5ENDA 3DO5A 1YJ8A 4L76A 3UVEA 4HKTA 2BFPA 3GVHA 5B37A 2EWMA 5JYEA 2WM3A 2O50A 2GRAA 3DB2A 4QQRA 4JROA 5IN5A 2GR9A 2B35A 2BH9A 4GMFA 5FI3A 1OI7A 5JNLA 4PG7A 1NYTA 2Y05A 1IZ0A 1KVUA 4OOFA 2A92A 1NFFA 4J16A 4W9NA 4WCDA 1SEVA 1BXZA 1I2ZA 2TMGA 1X1TA 2Q1WA 1VL6A 2EGHA 3EZYA 3H5RA 4OL9A 3VPGA 4ALMA 1HDGO 1N5DA 4GBJA 5FF9A 2OBNA 1EVIA 4AJOA 1U4OA 1NM5A 3VPFA 2PD3A 1ADBA 3DBHA 3AUTA 3JCZA 3LC7O 1GYQA 3EYWA 1E7QA 1A7KA 4KUEA 5ADHA 4RLSA 1H9BA 1YRLA 3ONFA 1GZ3A 2QZZA 5JO9A 1HRDA 3LVFO 1F0YA 1GQYA 2CY0A 2VT3A 4RVGA 3BMNB 4PRKA 2VCYA 3NKLA 2V6FA 4CQMA 4J1TA 2WWRA 1T24A 4PZDA 5A04A 1BVRA 3C8MA 4PLPA 3ST7A 5C7IO 3DR3A 3I9LA 5A9TA 1F17A 2NADA 3E5MA 4IDCA 5L7WA 2GYYA 2PLAA 3PLNA 1UDBA 4MIEA 3RUCA 4E21A 2HAEA 2JAPA 4J4TA 3PJEA 1P44A 3BMCA 1SMKA 2WYUA 4IY1A 4BNWA 5A03A 4ND2A 1CRWG 2X5JO 2DUUA 2DLDA 1JVBA 1UP7A 2QYTA 3R6DA 4CQMD 4E2YA 2IZ0A 4OMUA 3ZU2A 1QRRA 3U49A 1PL6A 5ER6A 4A0SA 1PJTA 1NPDA 1U5CA 3WOHA 1HZJA 1UR5A 1D8AA 4TWRA 1EUCA 2PZJA 1HSOA 3E9MA 1IHXA 5DN9A 5ER9A 3WJAA 1TI7A 1H5QA 4R3NA 2ZB7A 1EZ4A 2PGDA 1EEHA 2YYYA 2Y1DA 3EHEA 1X15A 4KOAA 1BXKA 4EUEA 3JQ9A 4NBRA 2FR0A 3CMCO 3OQ1A 1M66A 3B6ZA 1ZZEA 4GSKA 4BQPA 2G82A 4MP3A 4BQRA 3PJGA 3OQBA 4EW6A 1DHRA 1M75A 3AUUA 4FGSA 4UEKA 4BGEA 5ITVA 3LC1O 3PJFA 3RU9A 5JC1A 1KC3A 4IDEA 1QLHA 4CR6A 1QP8A 3LK7A 4TQGA 5KKAA 1FDTA 4CR7A 4GL4A 4E5PA 1EFLA 2EIHA 2J5QA 4JBIA 3DTYA 4UULA 2JJYA 1T2FA 1WLYA 3LF2A 2AQKA 1B0AA 1WVGA 4CV0A 4E33A 4F6LA 4TZTA 3U0BA 5B4TA 1P45A 5EMHA 1VLLA 3CZRA 4WLVA 5IAAA 3DOCA 3CUKA 3PPIA 4DLAA 4FDAA 3WB9A 4YJFA 5KOIA 1R15A 3U62A 4ALLA 6LDHA 1KS9A 2O7QA 3OECA 4XJSA 2LDBA 4BNJA 3QA9A 4ALNA 2EW2A 5JS6A 1XU7A 2P9CA 4BMSA 1LBEA 1OC4A 3F1KA 4N54A 2O2SA 2C0CA 4DPLA 2E48A 4INAA 2PGJA 3OM9A 1E7WA 4NR0A 4BIIA 4ND4A 4H7PA 1I2CA 2R2GA 3AI2A 5H83A 3WGHA 1TA4A 4GVXA 4JNKA 1GUYA 2BI7A 1FK8A 4BB5A 2ZCUA 3SLGA 3TRIA 1E3JA 4AICA 1XCBA 4BO0A 2CDCA 2AQ8A 3OP4A 5JMWA 1PTJA 3FBTA 4FIZA 1PJ4A 4CV2A 3GAZA 1DFIA 2HK8A 1ZXBA 4BO1A 2YV1A 2RH8A 2FZEA 4UVIA 3BMQA 1SCUA 2D1YA 3GVCA 3GVPA 4F3YA 1B8VA 2FZWA 2H9IA 3TDKA 4CMBA 1C1DA 2JD0A 4Z9XA 3AU8A 2C7VA 1GYPA 1PR3A 3F3SA 2O3TA 3ZI0A 1Z45A 1ZSVA 2NVWA 4ILKA 4DQXA 1E3IA 2VOEA 3GY0A 4UREA 3ICPA 1NAHA 2AA3A 5I8WA 3HADA 3GN2A 3CE6A 4R41A 2VZ0A 2YUTA 4XZ3A 4BKPA 3U09A 4N18A 3JQAD 3BMNA 2PKRA 1D1TA 3O9ZA 3PHJA 1LQUA 1UP6A 2YHUA 3DAGA 3VZPA 2FN7A 4DL9A 3DFUA 1TXGA 3IMFA 3GNTA 1NP3A 3WYEA 4B4VA 3U4IA 4XIJA 1AUPA 3QJ5A 4FB5A 4G2NA 5AQ1A 4LVUA 2IXAA 1U7HA 2IEDA 4RVSA 5ITWA 2CVOA 1C0LA 1HLDA 4XJTA 3I1JA 1J49A 1AHHA 3F5QA 3I3OA 4MP6A 5K6AC 4HV4A 3VOSA 1KIFA 3PTZA 3ZWXA 4RJTA 2C7GA 3F9IA 3KSZO 3EC7A 4XR4A 2SCUA 1UDAA 3Q1LA 1S7CA 1NVTA 2X8LA 2OXIA 1U3TA 1C1DB 1Y5MA 1P0FA 5CDSA 1SAYA 3ONDA 2AE2A 3E6AA 1PIWA 1Y9EA 2EP5A 4BKOA 4YDRA 4CM3A 3H6KA 3RI3A 3RKUA 2D2IA 5IDQA 3KZVA 3WMWA 5TF4A 1IYZA 3AI3A 3O38A 3PI7A 4PLTA 3FI9A 4AJ2A 4L73A 5JMPA 4AJJA 3R3SA 3ZWPA 3GDOA 4Z0PA 3W8FA 4UUMA 1GCOA 2A9FA 4LK3A 3NGLA 2C82A 4DQVA 4AJIA 4KWIA 3DHNA 2YFHA 5JCJD 2VWQA 2E82A 3H2ZA 4OSOA 5DBGA 5DT9A 2G76A 3IC5A 4LVCA 4GGOA 2PGLA 3WBBA 4DVJA 1L1FA 1B8UA 3KETA 1AN9A 1B26A 1P1RA 4IDBA 3GH3A 4PVDA 2EP7A 1V8BA 5THQA 2IEBA 5KWEA 1X0XA 4FFPA 3HDQA 5IZ4A 2YJZA 4DIOA 3S8MA 3JQCA 5JCJA 1F06A 4A10A 3PIDA 5A02A 1VSUA 5L9AA 4URFA 1SB8A 3KYBA 4CLXA 4E6PA 1IZ9A 5JAQA 4BUCA 9LDBA 3OETA 1ZIDA 3WFJA 5C5IA 1D1SA 1DB3A 1OBFO 2ZK7A 3QWBA 1SOVA 5DBIA 3CPSA 1E1MA 2O3JA 3B1KA 3BYZA 1OFGA 2Y67A 4K6FA 4XWYA 4TRJA 5EL0A 5CDTA 1GYRA 2YQ4A 4J3FA 3I9OA 2P9GA 2WE8A 2WYVA 1CJCA 3LF1A 2WSBA 5L7TA 1RM5A 1PS9A 2NVUB 3S1LA 4XIYA 4TVOA 1LEHA 1ZK0A 2NU6A 3FSRA 4QX6A 1F8GA 2RHCA 3P19A 1ZK3A 1E1KA 1LLCA 4YVFA 4GH5A 5LDHA 3TN7A 1MFZA 1VL8A 1ZKMA 1K6IA 4CMEA 3AK4A 3E9NA 5CPFA 5LCXA 3RUFA 4BNNA 5DULA 3GZNA 1CERA 3I4FA 3SXPA 5EIOA 3ANMA 3QP9A 2YZ7A 3R0IA 2VT2A 1O6ZA 1TLTA 2FR1A 2A35A 4FS3A 4BNGA 1YKFA 3JV7A 3ZN2A 1U5AA 3IS3A 1NQAO 4IQGA 4BGUA 4PZEA 4DLBA 3C1AA 3ZWWA 1U3WA 2PA3A 1U2DA 1ZK4A 3GRPA 5L7YA 3IL2A 3CZMA 1E7SA 4WK6A 2FOIA 2WD7B 1JW9B 4Q3NA 5U4QA 4UEOA 4QEDA 1HKUA 4BGIA 1WDKA 2I66A 2P4HX 4I08A 3VH4A 3VH1A 4RV9A 1XQ1A 4ZRNA 2J3HA 1PZFA 2YV3A 2D8AA 1HYEA 3JD4A 2GN9A 4N7RA 5GZ1A 2BMAA 1O89A 3WYCA 1E6UA 4RZHA 5TGDA 2JFFA 3VDRA 4MINA 4NG5A 4YRBA 2JD1A 1Q7GA 5TRTA 1HWYA 2ZYGA 5MDHA 1N92A 5T8KC 4WLFA 1P33A 4KUHA 3JQBC 4BL5A 3AFMA 1HDRA 4J1SA 5TT1A 2DU8A 4QTZA 2C07A 1NVGA 2PD6A 2CF6A 2VHWA 3DTTA 3GDFA 4A2CA 2BGKA 3STHA 1ML3A 3H9JA 4DC0A 2BKAA 3BAZA 1E3LA 1DIAA 2X6TA 3X2FA 1R4NB 1V0JA 3AW9A 4OGWA 5IZCC 2I3GA 4RPKA 2QRJA 4OHUA 4BNLA 5KJFA 1UXIA 4R5MA 3P2YA 1BVUA 3JQAB 3L4SO 3R3JA 4IGFA 4CUJA 3GEMA 1PWXA 2X22A 3ZWYA 1XHLA 5L53A 4FD3A 5JY6A 1YH3A 1DAOA 3JQ9C 1FXSA 4IXWA 3G0OA 1PWZA 1WMAA 4NI5A 4OO3A 1ENOA 1W4ZA 3QVTA 3H5NA 3ENKA 3WR5A 2ZIZA 3GF4A 4RPGA 2WDZA 4PCVA 3TZKA 3O8QB 2OL4A 3HB4X 3BTUA 2CZCA 2AEFA 2IXBA 4PG6A 3WGZA 2WYWA 4FCCA 2JFHA 2UUPA 3K9QO 3JQDA 4ND5A 3RUEA 4A03A 1UAYA 2AW5A 1R16A 3RROA 2PH3A 4S3MA 4E2WA 2CMDA 3N74A 3AFNA 1ZEJA 4YT2A 2O3SA 2E49A 2PZKA 3QVXA 3W4KA 4UUPA 1W73A 4Z6KA 3VAZA 4BO3A 2VQ3A 2J3IA 1UH5A 4XDYA 4FN4A 4KZPA 4QFDA 4PLZA 2J5RA 1R4NA 2AEMA 4HNGA 4YAIA 2X23A 1GU7A 4H15A 2DFVA 4Y9DA 4YWJA 4YA6A 2AQIA 4TROA 1EVJA 4I1IA 4OXNA 1KBZA 4WKGA 2HRBA 1YDWA 1EQ2A 1WDLA 2WE7A 1FF9A 1PS0A 5KVVA 5BNIA 1T4BA 1BDBA 3PQEA 4ZGWA 3W8DA 2JHFA 2Y0EA 3FPLA 3U4CA 4O63O 3X2EA 4XYLA 3GNSA 1O9BA 2C2XA 2C5EA 3GGGA 4XEHA 5COAA 3AY6A 3PDUA 1BWSA 1ISIA 3N7UA 4D0SA 1H0KA 3H65A 4AFNA 1J6UA 1NVMB 2HMSA 5U9CA 2HK7A 2VRBA 3C1TA 3FTNA 3NYWA 3D5QA 2ZTVA 4WCFA 4DTIA 4J0EA 5CG2A 4R16A 2DT5A 3VTFA 3MJSA 3FR7A 2OP1A 4KQWA 3FNGA 4CUZA 1EDZA 3OEYA 1Q1NA 5I9NA 2BRUA 2CF5A 2Y0CA 4D43A 3PZRA 3IP1A 5IJZA 4YAJA 1Q0QA 1I10A 2DQ4A 4J7UA 5TQVA 4ZRMA 3DL2A 1DPGA 1ZNQO 2JAHA 3KSDO 1I8TA 3DQPA 2BGMA 3GLQA 4XYBA 3MWEB 3RJ5A 4FJ1A 3VPSA 5EN4A 1ISHA 2Y66A 1ADFA 3TNLA 5GZ6A 3DONA 1KEWA 2AG8A 4P38A 1YJQA 4XB1A 1NNUA 5A3VA 4B7XA 1H9AA 5HWSA 3CINA 3CMMA 5JLAA 4NU5A 4BO5A 1P77A 4W82A 2OBYA 4Y6SA 5CPBA 3WSVA 3CH6A 5IN4A 3AY3A 1PGNA 3C7CB 4ZVVA 2D5AA 3NDJA 4ND1A 3ZU5A 4ZQEA 1LX6A 4PLFA 2VHVA 3DBHB 4ZQFA 2ZTMA 2IZZA 1KVRA 1ZVMA 2NVBA 4AJHA 3BMQB 5IDXA 2W98A 3ZU4A 1FJHA 2HMVA 1ZBQA 4M87A 4P8RA 4DBVO 5T8KA 1GZ4A 1MXHA 1PJ2A 4CMIB 1BDMA 4W7HA 4JXKA 1NBOA 4CLRB 5JDIA 4QSMA 1GZ6A 4DMMA 3MWDB 5JW6A 3GNQA 1V9LA 4G5HA 4BNIA 1V3UA 2IRWA 3JYNA 5G0SA 4H16A 5J23A 3A4VA 4CQMB 3L6OO 3NX4A 1T1SA 4XRGA 4NPCA 2BI8A 1PJCA 3DZKA 5A9RA 5C37A 5L4NA 3K6JA 3OH8A 1YDEA 1HXHA 3RUAA 4YT5A 5KVQA 3ZDFA 4S1VA 1I36A 4MIYA 3DBLA 4K6CA 5KVCA 4RVHA 4FFLA 3QVWA 4XQCA 1Z74A 4FJ0A 1GDHA 4J9VA 4DXHA 3G17A 3AM4A 3ZV6A 1IPEA 5ES3A 1HTBA 2ZB4A 3F47A 4IIUA 3LT4A 4DIFA 4FGWA 1EDOA 3P2OA 4YTEA 3S2GA 4OQYA 4P22A 3GMSA 4JQCA 5JPIA 1DLJA 1XLTA 3LDHA 3TFOA 1B16A 2Y1CA 2GN4A 1JTVA 3GK3A 7MDHA 1P1FA 3GT0A 2CVQA 1R12A 3BXXA 1U1IA 4GWGA 3MTGA 3ABIA 2EKQA 4D79A 2Q49A 5F1PA 5G4KA 3SJ7A 1YO6A 1PEDA 2VRCD 3E5RA 1DAPA 3DZBA 1HT0A 1NPTO 3WTBA 3VDQA 2D59A 2ZATA 1WNTA 4CM9D 2DUWA 4CMAA 4XDZA 2AHRA 4IIVA 4Y6PA 4MIOA 3MJTA 2X0NA 2Y1GA 3ZWBA 5JYDA 2AE1A 5T57A 1G1AA 4MKZA 3MOGA 1YBVA 1GEGA 3DBLB 3ADPA 2C59A 3OQ6A 5G4KB 2EJWA 4RQUA 1P74A 4J2OA 5BNFA 6ADHA 2GASA 3AM3A 1CQIA 3UHAA 1BXGA 4L74A 3TZHA 1PQUA 2GO1A 1MC5A 5J9GA 2IYPA 5JDIC 2VZ9A 2ZYAA 4RPHA 1KERA 4CM1A 1UP4A 2RAFA 1OC2A 1JAXA 4BO9A 3PHIA 4IQ0A 4YT4A 3IJRA 4YB8A 4TRNA 2NV6A 1Y8RB 1DO8A 1ENPA 1Z7BA 3BZUA 1R37A 1BXGB 3BTOA 3WWYA 1AXEA 2OO5A 1ZJYA 3ZHZA 1PJBA 1XQ6A 4JP3A 3SEFA 1KVQA 9LDTA 2B36A 1H6AA 1ZW1A 3GOHA 1EK6A 4R4JA 3EMKA 1QG6A 2Q45A 1BG6A 4NK4A 1QORA 1GR0A 5FFFA 1BGVA 1PJ3A 5EINA 1N1EA 3ZW8A 4CR8A 4BNZA 1U8FO 2OORA 5TJ9A 3EZLA 2R00C 1C0PA 1PQWA 4MP8A 1NFRA 1HE3A 5GMOA 3WGTA 5AYVA 3B1FA 3HWRA 4GX2A 4M55A 4XKJA 3RIHA 1A4IA 3K5PA 2FR8A 2POQX 1O8CA 4WNCA 1TVEA 2RH4A 1GCUA 4HWKA 3IAHA 3D4OA 1ONNA 3JQFC 4YAEA 2VUTA 4XYMA 2H63A 1J4AA 2UDPA 4A5OA 3CIFA 2YFQA 4JJGA 3F4LA 3VVCA 1MX3A 3JQGB 1M67A 5IF3A 2YDYA 1VJ1A 3GA0A 3FTPA 4RF4A 8LDHA 4D3SA 1RYEA 1DBVO 2P91A 3INGA 2DBQA 1ISMA 2HUNA 5G2OA 4BVAA 1DSSG 4HNHA 5GY7A 3WIDA 3JD0A 2PKQO 1UXHA 3JD3A 2Z95A 2X5OA 3WLFA 3PWZA 4YYZA 3JQGA 2B4RO 1QYXA 4DYVA 2QZ9A 1LI4A 1SC6A 4R51A 2PY6A 1E92A 1MFPA 2P9EA 4YJGB 3JQBA 2CNBA 2CUKA 4B7CA 1HYHA 4XQEA 1A72A 5C7LO 3FN4A 4PLYA 1DRVA 1EE2A 1YL5A 1VJ0A 1IHYA 3A1NA 2DKNA 4HP8A 1H6DA 2HKIA 3OJ0A 3ZGYA 4G65A 4EEXA 3ZWAA 5JAZA 1A9ZA 2B69A 2OP0A 3AOGA 3K31A 3M1AA 4Q3AA 5TX7A 4WLUA 3GPDG 2NACA 1ISFA 1Z6ZA 4KQXA 3TOZA 4A27A 1EUDA 3GVIA 3TF5A 1JAYA 2O48X 3E03A 1B7GO 4I5EA 5I7SA 1QYVA 1A27A 3W6ZA 1RJWA 1YL6A 5EERA 3PRJA 3QWFA 1YXMA 3Q2IA 3ADOA 1IL0A 5AXCA 3E1KA 4J49A 2C5AA 2FPPA 4J4HA 1BW9A 3H5AA 2NWQA 5DZSA 2J8ZA 5JYAA 3FPCA 2XXJA 3VKVA 3VPHA 1HLPA 5DCYA 4CL3A 1R0LA 2F1KA 1IB6A 3DZFA 4MVJE 1C1XB 3AY7A 3VHRA 3ZHBA 3UCXA 3PQFA 2EXXA 3PHHA 1SO8A 4YRDA 2VZ8A 1QR6A 1F14A 3IIEA 2JCYA 5EQFA 3ZHYA 3M6IA 4Y6RA 2HU2A 4YAGA 4RVFA 1Z82A 2Q46A 2X9VA 4E12A 4YAKA 5ICMA 2VUUA 3GPIA 2A4KA 1LXCA 1HE2A 3FF4A 4JBHA 2E6UX 5IDYA 1QLJA 4II3A 4GX5A 4WECA 5IZCA 1EE9A 4DQUA 3HDHA 1IPFA 1WXDA 2BFOA 4ZU3A 4CM4A 1NWCA 1UAGA 1Y81A 4LCEA 4R1UA 4MDHA 1YQDA 2NQTA 3L77A 4MKRA 4R68A 4BKQA 3ROQA 3PP8A 1F8FA 3WLEA 3ONEA 1SNYA 5JAMA 4CM9A 3D4PA 2J3KA 3K73O 1I3KA 4AG3A 1YBMA 1GD1O 2NU9A 3GFBA 4EITA 3TSCA 3OIGA 3EVTA 1U4SA 3TJRA 3DZGA 1DLIA 1I3NA 4EYEA 2Y1OA 3KYCB 3SX2A 4I9NA 4Z3KA 2BFMA 1ADCA 4FFRA 3ZWNA 3SBOA 3M2PA 1WW8A 1Y8RA 1KEUA 3LLVA 5GZ3A 1PZHA 3SC4A 1EMDA 3MTJA 4E5MA 5U1PA 1MGOA 3I9KA 3NGXA 2Q1TA 4RZIA 3WQRA 2D0IA 1LUAA 2C2YA 3M2TA 4MVJM 3AUSA 4RCVA 3WBFA 4BNHA 3VPXA 4YEDA 4J1QA 5A9SA 2V6BA 5F3RA 4NIMA 1GPJA 1M76A 4AJ4A 4K9DA 1E7RA 4Q3CA 1PZGA 2I99A 2JL1A 3F5SA 2G0TA 2GN6A 2Q2VA 1MUUA 1U8XX 4NFHA 1LRKA 3ZHXA 3HJAA 2VHZA 4IINA 4FR5A 4TMFA 3ZWCA 8ADHA 2G17A 4LRSB 4M86A 1KY5A 2P5YA 2OFPA 2H1SA 2VWPA 1CEQA 5JE8A 5A5FA 4X54A 5A1TA 1Y6JA 3AUAA 1A71A 5KVSA 2AG5A 3I6IA 2J3JA 2DAPA 1PL7A 1T2CA 4LGVA 3BHIA 5JSFA 1QYDA 4OQZA 1KEPA 1KVTA 3I9MA 5BSEA 3D4NA 3D64A 3HHPA 2G5CA 3CEAA 3V5NA 4AJKA 4Q3EA 1D7OA 3T4XA 4QUKA 3MJEA 4R3WA 3BA1A 3AWDA 3U3XA 1X14A 5H81A 1H94A 5A5EA 2PR2A 5JDCA 4GX0A 4GAEA 3RU7A 2NM0A 4B3IA 4E13A 3VTZA 2DFDA 1PJQA 4ALKA 4KP7A 3DC2A 2DBVO 4J90A 4RF2A 4R1TA 3BMOA 2VTEA 2V7PA 1ISJA 1E5QA 3B70A 4IJKA 5H82A 4BNMA 1LC3A 1LNQA 1S6YA 2Y1FA 4U6SA 2Q1SA 1T1RA 1NPYA 4JX8A 2Z1MA 3GHHA 3OA2A 3QVOA 4ALJA 2DPGA 2E37A 4F6CA 4RGBA 4E5NA 3QWAA 1G6KA 4GVLA 3OJOA 1Y8QA 3HQ4O 2EJVA 4DIBA 4PFJA 5G0UA 3AM5A 3PXXA 2X0IA 3H9QA 5KJEA 1ZCJA 2DBZA 4EJ6A 1YVEI 3JTMA 1K0UA 3JQ6A 4IJVA 4E2XA 4CLRA 2OHXA 4OH1A 4BNFA 5FEUA 1Y1PA 1A5ZA 2NUAA 3ZNQA 2XF8A 3H3FA 3Q3CA 4PG4A 1GTMA 1WDMA 1C14A 2ET6A 3O4RA 3RSHA 1DXYA 3V8BA 1E3EA 3GZNB 3DMTC 3G3EA 4Z3DA 3S2EA 2IYOA 2Q4BA 1CWUA 2GZ2A 1JLLA 4ZA2A 5L4LA 4MVJA 3H8VA 1CYDA 4OSPA 2PZLA 3IKVA 1YGYA 3I9JA 3RQSA 1FMCA 5DOZA 3H9GA 1T4DA 1GEEA 2QRKA 4W7IA 3UCFA 3C7AA 4AJ1A 2XAAA 1AE1A 4YACA 5HBRA 3V2HA 4MVJG 1SPXA 4C7JA 4O0LA 1XWFA 5G0WA 5KJ1A 5T64A 1MP0A 3ZCXA 1P3DA 3K2BA 3KUXA 1NXQA 3HG7A 2VTDA 4WNIA 1U2GA 1UZLA 2IE0A 5F1OA 3QIVA 5AVOA 3DAPA 4A7PA 2NTJA 1DIGA 4BOYA 2VWGA 4P4NA 4CLOB 4XQGA 4RVUA 5BSHA 3PGJA 1JQBA 3DBVO 3WNQA 2ZYDA 1NASA 3BMCB 2VNAA 1E3SA 4ZQBA 5MGBA 3WWZA 1M6HA 3VH3A 2QYSA 5AXDA 2YW9A 1HZZA 3UUWA 4DPKA 1JVSA 1X7DA 2VHYA 4GX1A 4N5MA 5B1YA 3WQQA 3GGOA 1A9YA 4BO2A 3DZHA 4TKMA 3L6EA 2Y68A 5EESA 5JFOA 2TMDA 3JQAA 5CDGA 4JCOA 4WCFB 3LU1A 1B3BA 5BT9A 1DRWA 2EG9A 2FSSA 3SLKA 2QRLA 1GV1A 4WOKA 2ZJ1A 3JQ8A 4P4GA 3ZNOA 3GEGA 4OJNA 3ZW9A 4E32A 4IDFA 3OFSA 4CQLB 1Q7BA 1E7MA 4GMGA 1KEVA 1MB4A 1CETA 3NDIA 1FDSA 3NRCA 4DGSA 4DYDA 4AJEA 4M8SA 4JN6B 1Q0HA 4K1LA 2OOSA 1LDGA 1W0CA 1DFHA 2NU7A 4UVDA 3VH2A 3ZNPA 5KTKA 4I8XA 5F21A 5B4UA 2O23A 1DC3A 1E3WB 3TL3A 5G0TA 3H9UA 1R6DA 3CKYA 4AL4A 4DC1A 3NUGA 3VC7A 1ID1A 4I5GA 5HA5A 3FCOA 5HS4A 3AI1A 3PHGA 1U3VA 2VUSA 3T7EA 3OICA 2FP4A 4JJFA 3JSAA 4M49A 2PWZA 2B5VA 2ZB3A 3RC2A 4PLVA 3NEPX 4ZD6A 1YB4A 2FMUA 2PKQP 1PJLA 4M1QA 4E0BA 1E3WA 4QT0A 1XEAA 1I3MA 3I4CA 5I7FA 3PK0A 1WWKA 3BHMA 4QXMA 4EI2A 3D5TA 3LC2O 4FJ2A 4GGPA 3D3WA 2Q4EA 3OBBA 3HNPA 1LDYA 4YJFB 3QE3A 3WXBA 3KYDB 1DRUA 5M6DA 1LDEA 2C54A 4L75A 5I8ZA 2D4AA 1LC0A 1NTOA 1PR9A 3FNHA 4EUFA 2FRDA 4CMIA 1PZEA 4CQLA 4II2A 4U0KA 1VRWA 2RIRA 1MLDA 3Q9UA 3WDSA 1P0CA 1ISGA 2QHXA 5FI5A 5JAIA 3OIDA 4JLWA 4TSKA 2B4QA 3D3WB 4QO8A 1LSUA 2VYVA 2CSUA 4GKBA 5A4DA 1P1IA 4BNYA 2XOXA 3WGYA 1ENYA 4Y98A 3WGOA 3FD8A 3K96A 3KLPX 1K5HA 1NQTA 1O95A 3D3EA 2X0RA 4IDAA 2UUOA 4XRRA 3MJCA 3IKTA 4CJXA 4DMLA 1H2BA 4NBUA 4WJZA 2IZ1A 4LMPA 4NBVA 1YWGO 1WP4A 3HFGA 1XSEA 1P31A 3RUHA 2X9GA 3BTVA 3A9WA 4E5YA 3ETGA 1LDMA 3MJ4A 3DDNA 1KVSA 4KUGA 2P2SA 3OA0A 5JYFA 3W1VA 1OOEA 2B37A 4JIGA 2RCYA 1IY8A 4RL6A 1CF2O 1O0SA 1T25A 2VRCA 5A06A 1RWBA 1IOLA 1E6WA 2B5WA 3INTA 3OJEA 4Q3BA 1MG0A 2OGUA 4FFOA 2W8ZA 1P9LA 3JD1A 3B20A 1Y9AA 3LYLA 4Z0TA 1K2WA 3DWFA 3ZV5A 4IZIA 4XGIA 3KXDA 1I0ZA 1Z7EA 3IOYA 2B0JA 3Q9NA 3ZH2A 1XA0A 1Z75A 3GEDA 3ITKA 5TJHA 4IJWA 4D0RA 4XR9A 1P1KA 3RD5A 1NQ5A 4MVJI 1PJSA 2X0JA 3FNEA 3A06A 3FR8A 2GD1O 4R9RA 3E18A 3PVZA 5JY1A 3ON5A 4YJDA 7ADHA 3D7LA 1PU2A 3GQVA 2EW8A 1LLUA 1HEUA 2ILTA 4FFMA 5JDCC 3D1LA 3ZV3A 5KCZA 3TZ6A 2OUIA 4PLCA 1Y5RA 3CSDA 1VI2A 4R1NA 5DP1A 1RYDA 3L0DA 1DDOA 2C20A 3KOUA 2Q2QA 1H6BA 1K6XA 3LQFA 1MG5A 1B3RA 3ASVA 4NFSA 3K92A 1JKJA 2V65A 4B4OA 4WLNA 1DJNA 1LA2A 1WPQA 4BKUA 4R54A 2X58A 4O1MA 3MOIA 3SVTA 3QY9A 4XCVA 4F45A 4W99A 4DPMA 3HDYA 1ULSA 3JQ8B 4YQYA 3ORFA 4CV1A 5KNLA 3PHLA 4WPGA 1K6JA 1M2WA 4B4UA 3OHSX 1IE3A 2ZTUA 3G79A 1YOVB 3AU9A 4BNVA 1TB4A 3NTQA 1I30A 3OJLA 1AHIA 3INRA 3JD2A 2P5UA 3Q11A 3ZWMA 4WASA 4NQZA 5DDIP 1ARZA 2OZPA 4E31A 3RVDA 3H2SA 3COSA 5K6AA 2X9NA 5DCWA 1B8PA 3H3JA 2EERA 4C7KA 5AXBA 4D3DA 1GFSA 3EY4A 5ICSA 4CL8A 3MEQA 1BTOA 5IDWA 4J43A 1CIVA 4B3HA 3QV1A 1V3TA 1E1LA 1ZSNA 4LISA 3QW2A 1KETA 2QIOA 4CMEC 1PL8A 3ZV4A 3Q0EA 4AJPA 3OEWA 2VNSA 4LCJA 1ZSYA 1TT7A 1OMOA 4R69A 1JKIA 1XDWA 1Y7TA 1YQXA 4O5OA 2G1UA 1KY4A 1XGKA 3WG9A 4EBFA 5ILOA 1EVZA 2Y93A 4ZHSA 5CEJA 1GY8A 5FYDA 4B8ZA 1EUZA 1EBFA 2F00A 4IM7A 2GGSA 4R9SA 1HDYA 1XG5A 2FSVA 3V1UA 3C7DB 2DM6A 2Y1EA 4CMGA 4ZJUA 1PGPA 2ZJ0A 4WLEA 4F46A 2GCGA 1NX6A 1X7HA 3KSUA 1ADGA 1B2LA 2W4QA 3FWZA 4CM6A 4R1SA 4YJGA 5TIIA 2CFCA 2D3TA 2PV7A 1X0VA 4OAQA 2BGLA 3RFVA 1ORRA 5COBA 1XIVA 4QECA 2DTDA 5L95A 4BB6A 1H6CA 3WNVA 3H9EO 3OJFA 1NHWA 1FDVA 5TLSA 3NT5A 3NV9A 5I9MA 4ZICA 3NTRA 1HDOA 4BO8A 2LDXA 1UUFA 1H2HA 1SB9A 1U3UA 1VJTA 5DP2A 4ND3A 2O3QA 4HFRA 4D46A 4DA9A 4PG5A 1EVYA 1OAAA 1PX0A 1YB5A 5HM8A 4J1NA 3WTCA 5KKCA 4JJIA 2NSDA 4K28A 3DFZA 1DJQA 4FQ8A 1BHSA 4G81A 4IMPA 4ONEA 4AVYA 4GQAA 1DIHA 2H6EA 3H4VA 5I7VA 3G1UA 3GVXA 2Q50A 2VHXA 4J0FA 4IJUA 1RM4A 1C1XA 2I65A 2OMEA 5AOVA 4B79A 3GMDA 2AEJA 1CDOA 2WD7A 3KEQA 4MVJP 2W90A 1VM6A 4MO2A 1UXGA 2XPCA 4WCFC 5A3JA 1LTHR 1NAIA 3A28A 1E77A 3HDJA 2FHSA 2I9PA 3BMOB 3RFTA 1UJMA 4ALIA 1PQPA 5JCXA 4I5FA 1V35A 2YHIB 4RF5A 4B4WA 1X7GA 5KJCA 4NJMB 4GLLA 1RPNA 4BS9A 1LU9A 4KWHA 5TSDA 4GKVA 1N7GA 3P7MA 4RPJA 2WJPA 1YBAA 3DEYX 1Y8QB 4J7XA 3DOOA 5CHEA 5ILGA 2RBEA 2EGGA 3DZJA 4FOOA 3V1YA 4P4LA 4XQ9A 2P68A 3RC9A 3JQ7A 5DOVA 4D44A 1L7DA 3GRKA 3WJ7A 4IDDA 4RVDA 3SJUA 4BHTA 3AJRA 1O94A 3KBOA 3PIIA 1YE3A 1VSVA 4MVJH 4U7WA 3WSWA 1D4FA 4RDIA 2C29D 2GLXA 2GERA 1NR7A 4NZ9A 1QYCA 5CEFA 3S2IA 3RC1A 2HQ1A 2QQ5A 3W6UA 4YQZA 2BHLA 1I33A 2I5PO 3HN2A 5DNAA 4KMSA 2EKPA 3W4JA 5T5QA 1NHGA 4XX0A 4CLOA 3IJPA 3PZBA 3VKUA 1BW9B 2WD8A 4UUNA 3W4IA 4NHEA 1WMBA 4E2ZA 3MJVA 4AJLA 4BO4A 3NAQA 5TT0A 2CVZA 1NR1A 5A9SB 2GZ3A 2BLLA 4N5LA 2B83A 1VC2A 4KDFA 4UVHA 1P1JA 5F5LA 1GPDG 2D5CA 3WIEA 3E48A 5T6BA 3JYQA 1GQQA 4IBOA 2Y99A 3TOXA 3I52A 3CTMA 1JWBB 4XYGA 3JQ7B 1NQOA 4QFCA 1DC6A 3T7CA 3ETDA 2QG4A 1SZJG 3F1LA 1FDUA 2NTVA 3ASUA 3PFWO 3LT2A 1T2DA 4BNUA 4CM4B 4CMHA 2FWMX 3LZ6A 4OKNA 3BIOA 1XKQA 5I9LA 1VKNA 3GFGA 1LSJA 1Z73A 4RPLA 2HMTA 4NMHA 3GC6A 1LDBA 1Q2XA 1WZIA 2AQHA 3QLJA 3VVBA 3L6DA 1ZO8A 4EJ0A 1E6EA 4DWVA 4TRRA 3PYMA 3GUYA 5CDUA 1KYQA 1C0KA 5JO0A 1R0KA 4XB2A 4CLDA 2EEZA 5CP8A 3PDJA 4PIVA 2HJSA 3V2GA 2JKVA 3DAFA 4MKXA 2I67A 1ZJZA 4OM8A 5EPOA 3H7AA 1B14A 4U5QA 1H93A 1EK5A 3ZWVA 1XYGA 1LJ8A 5BNTA 4JBGA 1I32A 1ZXLA 5B12A 2BFAA 5HS6A 3GUCA 2Q22A 2QX7A 1HDXA 1L7EA 4C4OA 4BO6A 3I23A 3PWSA 3DHYA 3KYDA 1AGNA
chains in the Genus database with same CATH superfamily
2X8WA 3HLTA 3P71T 3PXCX 2HO4A 5IMSA 4CEIA 1HKHA 2FRVA 2FPRA 4WE3A 4MVJF 1E98A 2R7MA 1PNOA 3O4IA 4FNMA 4L9RA 1U0GA 3AVUA 1HE4A 2G08A 3QOXA 1GVHA 4QNMA 4URZR 4C04A 4MVXA 1CU1A 3QIAA 2XYQA 1EGHA 2MSNA 1EFKA 1TT5B 3H04A 2E4VA 4CM8A 1RPAA 4I36A 4IUYA 2YXDA 5CT6A 3TLKA 3A1SA 4HYEA 2O7SA 3N8HA 3TBHA 4IILA 1FNNA 1GN9A 2BBTA 2CMHA 2PTGA 4QGGA 3S44A 3VR5D 1SG0A 3U5ZB 3FCYA 2O8BB 1RHJA 5AIAA 3OJCA 3G1TA 4ZJYA 2QZSA 3F3YA 5E38A 1ZVJA 3D9QX 3DM5A 4E94A 2WILA 2H0QA 1WVMA 2YH2A 3PXBA 3TL2A 3A9TA 4KMOA 1A77A 3BF7A 3QSGA 1PDVA 1E9AA 4B6QA 4YQFA 1OTHA 1BIFA 4IHJB 2MSCB 3FJYA 3FLMA 5ALKA 3W2TA 1N0HA 2A5FA 3G88A 4DLPA 3DM9B 4I6JA 3MS7A 2PH5A 4EF4A 4CQNA 5CITA 1UEJA 4MJLA 2X4GA 3M1LA 3U7FB 3EODA 4OQPA 1CR4A 1YRYE 4Q12A 5CFLA 2ONZA 3VV3A 3K6RA 2XXBA 5L3ZA 1E2IA 1FX1A 2EV9A 2J0EA 3KVNA 4LX8A 4AS2A 3HEMA 4H6WA 4RGQA 1CRPA 2ZTLA 4QO7A 3L7AA 1E0AA 2JAQA 3QXSA 1RAFA 2R751 1GJRA 3D6UA 5EKTA 4AJNA 1T2AA 4BKRA 3NS7A 5KCMA 2QBYA 1SQ0A 1U1DA 1NI5A 2C3PA 1JQAA 1E2MA 3AR5A 3IB3A 4OA5A 4CUKA 2IOFK 3L79A 3ZHOA 1KEEA 1F2UA 3PFFA 4AUNA 4LSWA 4N03A 3DLBA 4W6QA 4RMIA 2P5SA 1YZHA 3A27A 4KO1S 4R7TA 2Q1UA 3H4IA 4RJJA 4R1OA 4FINA 3ITEA 3OF2A 4TOIA 1XX6A 1W4CA 3ZPXA 1ANKA 5EY5B 5TMDA 5AHKA 1FL9A 3RRXA 1X74A 3UN1A 3VISA 2FQQA 4GOMD 2POCA 1JHUA 3EVZA 1T2EA 3ZCUA 3BAFA 3MGGA 4PLGA 4EABA 3L5KA 4TLBA 4IGIA 4ZC8A 1AK1A 1VHLA 1NQUA 1IUKA 3NOVA 4P92A 1F2DA 2PS9A 2O5CA 1TPYA 5IHXA 3OFKA 2X1HA 5C8YF 1II0A 1JDJA 3FBGA 1STOA 3R5SA 1QQTA 4KN6A 4MUKA 4MPDA 1K66A 1XMPA 1H3NA 3GLRA 3TTVA 1UMBA 1OB2A 4MRPA 3P0JA 4CMCA 1V5WA 2OBBA 5MGNA 4DTCA 2JK1A 2GK7A 2ZCVA 1N32B 1QF9A 4JGIA 1UK6A 3O8DA 3UTCA 7YASA 1RP1A 5L40A 1PFKA 4JLAA 1X6VA 4P93A 3CKKA 1YMQA 2E1PA 2YJ6A 4LFBB 3QKWA 4F1KA 3GG2A 1KS2A 3WL3A 1LLDA 1Z0AA 3JQEA 3WGLA 1MX1A 3OZVA 5SZHB 1A4XA 3ZS9A 5BW8A 5FTLA 5JCZA 4A5SA 4JBXA 3U7EB 2V7VA 1RM0A 2EW1A 1UZUA 3TKLA 3F96A 1ECCA 1M2FA 1OZHA 4KI7A 4TXLA 3WFIA 4AZ3B 2EDCA 1IHUA 1P2VA 2OA0A 2ODPA 3ONVA 4Q39A 4PLWA 3NBAA 4GMHA 3RS4A 3TD2A 1NW3A 3SDSA 4HLCA 1SK9A 3K8QA 3NW9A 4MNTA 4CCYB 1YKSA 3EC1A 1SOUA 1ZNZA 4J6FA 4ZQGA 2BCJQ 4M7PA 2VXBA 4C4AA 1X3SA 5HOEA 1GA1A 2HLPA 5C81A 1MZVA 4ZT3A 3TK1A 3GLIB 3T5AA 4CEJA 2LKCA 5KNBA 1E4EA 2Z8XA 3QEBZ 3R5XA 1T0HB 2LV8A 2JGMA 3A25A 1U9IA 4WBXC 2FPSA 4WNAA 3LGAA 4ROTA 1J0DA 3KWJA 1SVUA 5DKFA 3ZBUA 1P19A 4M7OA 4TKVA 5EJ7A 1PGOA 1FNMA 5M5BA 3L7OA 3EGOA 4A8PA 1UQUA 1VLJA 1JFFA 2A5LA 2XV1A 3OIVA 2RC5A 4MWSA 1TU3A 1JSLA 1CVRA 1NU6A 3CG0A 4RIGA 2I6GA 5IJ9B 2BGGA 1ECBA 3R5KA 3U2QA 4RWEA 2JW5A 1M7BA 2C9BA 1ZH6A 3OZWA 3WB2A 5KYUA 1K4MA 4NAHA 1ZA1A 2Y2VA 3QPUA 4UJ3A 2B4YA 4DJJA 2OC9A 1EGMB 3LK6A 5DBEX 4B8WA 2R00A 1H9CA 3QI2A 5CU7A 2JBWA 3NZEA 2PRKA 1QTNA 1CUUA 3I6QA 5D3MA 2AC7A 1ZUD1 1TFUA 2P9QA 2Q0XA 3JASA 3O2NA 4YAUA 4Q47A 4WBNB 2Y0DA 1T4MA 2OHGA 5K4GA 1U4NA 2AN3A 5AKGA 3S27A 1Y7LA 2HRZA 3JVIA 2EFHB 3CF0A 3NHFA 1KQPA 3QLUC 5CYPA 1LFAA 3EEQA 4BCCA 2ZI3A 4FC6A 5JPCA 1OZ0A 3KFXA 4MRMB 5B1SA 2QE7D 4H6VA 3T7RA 1C2TA 1OV4A 4MV0A 1DIBA 4QA9A 4PYIA 4QDUA 4K9SA 1HG1A 2ZAYA 5IVPA 1S9HA 4W5JA 1NQWA 4R5HA 1OH8A 1ZK1A 2Q3HA 3F5DA 2ZREA 3WGIA 4CCSA 3UCEA 2ZAIA 4L1KA 5FLEX 1EXNA 3E5NA 2UZ1B 4XTRA 4E22A 3RKRA 1XWWA 1BHJA 2QTBA 3WISA 5JNSA 1AKYA 1BROA 2ECFA 2VCEA 1XR3A 1UDCA 2F9MA 2HU7A 3CF4G 1VA4A 5FKJA 3CUTA 2W8BB 4GPTA 1G0OA 2O9JA 3UZUA 2WT8A 3N7TA 4Y9RA 4HDKA 3N2KB 4QBGB 4X6UA 1ZWLA 2WJAA 1JWAB 3MTDA 2AXPA 1CRZA 1NF3A 3BH7A 1YRBA 3THWB 2A3NA 3SNHA 3BDIA 4GYWA 3DNMA 4YJHB 1SOWA 3FKSD 1LCIA 4HFJA 3IE0A 2WZQA 1YJ5A 2Y3IA 3LCCA 4MQFB 4EG7A 1PO7A 3C3KA 2Q99A 4EELA 5EZYB 4HDMB 4DMFA 3AHHA 3PGVA 1XZMA 4JYPA 3PYXA 4NABA 2E0IA 3R0VA 4J91A 4BLPA 3DH0A 4O6VA 2YV2A 4JBNA 3UO8B 1GTJ1 3MT8A 5KNBD 1SZPA 4I8IA 4D41A 2Q3EA 4A91A 3N9IA 4MOWA 5BVHB 3KLMX 1QXSA 2GDZA 2ORWA 3BX1A 4QVKA 3RHZA 4E5KA 5IWAB 1H3FA 2VH2A 3KKZA 1GPH1 2DY1A 3HFSA 4N5NA 4HQ0A 4G5QA 1N8KA 1QZXA 4B45A 1J0AA 4TYYA 3WLNA 4FBGA 4B6GA 4G0MA 1B0PA 2XT9A 3UW3A 4FM9A 1QIDA 3OIFA 3AERB 2CUTA 1NZJA 2HWUA 3OX3A 3OZFA 4NYJQ 4UUBA 3BB1A 4A6PA 4TS4A 4N49A 4YXWA 2L19A 4ZT6A 5B7GA 1SBZA 3DHEA 1P2DA 1PX2A 1VB3A 3OAAD 5AKHA 3TW8B 4K03A 4LOKA 1HSZA 4HTFB 5KSOA 1JQEA 4LV6A 5G4LA 3TRKA 2AR7A 3MUEA 1SUDA 2YIMA 5CEEA 4W1QA 1M2JA 1UZNA 1W96A 3RSLA 4NK5A 3NBMA 5AO9A 2DBRA 4F5EA 1Z56C 4C6SA 3DKIA 1QH8B 2LBPA 3EAFA 3EDMA 3OQVA 3UFBA 4YMLA 3H42B 1R18A 4RIHA 2CHQA 4C07A 1RRGA 2R44A 3CEPB 2JVKA 4PGFA 4EA9A 2YVLA 3HE3A 5EKXA 4X63A 3GAFA 2H06A 5IAEA 1KFCB 3FCEA 4FYPA 1V5GA 4HUJA 3ULKA 2GFIA 4G5YA 3REQB 4D9MA 4IJMA 3TQHA 2QXYA 1T5IA 1BX0A 1P3Y1 3VZDA 2J6BA 5DM60 4KK3A 1UK8A 3WYAA 5IC4A 3ISVA 1CVLA 4CKCB 2GK4A 3C70A 1G9XA 4EGFA 1L3BA 1DU4A 1NULA 2W4MA 1TTQB 1AM4D 4PIPA 4W8GA 4LSMA 1JA9A 1KJQA 2W43A 3C41J 4KNWA 1V25A 4MITA 5A05A 3WLKX 5C4MA 1V41E 2N1MA 2OR3A 4OKIA 2ONYA 3TTTA 3OD5A 2IDZA 4BWYA 1AF4A 2IGBA 1L4BA 1VXOA 2C3OA 3KELA 4DKXA 2IP4A 3ZHCA 5FBVB 4ESVA 1EVEA 1I5OA 1MT0A 4HPJB 4IZHA 5JNVA 1QOPB 2P4QA 2QXTA 3NIBA 2UVDA 1NKTA 3HCNA 4CCAA 5JH7A 1II8B 2NX2A 1CY0A 4RLHA 3SXUB 2G4CA 3AFHA 1QU2A 3RTDA 2YBDA 4HADA 5SV2A 1CHNA 4OUKX 1IUOA 1ZMOA 4WNAB 1UZMA 2GXAA 3RCBA 1F2VA 1Y6FA 2GNAA 2W2QA 1SUWA 1NLYA 4LXHA 3KR1A 1Q19A 3AOEA 2FGJA 2Z5LA 3OI7A 2BEUA 2GYWA 3HN7A 4M22A 3FTFA 4LC9A 3CN7A 3QMWA 4LDZA 1LFDB 1CUYA 3C3CA 1UC9A 2ZUEA 2HDHA 2WWFA 2WTBA 1ENZA 1KAMA 2HIGA 1H85A 4V02A 2AIRA 1JT9A 1HETA 1TMKA 1UBSB 3CF6R 1FFXB 4AYWA 4YX9A 1N9GA 2PM8A 2C2MA 2R87A 3TWOA 3IWBB 1E89A 2VJMB 2ZYWX 4MUAA 1NVVR 2WJYA 2JZCA 3RRJA 1DCMA 2XUJA 4GFDA 3LPDA 4AKTA 3EAQA 3EEYA 4MZDA 4RULA 3T3GA 5J2TA 3W5IA 2ODEA 1U04A 5EQDA 1HYGA 2WDPA 3R9XB 2TS1A 3K94A 1GNVA 4QG7A 4DR3B 3WP1B 3O2SB 2IPAB 3THYA 3OTOB 1G5QA 1G20A 2QRPA 2ZANA 3BHJA 5DTQA 3VR2D 4O29A 1FSSA 3M70A 3O8QA 721PA 4JT9A 2IEZA 4U3JA 2NW6A 5L51A 1QMGA 3R9WA 1I01A 3ZZNA 5LYJF 1E5VA 1FFYA 4D42A 1F1JA 5L4SA 1JWLA 1BMTA 3D31A 4ZZ2A 1ULUA 1KJNA 5JECA 4DCSA 1TLLA 4ZHQA 2FPMA 2GCNA 3A05A 4OLFA 3WGQA 3R40A 2GSDA 3G9QA 4O2LA 4X6YA 5JD5A 5H0IA 4D81A 4DDVA 3PQDA 1WE2A 2GF9A 1ETHA 3HU3A 3LPCA 3HO6A 4QULA 2GS9A 4WFIA 5C5EA 1J7JA 3JWIA 4KJXA 4W5RA 5K20A 3ZJVA 2WUWE 3PEFA 2EHDA 2OV2A 3TCNA 4OK3A 5CDYA 1W52X 2V54A 4GNKA 4HRYA 1XO1A 4MMZB 2ZYVX 3I9V1 3FGZA 1CLEA 1ZD5A 2RGYA 2YQZA 4YJHA 3VHLB 2DQKA 4GLFA 4GI3A 1WETA 1CFJA 1RABA 1V16A 4MB6A 2HUPA 4EPXA 2IS1A 3OZTA 5HTOA 1MC4A 3MCAA 4RD2A 2DVMA 1CJMA 5LIRA 3AEYA 1DWUA 1JH9A 1VPEA 4YR9A 4C4TA 3FHJA 3RWBA 4HAOA 5DM4A 4R01A 5HF9A 4OHPA 2PR7A 3SK0A 4DLLA 1JKFA 2O4UX 3F6YA 3IKMB 2BEJA 3KTDA 2XZPA 2YY6A 3TD9A 2R1VA 2VYFA 4DMKA 1LLFA 3ZY6A 1QE3A 4WOJA 4P5DA 4ROSA 3FW1A 2EX0A 2FSHA 2UUBB 3ZX5A 4CM5A 2IXFA 1ESMA 1XN1A 1J2EA 4JJAA 4JEUA 2P11A 4PZCA 4REMA 3V1TC 1OFTA 4ARAA 5AIBA 3II6X 1R4MA 3LSYA 5CURA 2IYYA 4PX2A 4O89A 1DCKA 1E96A 4CM7A 2LGJA 1SEPA 2Q1YA 2DEUA 3T94A 4GEGA 4AUKA 4BX8A 3WFZA 5KHLB 3B1YA 4WZBE 5T73A 1KR5A 4U2DA 1T5SA 1NSTA 3I04A 3NO4A 4BNKA 4CV3A 2WBLC 1TQHA 2BM9A 2WNHA 4Q7EA 3G2LA 1I2AA 1M83A 4FD2A 3S2FA 1QGED 1R66A 4U4AA 1F7VA 2IYEA 2PL5A 1XL0A 4L76A 2FZGA 5LA6F 2BFFB 1SZCA 3UVEA 4HKTA 3D2LA 2IU3A 5E7JA 2EWMA 1H69A 4QQRA 5IN5A 1ULBA 2GCOB 4GMFA 5ELLA 2AUNA 2I1LA 4PU0A 3SHOA 4PPFA 1IZ0A 5BPFA 5JUWA 2FZKA 5CT5A 2REOA 1U80A 2JGIA 2BP7A 4WCDA 3ND8A 3TLGB 1O6GA 2JGFA 1OKKD 4MS4A 1XVAA 4JD5A 5DXFA 3GPBA 3FETA 2PWYA 2B1GA 2FKAA 2CFOA 1J56A 2ZR9A 1S3FA 5FF9A 4AJOA 1EK2A 1NLMA 4AECA 1NM5A 2PT5A 2BMVA 2R1VB 4KXUA 3OUTA 4PR0A 1ADBA 1I7MB 4TVSA 1FSFA 4TWIA 3EMDA 3E35A 2IHTA 5CXXA 2BN4A 3RTBA 1GYQA 2AI1A 1FFGA 3EYWA 3IAS6 4OY3A 5SY9A 2R1UA 1A7KA 3V97A 5BVGB 2AW3A 4RY8A 1L8XA 1YRLA 1GZ3A 5EUQB 1N8TA 4MA4A 3WKBA 2QLLA 5JO9A 3RRMA 1F0YA 1Z0KA 1E18A 3LCRA 3UBMA 4EVIA 3GCZA 2XNJA 1Y6QA 1NLUA 3NKLA 3T54A 2C1XA 4WD3A 3PFNA 1YF3A 3PXGA 2WWRA 3PNBA 3OCYA 4ML3A 1VYTA 4IMIB 2A3RA 4EKDA 4EKNB 1BVRA 2IYWA 1DKNA 2GJ8A 5F3WB 2Z2IA 3EQ9A 1F17A 2CNNA 1CEYA 1NUQA 4LTDA 4ZCIA 2JAPA 3VYRB 1D2EA 4YDHB 4J4TA 5ALPA 2WYUA 5HUQA 1PQ4A 5A03A 4COOA 3SP1A 1LPAB 1UKBA 2X8JA 2C2BA 1YRQA 3JYHA 4Q1DA 1JNYA 5KYWB 2VDQB 3VC3A 4E2YA 3NOQA 1L4MA 3OOWA 5D3QA 2RE8A 2RI6A 5SYMA 4KGZA 5LQCA 1NPDA 1U5CA 3LRTA 1HZJA 1UR5A 2BOVA 2HXYA 4DMCA 1KP3A 2B6HA 2WUVA 3LQ2A 5ER9A 4X1OA 2PRIA 3N6VA 1H5QA 4ZZIA 5HQTA 5K0EA 2PGDA 5DM1A 4ARUA 2Y1DA 1X15A 4YIHA 5LPNA 1CR6A 4O4HF 3IQIX 1PFUA 5CVTA 4QD3A 1OFHA 3DAOA 1BDHA 2WU3A 1KBQA 2XKAA 3AQIA 5G1PA 2PGIA 3H0VB 3U80A 2RARA 4ZODA 3HBMA 3B6ZA 1ZZEA 5TXGA 1KZ1A 3PJGA 3ADBA 1TVCA 4ZAVA 4FGSA 1DHRA 3DZCA 5HGXA 5INTA 4ZYVA 4KNVA 2J7PD 3AEZA 3LKZA 4OTZA 4PAWA 1FNDA 2VP5A 1NVXQ 2OPHA 4N8SA 1VLQA 4RLFA 3VAAA 1EXMA 4IDEA 1DXOA 4TQGA 4NULA 3UJAA 3WIBA 5JZVA 5CD9A 2I91A 3KKEA 4GL4A 1I1NA 4CTNA 1EFLA 2EIHA 2QZPA 3RG8A 3WRVA 4DG9A 4KXLA 5CD1A 3C5CA 3TPFA 4REOA 5HZGA 2SNIE 2X8AA 4TTPA 4ESHA 2HLHA 2BLNA 3ZY5A 4JQOA 1WVGA 4TZTA 3U0BA 1UFVA 1BN6A 1D0IA 1VI5A 1VLLA 3E0QA 1V7PC 1P5HA 4XVHA 1FP4B 3DOCA 3PPIA 1L7QA 3WB9A 1V16B 1GNQA 4GHWA 4ALLA 4AY2A 1SD2A 4TMTA 2A9VA 4X91A 5KX5B 2WNIA 1DJOA 4NYMR 2H2AA 4IZOA 4C2UA 1XRRA 2O7QA 4KXYA 3MBIA 3DBIA 4DCGA 2JGNA 4BNJA 1W46A 1YDFA 3BGVA 3S1AA 4GYJA 2EW2A 4RA9A 3V1LA 2G28A 1XU7A 3BD9A 4RSMA 2QA5A 3NTLA 1AF7A 3RVRA 4FKBA 4KO8A 5JH7F 1JV2B 3AV3A 4BFXA 1TW3A 4N54A 2FFHA 4HAIA 5F2EA 4EI7A 3DZ8A 5CXQA 4Q4JB 2VS1A 2PSJA 2ZT8A 4K86A 4OHRA 2XNSA 5C3UA 2FDRA 2X6QA 3V34A 1I2CA 1FY2A 4MRRA 5HZMA 2ZITA 5FORA 1TUBB 3AI2A 4PGMA 4ZVQA 5H83A 3HWX1 4LHXA 1GT91 4GVXA 1GUYA 3UB3A 1QP0A 3NM5A 2XDWA 3OTGA 8ABPA 3O1LA 2IOYA 4BB5A 4BVEA 1YI8A 1XUOA 2D3WA 5CK4A 3RRNA 3TRIA 1E3JA 4TV9A 5JJIA 1H8HD 1UFRA 1XCBA 3WIOA 1RQGA 3GJ7A 1QZZA 1VBFA 3RANA 5B2ZA 1U0OC 2RHTA 1Z7GA 4NBSA 2YJ3A 4UPDA 1XDSA 4WK0B 4WXHA 3D6FA 2PMEA 3Q1KA 3CO5A 1CUDA 1XJ5A 1ZXBA 2BGIA 3P2KA 4DZZA 1RKVA 1CS4C 2ZRBA 4JENA 3RT9A 4QJ5A 3TV1A 4HQRA 5HK9A 2HHLA 2VTBA 1WG8A 1RC1A 1WR8A 5THXA 3SXJA 1XEWY 4GPIB 1YQWA 2O57A 2H9IA 2FFBA 2DHRA 3GMIA 3DMRA 3G59A 1GYPA 2R1ZA 1YB7A 1C7IA 3O3CA 4QUIA 3UWKA 1PR3A 3D6AA 3EQ2A 4NMMA 2NVWA 2VAPA 3L8GA 4ILKA 4G0WA 3G8CA 1RJFA 3GY0A 1R9MA 3OE1A 5CH8A 1NAHA 4X44A 3LM8A 4A16A 4A8JC 3GN2A 4I1VA 3BH0A 2PYDA 1N5LA 4LY0A 1QWSA 4LGYA 1WKVA 5T3YA 4K6HA 4W5NA 4QBHA 1E66A 2J3DA 3K5IA 5IW8A 3L02A 3RRBA 2PKRA 1MMFB 1M10A 3O9ZA 2XRFA 3CRMA 4OXRA 1UP6A 1ZD9A 1C4WA 1ZCZA 1N1DA 2FN7A 3PHCA 4DA0A 1NP3A 2GAOA 3E3LA 2X5NA 3SX4A 1EJ0A 1E61A 1XLUA 3OOSA 2H31A 5JI3E 1Q91A 1P18A 4X7MA 3REFA 4W63A 3AIMA 1HLDA 1X8XA 3FOEC 4WADA 1WBDA 4GC9A 3I1JA 4XJTA 3F5QA 3A3KA 4MP6A 3V8VA 4HV4A 2J0SA 1PRYA 3VOSA 1FQKA 3SN6A 4XDGA 5DO9A 2H48A 3EWNA 4RJTA 2NSHA 1X38A 3D6TB 4XR4A 1SOMA 2SCUA 3G8DA 3AX6A 3IRUA 4Q7LA 5KNDA 1XV5A 5DNVA 4OBEA 1NVTA 2OXIA 1F38A 3MQ4A 4Q9KA 1U3TA 1T8RA 1Y5MA 2K5UA 2N3ZA 3A1EA 3CWCA 1Y5NA 2ZSAA 4KN9S 5F73A 1A8PA 3T38A 5CIWA 5CDSA 3O83A 3FYHA 3W6NA 3NC1C 4B1FA 3O4JA 3V80A 2HYIC 1DVRA 2WM8A 3GLTA 2H4XA 1J00A 3Q7EA 2AE2A 3P5BA 1AD2A 3SZ3A 5FTNA 1RS0A 2EP5A 1ZRNA 2Z9DA 4YRJA 1OE0A 3H6KA 3H6GA 1USKA 3RI3A 1VXRA 3GRVA 2HF8A 1XPUA 4OYLA 3UUGA 3KZVA 2CJYA 3WMWA 2SKEA 1IYZA 3O38A 5TF4A 2QVXX 3FI9A 1FEZA 3GFRA 3L8DA 4L73A 1ZYUA 3WLAA 3DPIA 3PNYA 1VLZA 2O1EA 2PX4A 3AWIA 4QICA 5AT1A 1XKTA 3W8FA 1PYOA 3IA2A 4UUMA 2A9FA 4TT8A 3NGLA 4GQBA 4QPCA 1ZJJA 2BMWA 3ZG6A 4DQVA 4EKGA 3UAYA 2JLVA 4Q9IA 5JNTA 3IVAA 4TT3A 4GM0A 2ZRDA 1E2NA 2VQDA 3THSA 2BISA 5FOTA 4LZOA 1JG1A 4GECA 4TZ6A 4TLLB 3IYLW 3EP6B 2JARA 3OPNA 5DT9A 2G76A 4RU1A 2Z2KA 1CTQA 4LMBA 3F2VA 3IC5A 4RVOA 1U28C 1NW8A 1W1WA 5AOCA 2VSYA 2UXCB 2I3BA 2PBZA 4DVJA 1J1IA 2YWJA 3HZHA 3CJRA 1B26A 1K8YB 1P1RA 4IDBA 4PVDA 3SE0A 2O2DA 1NY6A 2ATXA 1X0XA 4DR6B 3HDQA 5FJIA 4F4FA 4IRUB 3M6MD 4M76B 3GJ6A 4DIOA 1UMKA 1A95A 3S8MA 3PIDA 3OZXA 3A9SA 1RLIA 2CFTA 4B35A 1VSUA 1PLJA 5L9AA 3GAAA 5DYGA 2X2FA 1P2FA 1SB8A 3KYBA 4KPYA 1U7DA 1IZ9A 4YDSA 2P9HA 1ZLXA 2IPMA 3N5CA 2AV6A 1Q14A 4DDWA 2P3QA 2A1TR 5AVYA 5C5IA 5IJ9A 3F73A 1PJ8A 5DLPA 3OQMA 2ZM5A 1SOVA 5SZJA 2G9NA 3QUCA 2XD9A 3CPSA 5TPWB 3H5OA 3ZZUA 1RQXA 2ONJA 4K87A 3FJ1A 1E6LA 1LPBB 3BM5A 1HK7A 3MG9A 4BV2A 3LFUA 1CFZA 3LW8A 1WCXA 2IEIA 1L7OA 3B12A 5EL0A 2P9GA 4ERXA 1EA5A 2RGEA 2WJVA 3IMCA 1CJCA 5LA6B 2WSBA 3JWJA 1KDZA 4LWOA 2WWYA 4YALA 1LEHA 1ZK0A 2NU6A 3B5JA 1FMFA 1NI4B 4RUKA 3ZUPA 3QKUA 2HV9A 1F8GA 2OB2A 5AKIA 3K0HA 2ZUCA 4B73A 1ZK3A 2PCJA 3VU1A 2VZEA 1S8OA 4U6NA 1JR4A 1DG3A 4YBRA 2GBLC 3TNDA 1VL8A 1ZKMA 4O4LA 3DL0A 3IIJA 3AK4A 1F20A 5LCXA 1OVGA 2VHTA 3GZNA 4D9JA 2QD2A 3UUEA 1CERA 2G25A 1A82A 3GFQA 1PNTA 1BA3A 3W9SA 4AMYA 1YAHA 1U7UA 3ANMA 4NYMQ 2IH5A 1GPWB 3R0IA 5HVNA 5I7FA 3EXHA 5JS1A 1S4QA 1Z2NX 3FZQA 3KJNA 1YKFA 3EWAA 3SD7A 3V2IA 2WSIA 2WA1A 1ESCA 2VQFB 2P30A 3MRVA 3L46A 4ZK6A 4DQLA 1G2PA 1XMQB 3CCBA 1JTFA 2IV3A 1U3WA 3SHFA 5L7YA 3GRPA 3NP9A 2WY2D 2PMDA 3IL2A 5KYXA 5BMVA 1JW9B 1ORIA 4Y2JA 4UEOA 3M33A 1THTA 5FWDA 2I66A 2P4HX 2R66A 4ZRNA 1A5AB 2JFQA 5C8ZA 1BHQ1 1PZFA 2YV3A 5CLLA 2ODBA 5JZBA 1K7SN 1V7ZA 5TGDA 4LQCA 1JEJA 2PVPA 4DEYA 3KUKA 2ZAOA 4Y2HA 1BJTA 4YRBA 3HKEB 2H1VA 3C2QA 3O8OA 4HDMA 2P6MA 2ZYGA 5MDHA 3Q85A 2XRZA 4WLFA 3DLPX 4ZTZB 4OAOA 1MOSA 1BD3A 1SFRA 1AKRA 4J94A 4DBLC 3CNBA 1Z6XA 3G9UA 1IOWA 1MORA 4RZQA 4CFSA 1KK1A 5AK5A 4FMDB 4FNGA 2WSSD 4RC9A 5JD3A 2P4EA 2ZQ5A 4UUQA 1SCBA 1J7KA 2C07A 2J48A 4KQ1A 4BBJA 3DT9A 3T5MA 2JKZA 1K3FA 3NUQA 2VDUE 5JVDA 5F9HA 2YOGA 3QHQA 4NENA 2ZSHA 2UVQA 3UH0A 1YZKA 1ML3A 3CUUA 3I62A 2DWCA 4MW4A 3OFJA 2PYZA 1E3LA 1XD9A 4Q7MB 3VGPA 3TTYA 1XL1A 1Y89A 3ELYA 3QELA 1E64A 4V0LA 1VMIA 3AW9A 3VVMA 5IZCC 3VNVA 4Q05A 1KQFA 4PNZA 1EFCA 1WPXA 2QRJA 2NN3C 2XT0A 3E9DA 3PUJA 4OHUA 4RPKA 4BTEA 4D9HA 3EFOA 3R3JA 1PR2A 2JIRA 3X0DA 4P98A 1A98A 1UKCA 2CBGA 1XHLA 2O0JA 4O5AA 1K0FA 2XKJE 4D9IA 2GUWA 3V9PA 3EHDA 4ATNA 1SK8A 4IXWA 4DHEA 3TW4A 1PWZA 2Q5CA 1ZDMA 3H5NA 1T6ZA 2PX0A 2V7QD 3SHWA 3SZGA 4IGAA 4LHVA 4LMAA 3GF4A 1BFUA 3L8HA 1CF9A 1ULTA 5JJLA 4PCVA 1SM4A 5FBHA 4N6GA 5ADUS 2OL4A 4C5AA 2GD0A 3M6XA 2XGJA 2WYWA 4IP0A 4FCCA 4HAVA 3GJ8A 3JQDA 4ND5A 3QEAZ 1NF2A 3Q72A 4A03A 2OXCA 1UWVA 2ZSJA 3K0FB 3BGOS 4E2WA 4A2QA 5J4LA 3N74A 4R2WA 3ACDA 3MD9A 1YR8A 2O3SA 1T6XA 1CT9A 1RHRA 4G8JA 3I04M 1O6FA 2B34A 5EE0A 2XOEA 1ZMXA 1KQOA 4TZ0A 2I8AA 3VAZA 3DT8A 4J03A 3NWEA 2WSMA 5DHUA 2ANBA 4JQYA 4XDYA 3HSYA 4FN4A 4KZPA 5AM0A 4ZT4A 5CFNA 5JYCA 2IKQA 2J5RA 5FTKA 4RS3A 4C06A 1CJBA 2NUPB 4L8FA 4I4LA 4YWJA 4KYIB 3P8ZA 2ZI6A 3L6UA 1FLVA 3FHOA 2J87A 4B9EA 4JI8B 4I1IA 3ZJXA 1KBZA 1WZCA 1T3SA 4MYTA 4WKGA 5JRJA 2ZIWB 2HRBA 1R0BA 2P65A 3AVPA 2DR3A 2W4IA 4B3SB 1P7YA 1QPGA 4KAAA 4C1NA 1NM5C 2AD1A 5BSRA 1JIIA 4IOJA 4M1ZA 4ZGWA 2IS4A 3W8DA 4B3BA 3BSYA 4JOCA 3LYUA 4DG5A 3FAZA 3FOCA 1FOEB 3U4CA 3BXFA 3A04A 2AOWA 2XJ4A 1O9BA 2C2XA 1V37A 2G9QA 3G7UA 1N3LA 4V3CA 4E3WA 2NT3A 1R0XA 4D0SA 2AYYA 1KMIY 1RVV1 1J6UA 1NVMB 2QT0A 2GA9A 2IDMA 2IYNA 3VHXB 1G20E 4MQUA 3TNYA 3D5QA 4UFNA 4EW2A 1N33B 2F43A 4J0EA 4DSUA 2IF0A 2QTVB 5BQ3A 4I0WB 5E9AA 1EFDN 3VTFA 5JV5A 4NCAA 1AJEA 4KQWA 1EDZA 2XJ9A 2IW1A 2PKEA 3LX6A 3BSFA 3OEYA 5JVDF 4NCBA 4UE2A 5LM3A 3HHEA 5E9QA 2FN3A 1R8SA 1TQ2A 3NHJA 2VR1A 3WK6A 2BRUA 2ZRIA 2NNWB 3FY4A 1NJFA 2Y0CA 4EHKA 3DYBA 1T8UA 1EDDA 3NWBA 4F4UA 3IP1A 5IJZA 5ED4A 2ZXEA 1Q0QA 3HCWA 1I10A 3B48A 3I28A 3SAJA 1MW8X 1QQBA 3NYIA 4ZRMA 3MS2A 3PTAA 4CKXA 3DQPA 1SPBS 3GLQA 5LD2C 2YHAA 4FLEA 2NUPA 3HBNA 3N07A 4MUHA 5EN4A 3A10A 5FWYA 3KOZA 1RCFA 1ISHA 2O8BA 3QUTA 3RIYA 3FNBA 4HZIA 2CMFA 2I4TA 3PGLA 4RM2A 4LHYA 1U5BA 3ND9A 2NZ8A 2FUEA 1JEDA 3QK7A 4WY8A 1W4AA 3UJPA 4HLUA 4OCZA 5A3VA 4ZZ3A 2HRCA 3P2JA 4QXQA 3C7KA 4A0GA 1P77A 3S8EA 4RY0A 1P4AA 2HSZA 4W82A 1TTTA 4EDHA 3MB5A 1X7WB 2J7PA 4DLUA 2FDXA 4QPZA 1XMVA 1WBJB 2HBRA 4M0EA 5BT8A 3P2MA 1LX6A 1V96A 3R3VA 4PLFA 2O1XA 4CF6A 2VHVA 3LDFA 3IE1A 1VJRA 3KKMA 2IZZA 3V46A 2NVBA 1GAQA 3A32A 3BMQB 3QG5A 2W98A 3S3TA 4AJHA 2QVZX 2DT8A 1ZBQA 2QRHA 3U4GA 1GZ4A 2QLTA 2WIKA 2I6QA 2FWBA 2OILA 3CLUC 4EHFA 1CNFA 2GXQA 1BDMA 3DQZA 4DQKA 1BMFD 2R6R1 2HA6A 3Q7SA 3UWPA 5JW6A 4BMDA 1ULAA 4G5HA 5BNWA 3KTAB 2G0AA 1T3HA 3JYNA 4B9AA 3GRCA 4BEBA 2XCUA 5CCEA 5LQJA 3L6OO 3ZXXA 2VJCA 4JXZA 3KCNA 1PJCA 3QFHA 1O4VA 1NE2A 5A9RA 10MHA 1FSGA 5C37A 5L4NA 3K6JA 3F7TA 3OH8A 4OQDA 4Q01A 2VYCA 2FUG6 5JLJA 4EX7A 3DT6A 2OBLA 3R41A 4D9GA 1M6NA 5CVDA 4YT5A 5GP1A 2AS0A 1CB0A 3ZDFA 2G5TA 4F2HA 4ARZA 3KLNA 3FHTA 4CLQA 4MIYA 1OT3A 4M38A 2WWIA 3CS3A 5AM4A 4FFLA 3QVWA 1YAJA 2AC2A 1Z74A 3ZEIA 5AHOA 5BXQC 1ZM9A 2ACEA 1G291 1GDHA 5IYZF 4TMZA 1QRDA 3BCSA 4FUQA 4LV8B 4NOMA 1J2JA 4DMUB 4RHXA 2RC6A 1HTBA 1Q1GA 2BRUC 2E4WA 3NHZA 4IIUA 4XH9B 4A0HA 1SIUA 3PKZA 3CNQS 3ECAA 4LGMA 3U4MA 1NE7A 3SOPA 1K8XB 4F1JA 4JELA 3UT6A 4KREA 2FR8C 2DLCX 4TXNA 3F9RA 1DMRA 2R6DA 2ZIXA 2HFKA 1TZJA 3FYUA 3K16A 3TFOA 3H8WA 2I7DA 1U98A 4KQKA 3G9ZA 2Y1CA 3HCFA 3P4UA 5K0BA 1JG6A 1I7BB 3PC8A 5CA1A 1OCEA 2IUUA 5KREA 1D0SA 1H0RA 7MDHA 3GT0A 4JS0A 1JB1A 2DH6A 5DGIA 1CS0B 1EWVA 1U1IA 2QJOA 1DXHA 2RHMA 3BE8A 3RVMA 1VE3A 4DV6B 2HJ9A 2PX5A 1RNLA 1SKMA 1CUBA 1YO6A 3R3XA 3LAWA 4WESA 5K3OA 3E5RA 4TMKA 3CLKA 2ZAGA 3DZBA 2B2XA 1J99A 3MQFA 5KQMA 1EFPA 4JVMA 5TMPA 1X7XA 1CZKA 1JENB 2D59A 4LJKA 1WNTA 5K3DA 3DE3X 4IDHA 2WABA 1GPYA 4FHZA 1FVOA 1VLHA 3HNOA 4MIOA 4I55F 2X0NA 3ZWBA 7MHTA 5JYDA 1OSNA 4Q0MA 5B3JA 3TVTA 1E3MA 4ILEA 4MKZA 2YMQA 1X80B 4TQAA 2P90A 1T8WA 4QGFA 3R9XA 2FEMA 4ZO7A 3ZE7A 2J07A 1PW5A 1QF7A 5ALQA 1FNBA 4O2BF 4PX3A 3WHPA 6ADHA 1MO6A 2X4IA 1PDOA 3AM3A 4CG3A 5IXJA 2E4YA 4KGXA 2R7LA 3L40A 4JEHA 5DLQC 5JCOC 3OQHA 5FA6A 4S1TA 1I7DA 1S7GA 1JHVA 2GO1A 1MC5A 3OQOA 3WI7A 1U0HC 4JVOA 2OCPA 4JLMA 2ZYAA 3K2IA 3KKNA 1U2TA 2Z2ZA 5BRNA 3HM9A 1OC2A 5DIFA 1Z18A 4IQ0A 3IP6A 4NKRA 5F4ZA 2W6CX 2Z83A 3NIGB 3F9CA 1JKJB 3EVEA 4YB8A 1DGQA 2NV6A 1Y8RB 4FOLA 4Q1BA 1DO8A 1ENPA 1WVIA 3EZ7A 1O5TA 3BRQA 1WMFA 1R37A 1AXEA 1Z6PA 2OO5A 2CV2A 3ZHZA 4DVGA 2AOUB 2PQ0A 3CZQA 4WK2B 2KW5A 1P5JA 2B36A 4K9KA 1ZW1A 4YJ3A 3MW8A 2Q45A 1V11A 4CFZA 1QHYA 5ITZB 2BC9A 4C4XA 2ZPUA 3Q9LA 2DH5A 4HRAA 1OLSA 1CY6A 1QORA 2M2IA 2ZT6A 3KEGA 4ZT7A 1T0UA 3QH4A 3RS9A 3KQQA 1EZ1A 3WK4A 3PC3A 4HVAA 4BVLA 2Q5QA 1Z5UA 3ZW8A 4AQYB 4N82A 3G8BA 2YRWA 1PD0A 4L6AA 2YY5A 3RTCA 2R00C 1C0PA 1O7JA 1XQ9A 1UM9B 3ZXIA 4EGCB 3VMFA 4HWPA 3PQ2A 1DTWA 1ZESA 3C6KA 1R6UA 1T5OA 3OTHA 3FPEA 4MP8A 2ZPTX 3H4TA 4EHJA 2AK2A 4H7JA 1XTSA 2QUZA 2PKWA 3IPLA 5AYVA 3B1FA 3HWRA 3UJ3X 3A36A 3ZY2A 3K5PA 4I4TF 5FTMA 1SU7A 2GJAA 1U6KA 4MRAA 2DP4E 3ERCA 2Q5FA 3D2AA 4WNCA 1RJDA 4XI9A 5I45A 1DWOA 3KVRA 3PCRB 5DGXA 1XZFA 1OYOA 5FV7A 3D4OA 1ONNA 1NW6A 1LQ2A 1W35A 4HYQA 1J4AA 4MLDA 5TEVA 4ZZ0A 3RO7A 5CDFE 4A5OA 1VCIA 3VVCA 3F4LA 1PWHA 1XZGA 4BDTA 1ZM7A 3HJCA 2HL6A 3VPCA 2BCEA 3THWA 2EKBA 2Y9MB 1EAMA 1E79D 2W9XA 3GA0A 1ZGHA 3H99A 3IFSA 4RF4A 4D3SA 3UOAB 3INGA 2WVJA 3OU7A 4WL0A 1Z4MA 3SS9X 5G2OA 3TUIC 1R0WA 5I7WA 4KLNA 5DSXA 5GY7A 2IHZA 2PKQO 3YASA 3KAQA 3JD3A 1QMPA 2Z95A 4EW3A 3UY4A 5FUXA 3PWZA 5H3CA 4RV4A 4P80A 2A9PA 4QODA 4QYTA 3BRCA 4AMGA 3JQGA 3RJZA 4YYZA 4ZJPA 4MPPA 1LI4A 5JSUA 1P9RA 4UUAA 2LIVA 1IQUA 2P9EA 1R8YA 4I2NA 5JMOA 1D2NA 2BUAA 2H51A 1X1AA 4DMGA 2CNBA 3ETNA 4OQNA 2IXEA 4TS3A 4C20A 4C7XA 3KWMA 1XTTA 4XQEA 3D7NA 4ZOEA 3SIRA 2J9RA 1RXEA 3VJKA 3MRTA 4KDRA 4PF1A 3P9KA 4PWYA 7ABPA 1T1JA 2WHPB 1H6DA 2HKIA 3ZGYA 1QJCA 3R4CA 3K70C 3AY0A 4RE5A 4QQNA 4POAA 4LXIA 4EEXA 3G0IA 2XZLA 1I4OA 2OP0A 3RYHB 3M1AA 1FPQA 4D2IA 2QXUA 2R1TB 2Q4TA 2IHJA 2XI4A 1IHDA 1Z6ZA 4KQXA 1KPIA 2X0EA 3ZQKA 3TF5A 1J24A 1XCPA 4B6EA 5BR4A 3KKQA 4I5EA 5KTYA