1E83A

Cytochrome c' from alcaligenes xylosoxidans - oxidized structure
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
126
structure length
126
Chain Sequence
b'EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Unprecedented Proximal Binding of Nitric Oxide to Heme: Implications for Guanylate Cyclase
pubmed doi rcsb
molecule tags Electron transport
total genus 48
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2000-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1e83A00
5JSLA 3NMKA 5JT4A 3ZQVA 256BA 1CGOA 4IB4A 3NMJA 4WGYA 2YL3A 2QLAA 3M15A 4L6RA 4WGZA 4U9EA 4ULVA 1QQ3A 2XLDA 2YL1A 1E83A 2XL8A 1YYXA 4CDVA 1CPQA 3QVZA 2CCYA 2YL7A 4D4XA 4N4WA 4U9DA 1A7VA 4CIPA 4NC3A 2XM4A 4CDYA 3HNJA 3HNIA 2YL0A 3VRCA 4D4NA 2J9BA 1CGNA 1NBBA 1RCPA 2XM0A 5JVEA 3DE8A 1MQVA 2YLIA 3DE9A 1GQAA 2XLEA 2YLGA 5JP7A 3QW0A 5JRAA 3QW1A 5B3IA 1EKYA 4JKVA 3IQ5A 4EIYA 1LM3B 4IAQA 3U8PA 5JS5A 1QPUA 4JEBA 1M6TA 1E85A 1YZAA 3TOMA 3IQ6A 3L1MA 3M79A 4CDAA 2XLVA 2XLMA 1E84A 5AGFA 1E86A 2XLWA 3M4CA 1S05A 4JE9A 5JLIA 3QVYA 3ZTMA 4CJGA 3C63A 2BC5A 4CX9A 4N6HA 3HNLA 3NMIA 3ZQYA 1CPRA 3HNKA 1APCA 2XL6A 1JAFA 3C62A 1YYJA 3FOPA 3M4BA 5JUAA 2YKZA 3ZWIA 1YZCA 2XLOA 3TOLA 3FOOA 2YLDA 2XLHA 4ER9A 4JEAA 1BBHA 4CJOA 2J8WA 4IARA 3ZTZA
chains in the Genus database with same CATH superfamily
5A6BD 4NCQA 1YLMA 2OG2A 2VB6A 1RJ9B 1SMYF 1I5NA 3GWNA 3OWTA 4IB4A 1HE1A 2NG1A 1BR2A 2DGJA 2Y3DA 3UMIA 2Q9AA 2PX3A 1GGQA 1LPEA 1M2VB 3ABKC 4JZAA 3ZDLA 3R7CA 1YARO 4U9EA 2BE5F 1WN0A 3S90A 4CS9C 1MNEA 3S84A 5CIVA 1TFKB 1ZHTA 2R7OA 3M1CB 2I8BA 2A6HF 2EIJC 3H2UA 1QQ3A 2HSQA 2XLDA 2YL1A 5KYWA 5TJ5E 4O79A 2FGYA 2G3VA 3QTHA 2YEVA 1A7EA 4DOZA 4H54A 5AC5A 3K66A 1VYIA 2EPLX 3CAXA 2DB4A 4CS7A 5EGYA 2ZXWC 4D4XA 3Q7GA 4MVRA 3AGTA 3LJBA 4Q5SF 2L6HA 3B29A 2Y69C 4CIPA 4YWQA 2KC3A 2EPNA 3DD7A 2A1DD 3CSKA 3RH3A 3NKEA 4U5EE 3K1IC 4LERA 4NQFA 1VB5A 1QSPA 2IXNA 4OD4A 3VRCA 2J9BA 4EWCA 3LEVA 1H7IA 3SEOA 1CGNA 2UUHA 4WJ0A 3JTLO 5L0FA 2ASRA 3U2MA 2Q4FA 4EBBA 3UGPA 4XEFA 3RQGA 2WZGA 2J7PA 1NFNA 3JZ0A 3SYNA 2EILC 4P9FA 3SZRA 5KYNA 1D1AA 1U0BB 4HE8D 3DE9A 4IAOA 2YLGA 2XLEA 1BDJB 3MYIA 3TJ5A 1OCOC 2X51A 3U0CA 4OIQF 5JP7A 3U3FA 3AG2C 2XS8A 3AQCA 3G4ZA 2VC9A 3L0IA 3FAPB 3QW1A 4R32A 4OIRF 3C8GB 1EKYA 5L0HA 2KJGA 1LS4A 3HTKC 1H9GA 3FVYA 2AVKA 3O39A 2MHRA 5L0CA 1FFTC 3FXHA 3PMRA 1HW2A 1HY5A 4MTOA 4FAPB 1LM3B 3G50A 3FDQA 3GM2A 1TWCA 3US6A 3FAJA 4HFFB 1OXBA 1XZQA 3VF0A 1BZ4A 1Q0FA 1NFOA 1E85A 1V74B 2CGEA 2KQ9A 3M79A 2R25A 3TK0A 1FMVA 3NYLA 4DXWA 3B0PA 5AGFA 3ABMC 2XLWA 3B9QA 5BQGA 3U9MA 3SXMA 2PNOA 4JE9A 4CS8C 5JLIA 2TMVP 4IWBA 3T6GB 1G8XA 1HMDA 3ZTMA 3C63A 3I5QA 4C3EA 1L3PA 4GYTA 2GAQA 3MBGA 1ZVZA 3CEXA 3EFOB 1V54C 2CNWA 3LLKA 1T9KA 1EA8A 2XL6A 2AU5A 5EHHA 3G4XA 4NTBA 4FWVA 3FOPA 5JUAA 4JVSA 1BR1A 2HFIA 4RD9A 1YZCA 1B68A 1QZXA 1WOLA 1YDIA 3C8ZA 4QI0A 4Z9HA 3RQEA 1OCCC 2CYDA 1RKEA 3V7OA 1F1MA 1LS1A 4MTGA 2L9JA 4PFPA 5AC4A 4C7OA 2DYSC 1I4ZA 1K04A 1D1CA 2KNHA 2ZXPA 3BEHA 3N24A 3Q6MA 4MQ9F 3UNGC 4JEAA 3DWWA 2KW3C 3HKKA 4W8PA 4XTKA 3TULA 4I1MA 1ORYA 2HV6A 3OA1A 2XS1A 4GQHA 2J8WA 1VLSA 3KYJA 4IARA 2AP3A 1OR3A 3ZTZA 2IM8A 3NMKA 4K0DA 2XXAB 2YQYA 3BRJA 1JPNA 1KU2A 256BA 3EPVA 2A69F 3W2VA 4MW8A 2NUPA 5A6BA 3MFNA 3NMJA 4WGYA 2R7WA 2EPKX 2L6FA 2W45A 5L0GA 3KYIA 4C3DA 4LLEA 3TJ6A 3S9OA 3WG7C 4WGZA 1GS9A 2J9VA 1UFBA 2AWCA 4JIOA 4BJTA 3ZVRA 4LDKA 3KMIA 4CSAA 2DI3A 1TFOB 2PBEA 3GORA 3HJCA 4G0HA 4CIHA 1Y4CA 3F46A 1E83A 1Z3IX 3JYYA 2Q3TA 3EG9A 4CDVA 3QVZA 5E2QA 3EQLF 1ORJA 1WASA 2A68F 3N2ZB 3RF3A 3ZG1A 3IQCA 2R05A 4BJ5A 3EGXB 3GEHA 4OIOF 5FZTA 3POVA 3CQZA 4XEKA 1FFHA 4N4WA 4PACA 3ZIBA 2HS5A 2HSBA 2OOCA 4OIPF 2DYRC 2R7XA 2R9RB 5L3VA 1HMOA 2MYSA 1RMVA 5KYUB 2X0CA 1FAPB 1J8MF 2YL0A 2XSEA 3LEOA 1OKKD 4B6IA 4E7SA 4D4NA 2EIMC 3KKBA 4DBRA 2NSFA 1FTSA 2OEXA 1ST6A 4CS9A 1C03A 1M2OA 4YT8A 3K33A 1NSGB 1AVOB 2OJQA 4XPYA 3UR3C 5KYYA 3RFYA 1RXQA 1ZHYA 1RCPA 2YWAA 5JVEA 2HKVA 1MQVA 3DE8A 3EGDB 5A69A 1FR0A 1OCRC 4LDRA 4I1OB 5CI8A 3RYLA 3I5PA 3S29A 4AE4A 2ZXRA 3GWLA 4HEAJ 3QW0A 4YL0A 2WB7A 2H8AA 1ZW3A 5E3AA 5B3IA 4JCHA 2VCBA 2H7BA 4HFKB 2HMZA 1NLXA 2J0WA 1I4YA 4JKVA 1D1BA 3PCVA 4Z9JA 1O3UA 3L8JA 3K1IA 4OINF 4EIYA 2IOQA 1Q0MA 1FNTc 2Y3BA 2P61A 5JS5A 1NG1A 1QPUA 2LD6A 3E9VA 2JPUA 1YZAA 4YJWA 5A6JA 2G62A 1DOWA 4NTFA 4U5BE 2XLVA 4A2NB 2AWYA 2Y3GA 2FAPB 2XLMA 1VMAA 3JSEO 3M4CA 3U5SA 3PDMP 1K05A 2YZSA 2QE9A 2NUTA 1LE4A 2RD9A 5DQZA 2BC5A 2B0JA 2HJMA 1ZW2A 1G4WR 3EJNA 3T6BA 1PD0A 3HNLA 1N1CA 2H7OA 3N0TA 4N6HA 4N6CA 2IYLD 1OW8A 3NMIA 1J8YF 3DJNB 2PP4A 1OXKA 4E0IA 1WATA 1ZYRF 3DAFA 4FESA 3X1OA 5KYXA 2NSGA 4LDQA 2W9YA 4U5CE 3SP1A 2F22A 3KH2A 4PJLA 3RVZA 3M4BA 4DRIB 5T3WA 4NTAA 5COGA 4DJ9A 1C17M 4E0HA 2YKZA 3B71A 4X0RA 1VK5A 1IZMA 3RVYA 4EUKB 1SYQA 4WABA 3S28A 2NUPB 4XPWA 3W4YA 2ETSA 4MTFA 2P1AA 2YLDA 5A6KA 1Q0DA 5F5FA 1M56C 5L0JA 4ER9A 2W4BA 3A11A 4DRHB 1TWAA 2R02A 3NG1A 2HV7A 3GANA 4CJOA 1MMDA 4MNDA 2UUIA 3B0VC 4AL1A 3ATPA 3IQTA 4J7YA 5FCLA 1KNYA 1M2VA 1ZZPA 4O6MA 4CS8A 2P0NA 5BQIA 2KSFA 3ZQVA 4PK4A 1D0ZA 3EG9B 1CGOA 3O55A 2OQMA 2PF4E 3V5ZA 5CI9A 2L81A 4DVZA 3VAYA 1Z7Qc 3A9CA 3NYMA 2QLAA 3L34A 3M15A 4L6RA 3FHDA 4QI2A 4LLCA 4AK9A 3NDBB 1YJGA 3ZSUA 4W8KA 4MVOA 2V26A 1OQCA 4ULVA 2G3KA 1VLTA 2OCCC 4ULWA 1MMGA 1Z63A 1NU9C 2XL8A 3K6BA 4MVZA 3IPMO 5T1DB 2VASA 1CPQA 3EHNA 4BPMA 3K7DA 4JCZA 4KC9A 2CCYA 1YVIA 2GDCA 3DM9B 2H7VC 1GM5A 4I44A 5GPGB 2Z15A 3ZC4A 3AQBA 1PD1A 2PX0A 5KYWB 4YT4A 4RBNA 3T6JA 1VYKA 5COMA 1NZEA 2XL4A 2MWQA 4BEJA 1D0XA 2LSEA 1OW6A 2A0UA 1ZHZA 2CDQA 4Z9IA 4NC3A 4JJGA 3JRTA 1ORSC 2R03A 4CDYA 4ONSA 2LIGA 3HNJA 3RW0A 5DS4A 5D91A 2GWWA 3B0UX 5L3QA 3HLZA 2Q7RA 2EIKC 1PCXA 1AEPA 3AGUA 3UMKA 1T6UA 1OKKA 1YAUO 1NU7D 2KGOA 1SR2A 4RDAA 4BJ6C 2R7RA 2XM0A 1IW7F 3AOUA 4M63A 4EHPA 1JPJA 2YLIA 4G78A 2CW0F 4PJJA 2WZFA 4IJJA 3Q7LA 1GQAA 4ANJA 5A6AA 1A7DA 2E87A 4YT2A 2A6EF 4KNWA 1W2WA 1CGME 5K0IA 1LE2A 1O5HA 4KI2A 4P6IC 1HW1A 3IEEA 4BG0A 3UGOA 4NY3A 3JRMO 1LI5A 3AG3C 4H4KC 4AX2A 1AUEA 1SZIA 1MMAA 3SXZA 3J06A 2HUJA 2LFFA 3GEIA 5F5HA 4G7OF 2JD3A 1HE9A 1V55C 4MVMA 3DM5A 3UMHA 1JOGA 1Y6DA 3EH1A 4IAQA 3U8PA 3H2VA 4C3BA 2R7UA 2P7VA 4KBLA 4DBQA 1PV3A 4JEBA 1Z5ZA 3C8GD 4YN0B 1M6TA 1ZHXA 3TOMA 2BL2A 4J30B 2RSEB 2W4MA 3JYHA 1OW7A 5COFA 4CDAA 3EFOA 4U5DE 4JJFA 4XLNF 3SXKA 1E86A 3ASNC 3O10A 2Y39A 3GEEA 3V5YA 5HSWA 1G5ZA 4CJGA 2QTVA 2LK4A 3OEOA 4PJMA 4Q4ZF 4CX9A 2YVKA 2R7SA 1A0BA 1Q0KA 1T5OA 3U3BA 3W2WA 2D4UA 2IXMA 3LLIA 2WZLA 4FX5A 2PFDA 3C62A 3NRHA 3L8IA 4EBJA 4YK5A 4O6NA 2WVNA 3KL4A 3ZWIA 2C03A 3PHF2 2XLOA 3RQFA 1H6GA 3FOOA 3NKDA 4LACB 2R7VA 2XXAA 3DJUB 1O87A 2XLHA 3LS0A 4JTDB 1QVXA 3ITFA 2ICWG 2QY9A 4XEVA 3K1HA 2Y3HA 1A41A 3EZHA 1ZHWA 3ECSA 5F28E 2ZD9A 1D0YA 2IXOA 3LNRA 4J32B 5DS6A 3TD7A 1RKEB 2EPMX 5JSLA 4GEHA 1E2XA 5JT4A 4C7OB 4DVYP 4OD5A 3LAYA 2R7QA 3U8VA 1R5ID 5DS5A 1UG7A 1TWHA 3U2LA 1BR4A 2WL8A 1RKCA 3GM1A 4Q7CA 1U6HA 2YL3A 1H9TA 1TKNA 3C18A 2O9XA 2OJED 2VCAA 5IY5C 1SF8A 4U5FE 1S7ZA 2JX0A 3FMSA 3JSZA 3S27A 1M57C 2KYHA 2LP4A 3H65A 2WVQA 3LUTB 2A0BA 4K1OA 2NPUA 1OCZC 3EGXA 5L0DA 3I4UA 4U5GA 1ZU4A 3DAGA 3W8HA 3QMKA 2J9UA 3C7JA 4XQ1A 1T01A 3MX3A 1RJ9A 3T4RA 1XWJA 1YYXA 2EPOA 2FFHA 2J0XA 2KK1A 2L7AA 4K7BA 5B1AC 4U5HA 4ZLCA 3GODA 4MVSA 2HJ3A 2YL7A 3EH2A 3V5XA 2B0HA 5KYUA 3MYFA 2P6VA 3U9JA 4ZLDA 2M4EA 4U9DA 1G4US 5E33A 5L0IA 2YHSA 4KNVA 4PFOA 4YT5A 1T6IA 3VM6A 1A7VA 4EBKA 4MS2A 4MVUA 4JRZA 2XM4A 3O6XA 3AJMA 2Q9BA 3LNMB 3EGDA 4JTAB 4E7ZA 3HNIA 4G7HF 2YRFA 3Q6NA 2J46A 1EQ1A 2J7PD 4XLPF 3ASOC 4EKWA 3CZ6A 4O6YA 1LI7A 1L7CA 1LKXA 1NBBA 2LFDA 1JR8A 3SXYA 4BEMJ 1Z23A 1R4TA 3IHUA 3JT1A 4PR9A 2I15A 1JMWA 2C04A 2M64A 3KPHA 4JW1A 3NYJA 4O7GA 4PJNA 1XZPA 2LCHA 2ZXOA 3WODF 3E70C 1WTYA 2V3CC 3ABLC 3AG4C 3TQOA 5T3TA 5JRAA 5KYYB 1ZU5A 2Q00A 4AL0A 1EI7A 2GFHA 5BQHA 1OR2A 3EZIA 3DXJF 4N06A 2GA0A 2VH3A 3WAQA 4AE4B 3JCUQ 3MLGA 4E17A 1KTMA 3F47A 5DLJA 3IQ5A 4MW3A 5E3CA 4CBEA 1TQGA 4I3MA 3DZAA 2OU6A 4QDLA 4BJ1A 2J45A 2WVOA 2VCCA 1K40A 2OKUA 4MVQA 3S0XA 1FMWA 3IQ6A 3L1MA 1V4AA 1TR2A 2QUPA 1Q0GA 3C8GA 1E84A 4BJ6A 1Z6AA 1S05A 3SNHA 1LVKA 2LQGA 1WWPA 2HMQA 3QVYA 5EK0A 3RIPA 5B3SC 4JC7A 2J9WA 4E18A 2R7TA 2CNWD 3EHMA 4DRJB 1VTMP 3ZQYA 1VOMA 1CPRA 4JURI 4A4AA 4YL3A 2EINC 5D92A 3HNKA 1APCA 1QLEC 3GM3A 3RKOF 4F4BA 3DKAA 3DI5A 2NUTB 1JAFA 2QNLA 3W8IA 4IGGA 1T6QA 1DOVA 1YYJA 2D5RB 3LS1A 4XPXA 2IXPA 4YL1A 5DVWA 3X2QC 4UDVA 2OEVA 1YA9A 3TOLA 4CSAC 5DQTA 3LESA 1WGWA 3R2PA 3VYWA 3WHNA 1TWGA 2Q9CA 3QZCA 4XWJA 3T9OA 1LIHA 5KYXB 1U89A 1C02A 2ZPAA 3DMDA 1MMNA 3AG1C 5BUOA 1MNDA 1BBHA 2HZ8A 2L6GA 4P9TA 4BJ5C 1YA7O 1JRAA 2IBFA 4IRUA 1QKRA 5HV9A 4G7ZF 5B1BC 2XRHA 4J7TA 4JTCB
chains in the Genus database with same CATH topology
5JSLA 3NMKA 5JT4A 3ZQVA 256BA 1CGOA 4IB4A 3NMJA 4WGYA 2YL3A 2QLAA 3M15A 4L6RA 4WGZA 4U9EA 4ULVA 1QQ3A 2XLDA 2YL1A 1E83A 2XL8A 1YYXA 4CDVA 1CPQA 3QVZA 2CCYA 2YL7A 4D4XA 4N4WA 4U9DA 1A7VA 4CIPA 4NC3A 2XM4A 4CDYA 3HNJA 3HNIA 2YL0A 3VRCA 4D4NA 2J9BA 1CGNA 1NBBA 1RCPA 2XM0A 5JVEA 3DE8A 1MQVA 2YLIA 3DE9A 1GQAA 2XLEA 2YLGA 5JP7A 3QW0A 5JRAA 3QW1A 5B3IA 1EKYA 4JKVA 3IQ5A 4EIYA 1LM3B 4IAQA 3U8PA 5JS5A 1QPUA 4JEBA 1M6TA 1E85A 1YZAA 3TOMA 3IQ6A 3L1MA 3M79A 4CDAA 2XLVA 2XLMA 1E84A 5AGFA 1E86A 2XLWA 3M4CA 1S05A 4JE9A 5JLIA 3QVYA 3ZTMA 4CJGA 3C63A 2BC5A 4CX9A 4N6HA 3HNLA 3NMIA 3ZQYA 1CPRA 3HNKA 1APCA 2XL6A 1JAFA 3C62A 1YYJA 3FOPA 3M4BA 5JUAA 2YKZA 3ZWIA 1YZCA 2XLOA 3TOLA 3FOOA 2YLDA 2XLHA 4ER9A 4JEAA 1BBHA 4CJOA 2J8WA 4IARA 3ZTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JSL A;  3NMK A;  5JT4 A;  3ZQV A;  256B A;  1CGO A;  4IB4 A;  3NMJ A;  4WGY A;  2YL3 A;  2QLA A;  3M15 A;  4L6R A;  4WGZ A;  4U9E A;  4ULV A;  1QQ3 A;  2XLD A;  2YL1 A;  1E83 A;  2XL8 A;  1YYX A;  4CDV A;  1CPQ A;  3QVZ A;  2CCY A;  2YL7 A;  4D4X A;  4N4W A;  4U9D A;  1A7V A;  4CIP A;  4NC3 A;  2XM4 A;  4CDY A;  3HNJ A;  3HNI A;  2YL0 A;  3VRC A;  4D4N A;  2J9B A;  1CGN A;  1NBB A;  1RCP A;  2XM0 A;  5JVE A;  3DE8 A;  1MQV A;  2YLI A;  3DE9 A;  1GQA A;  2XLE A;  2YLG A;  5JP7 A;  3QW0 A;  5JRA A;  3QW1 A;  5B3I A;  1EKY A;  4JKV A;  3IQ5 A;  4EIY A;  1LM3 B;  4IAQ A;  3U8P A;  5JS5 A;  1QPU A;  4JEB A;  1M6T A;  1E85 A;  1YZA A;  3TOM A;  3IQ6 A;  3L1M A;  3M79 A;  4CDA A;  2XLV A;  2XLM A;  1E84 A;  5AGF A;  1E86 A;  2XLW A;  3M4C A;  1S05 A;  4JE9 A;  5JLI A;  3QVY A;  3ZTM A;  4CJG A;  3C63 A;  2BC5 A;  4CX9 A;  4N6H A;  3HNL A;  3NMI A;  3ZQY A;  1CPR A;  3HNK A;  1APC A;  2XL6 A;  1JAF A;  3C62 A;  1YYJ A;  3FOP A;  3M4B A;  5JUA A;  2YKZ A;  3ZWI A;  1YZC A;  2XLO A;  3TOL A;  3FOO A;  2YLD A;  2XLH A;  4ER9 A;  4JEA A;  1BBH A;  4CJO A;  2J8W A;  4IAR A;  3ZTZ A; 
#chains in the Genus database with same CATH topology
 5A6B D;  4NCQ A;  1YLM A;  2OG2 A;  2VB6 A;  1RJ9 B;  1SMY F;  1I5N A;  3GWN A;  3OWT A;  4IB4 A;  1HE1 A;  2NG1 A;  1BR2 A;  2DGJ A;  2Y3D A;  3UMI A;  2Q9A A;  2PX3 A;  1GGQ A;  1LPE A;  1M2V B;  3ABK C;  4JZA A;  3ZDL A;  3R7C A;  1YAR O;  4U9E A;  2BE5 F;  1WN0 A;  3S90 A;  4CS9 C;  1MNE A;  3S84 A;  5CIV A;  1TFK B;  1ZHT A;  2R7O A;  3M1C B;  2I8B A;  2A6H F;  2EIJ C;  3H2U A;  1QQ3 A;  2HSQ A;  2XLD A;  2YL1 A;  5KYW A;  5TJ5 E;  4O79 A;  2FGY A;  2G3V A;  3QTH A;  2YEV A;  1A7E A;  4DOZ A;  4H54 A;  5AC5 A;  3K66 A;  1VYI A;  2EPL X;  3CAX A;  2DB4 A;  4CS7 A;  5EGY A;  2ZXW C;  4D4X A;  3Q7G A;  4MVR A;  3AGT A;  3LJB A;  4Q5S F;  2L6H A;  3B29 A;  2Y69 C;  4CIP A;  4YWQ A;  2KC3 A;  2EPN A;  3DD7 A;  2A1D D;  3CSK A;  3RH3 A;  3NKE A;  4U5E E;  3K1I C;  4LER A;  4NQF A;  1VB5 A;  1QSP A;  2IXN A;  4OD4 A;  3VRC A;  2J9B A;  4EWC A;  3LEV A;  1H7I A;  3SEO A;  1CGN A;  2UUH A;  4WJ0 A;  3JTL O;  5L0F A;  2ASR A;  3U2M A;  2Q4F A;  4EBB A;  3UGP A;  4XEF A;  3RQG A;  2WZG A;  2J7P A;  1NFN A;  3JZ0 A;  3SYN A;  2EIL C;  4P9F A;  3SZR A;  5KYN A;  1D1A A;  1U0B B;  4HE8 D;  3DE9 A;  4IAO A;  2YLG A;  2XLE A;  1BDJ B;  3MYI A;  3TJ5 A;  1OCO C;  2X51 A;  3U0C A;  4OIQ F;  5JP7 A;  3U3F A;  3AG2 C;  2XS8 A;  3AQC A;  3G4Z A;  2VC9 A;  3L0I A;  3FAP B;  3QW1 A;  4R32 A;  4OIR F;  3C8G B;  1EKY A;  5L0H A;  2KJG A;  1LS4 A;  3HTK C;  1H9G A;  3FVY A;  2AVK A;  3O39 A;  2MHR A;  5L0C A;  1FFT C;  3FXH A;  3PMR A;  1HW2 A;  1HY5 A;  4MTO A;  4FAP B;  1LM3 B;  3G50 A;  3FDQ A;  3GM2 A;  1TWC A;  3US6 A;  3FAJ A;  4HFF B;  1OXB A;  1XZQ A;  3VF0 A;  1BZ4 A;  1Q0F A;  1NFO A;  1E85 A;  1V74 B;  2CGE A;  2KQ9 A;  3M79 A;  2R25 A;  3TK0 A;  1FMV A;  3NYL A;  4DXW A;  3B0P A;  5AGF A;  3ABM C;  2XLW A;  3B9Q A;  5BQG A;  3U9M A;  3SXM A;  2PNO A;  4JE9 A;  4CS8 C;  5JLI A;  2TMV P;  4IWB A;  3T6G B;  1G8X A;  1HMD A;  3ZTM A;  3C63 A;  3I5Q A;  4C3E A;  1L3P A;  4GYT A;  2GAQ A;  3MBG A;  1ZVZ A;  3CEX A;  3EFO B;  1V54 C;  2CNW A;  3LLK A;  1T9K A;  1EA8 A;  2XL6 A;  2AU5 A;  5EHH A;  3G4X A;  4NTB A;  4FWV A;  3FOP A;  5JUA A;  4JVS A;  1BR1 A;  2HFI A;  4RD9 A;  1YZC A;  1B68 A;  1QZX A;  1WOL A;  1YDI A;  3C8Z A;  4QI0 A;  4Z9H A;  3RQE A;  1OCC C;  2CYD A;  1RKE A;  3V7O A;  1F1M A;  1LS1 A;  4MTG A;  2L9J A;  4PFP A;  5AC4 A;  4C7O A;  2DYS C;  1I4Z A;  1K04 A;  1D1C A;  2KNH A;  2ZXP A;  3BEH A;  3N24 A;  3Q6M A;  4MQ9 F;  3UNG C;  4JEA A;  3DWW A;  2KW3 C;  3HKK A;  4W8P A;  4XTK A;  3TUL A;  4I1M A;  1ORY A;  2HV6 A;  3OA1 A;  2XS1 A;  4GQH A;  2J8W A;  1VLS A;  3KYJ A;  4IAR A;  2AP3 A;  1OR3 A;  3ZTZ A;  2IM8 A;  3NMK A;  4K0D A;  2XXA B;  2YQY A;  3BRJ A;  1JPN A;  1KU2 A;  256B A;  3EPV A;  2A69 F;  3W2V A;  4MW8 A;  2NUP A;  5A6B A;  3MFN A;  3NMJ A;  4WGY A;  2R7W A;  2EPK X;  2L6F A;  2W45 A;  5L0G A;  3KYI A;  4C3D A;  4LLE A;  3TJ6 A;  3S9O A;  3WG7 C;  4WGZ A;  1GS9 A;  2J9V A;  1UFB A;  2AWC A;  4JIO A;  4BJT A;  3ZVR A;  4LDK A;  3KMI A;  4CSA A;  2DI3 A;  1TFO B;  2PBE A;  3GOR A;  3HJC A;  4G0H A;  4CIH A;  1Y4C A;  3F46 A;  1E83 A;  1Z3I X;  3JYY A;  2Q3T A;  3EG9 A;  4CDV A;  3QVZ A;  5E2Q A;  3EQL F;  1ORJ A;  1WAS A;  2A68 F;  3N2Z B;  3RF3 A;  3ZG1 A;  3IQC A;  2R05 A;  4BJ5 A;  3EGX B;  3GEH A;  4OIO F;  5FZT A;  3POV A;  3CQZ A;  4XEK A;  1FFH A;  4N4W A;  4PAC A;  3ZIB A;  2HS5 A;  2HSB A;  2OOC A;  4OIP F;  2DYR C;  2R7X A;  2R9R B;  5L3V A;  1HMO A;  2MYS A;  1RMV A;  5KYU B;  2X0C A;  1FAP B;  1J8M F;  2YL0 A;  2XSE A;  3LEO A;  1OKK D;  4B6I A;  4E7S A;  4D4N A;  2EIM C;  3KKB A;  4DBR A;  2NSF A;  1FTS A;  2OEX A;  1ST6 A;  4CS9 A;  1C03 A;  1M2O A;  4YT8 A;  3K33 A;  1NSG B;  1AVO B;  2OJQ A;  4XPY A;  3UR3 C;  5KYY A;  3RFY A;  1RXQ A;  1ZHY A;  1RCP A;  2YWA A;  5JVE A;  2HKV A;  1MQV A;  3DE8 A;  3EGD B;  5A69 A;  1FR0 A;  1OCR C;  4LDR A;  4I1O B;  5CI8 A;  3RYL A;  3I5P A;  3S29 A;  4AE4 A;  2ZXR A;  3GWL A;  4HEA J;  3QW0 A;  4YL0 A;  2WB7 A;  2H8A A;  1ZW3 A;  5E3A A;  5B3I A;  4JCH A;  2VCB A;  2H7B A;  4HFK B;  2HMZ A;  1NLX A;  2J0W A;  1I4Y A;  4JKV A;  1D1B A;  3PCV A;  4Z9J A;  1O3U A;  3L8J A;  3K1I A;  4OIN F;  4EIY A;  2IOQ A;  1Q0M A;  1FNT c;  2Y3B A;  2P61 A;  5JS5 A;  1NG1 A;  1QPU A;  2LD6 A;  3E9V A;  2JPU A;  1YZA A;  4YJW A;  5A6J A;  2G62 A;  1DOW A;  4NTF A;  4U5B E;  2XLV A;  4A2N B;  2AWY A;  2Y3G A;  2FAP B;  2XLM A;  1VMA A;  3JSE O;  3M4C A;  3U5S A;  3PDM P;  1K05 A;  2YZS A;  2QE9 A;  2NUT A;  1LE4 A;  2RD9 A;  5DQZ A;  2BC5 A;  2B0J A;  2HJM A;  1ZW2 A;  1G4W R;  3EJN A;  3T6B A;  1PD0 A;  3HNL A;  1N1C A;  2H7O A;  3N0T A;  4N6H A;  4N6C A;  2IYL D;  1OW8 A;  3NMI A;  1J8Y F;  3DJN B;  2PP4 A;  1OXK A;  4E0I A;  1WAT A;  1ZYR F;  3DAF A;  4FES A;  3X1O A;  5KYX A;  2NSG A;  4LDQ A;  2W9Y A;  4U5C E;  3SP1 A;  2F22 A;  3KH2 A;  4PJL A;  3RVZ A;  3M4B A;  4DRI B;  5T3W A;  4NTA A;  5COG A;  4DJ9 A;  1C17 M;  4E0H A;  2YKZ A;  3B71 A;  4X0R A;  1VK5 A;  1IZM A;  3RVY A;  4EUK B;  1SYQ A;  4WAB A;  3S28 A;  2NUP B;  4XPW A;  3W4Y A;  2ETS A;  4MTF A;  2P1A A;  2YLD A;  5A6K A;  1Q0D A;  5F5F A;  1M56 C;  5L0J A;  4ER9 A;  2W4B A;  3A11 A;  4DRH B;  1TWA A;  2R02 A;  3NG1 A;  2HV7 A;  3GAN A;  4CJO A;  1MMD A;  4MND A;  2UUI A;  3B0V C;  4AL1 A;  3ATP A;  3IQT A;  4J7Y A;  5FCL A;  1KNY A;  1M2V A;  1ZZP A;  4O6M A;  4CS8 A;  2P0N A;  5BQI A;  2KSF A;  3ZQV A;  4PK4 A;  1D0Z A;  3EG9 B;  1CGO A;  3O55 A;  2OQM A;  2PF4 E;  3V5Z A;  5CI9 A;  2L81 A;  4DVZ A;  3VAY A;  1Z7Q c;  3A9C A;  3NYM A;  2QLA A;  3L34 A;  3M15 A;  4L6R A;  3FHD A;  4QI2 A;  4LLC A;  4AK9 A;  3NDB B;  1YJG A;  3ZSU A;  4W8K A;  4MVO A;  2V26 A;  1OQC A;  4ULV A;  2G3K A;  1VLT A;  2OCC C;  4ULW A;  1MMG A;  1Z63 A;  1NU9 C;  2XL8 A;  3K6B A;  4MVZ A;  3IPM O;  5T1D B;  2VAS A;  1CPQ A;  3EHN A;  4BPM A;  3K7D A;  4JCZ A;  4KC9 A;  2CCY A;  1YVI A;  2GDC A;  3DM9 B;  2H7V C;  1GM5 A;  4I44 A;  5GPG B;  2Z15 A;  3ZC4 A;  3AQB A;  1PD1 A;  2PX0 A;  5KYW B;  4YT4 A;  4RBN A;  3T6J A;  1VYK A;  5COM A;  1NZE A;  2XL4 A;  2MWQ A;  4BEJ A;  1D0X A;  2LSE A;  1OW6 A;  2A0U A;  1ZHZ A;  2CDQ A;  4Z9I A;  4NC3 A;  4JJG A;  3JRT A;  1ORS C;  2R03 A;  4CDY A;  4ONS A;  2LIG A;  3HNJ A;  3RW0 A;  5DS4 A;  5D91 A;  2GWW A;  3B0U X;  5L3Q A;  3HLZ A;  2Q7R A;  2EIK C;  1PCX A;  1AEP A;  3AGU A;  3UMK A;  1T6U A;  1OKK A;  1YAU O;  1NU7 D;  2KGO A;  1SR2 A;  4RDA A;  4BJ6 C;  2R7R A;  2XM0 A;  1IW7 F;  3AOU A;  4M63 A;  4EHP A;  1JPJ A;  2YLI A;  4G78 A;  2CW0 F;  4PJJ A;  2WZF A;  4IJJ A;  3Q7L A;  1GQA A;  4ANJ A;  5A6A A;  1A7D A;  2E87 A;  4YT2 A;  2A6E F;  4KNW A;  1W2W A;  1CGM E;  5K0I A;  1LE2 A;  1O5H A;  4KI2 A;  4P6I C;  1HW1 A;  3IEE A;  4BG0 A;  3UGO A;  4NY3 A;  3JRM O;  1LI5 A;  3AG3 C;  4H4K C;  4AX2 A;  1AUE A;  1SZI A;  1MMA A;  3SXZ A;  3J06 A;  2HUJ A;  2LFF A;  3GEI A;  5F5H A;  4G7O F;  2JD3 A;  1HE9 A;  1V55 C;  4MVM A;  3DM5 A;  3UMH A;  1JOG A;  1Y6D A;  3EH1 A;  4IAQ A;  3U8P A;  3H2V A;  4C3B A;  2R7U A;  2P7V A;  4KBL A;  4DBQ A;  1PV3 A;  4JEB A;  1Z5Z A;  3C8G D;  4YN0 B;  1M6T A;  1ZHX A;  3TOM A;  2BL2 A;  4J30 B;  2RSE B;  2W4M A;  3JYH A;  1OW7 A;  5COF A;  4CDA A;  3EFO A;  4U5D E;  4JJF A;  4XLN F;  3SXK A;  1E86 A;  3ASN C;  3O10 A;  2Y39 A;  3GEE A;  3V5Y A;  5HSW A;  1G5Z A;  4CJG A;  2QTV A;  2LK4 A;  3OEO A;  4PJM A;  4Q4Z F;  4CX9 A;  2YVK A;  2R7S A;  1A0B A;  1Q0K A;  1T5O A;  3U3B A;  3W2W A;  2D4U A;  2IXM A;  3LLI A;  2WZL A;  4FX5 A;  2PFD A;  3C62 A;  3NRH A;  3L8I A;  4EBJ A;  4YK5 A;  4O6N A;  2WVN A;  3KL4 A;  3ZWI A;  2C03 A;  3PHF 2;  2XLO A;  3RQF A;  1H6G A;  3FOO A;  3NKD A;  4LAC B;  2R7V A;  2XXA A;  3DJU B;  1O87 A;  2XLH A;  3LS0 A;  4JTD B;  1QVX A;  3ITF A;  2ICW G;  2QY9 A;  4XEV A;  3K1H A;  2Y3H A;  1A41 A;  3EZH A;  1ZHW A;  3ECS A;  5F28 E;  2ZD9 A;  1D0Y A;  2IXO A;  3LNR A;  4J32 B;  5DS6 A;  3TD7 A;  1RKE B;  2EPM X;  5JSL A;  4GEH A;  1E2X A;  5JT4 A;  4C7O B;  4DVY P;  4OD5 A;  3LAY A;  2R7Q A;  3U8V A;  1R5I D;  5DS5 A;  1UG7 A;  1TWH A;  3U2L A;  1BR4 A;  2WL8 A;  1RKC A;  3GM1 A;  4Q7C A;  1U6H A;  2YL3 A;  1H9T A;  1TKN A;  3C18 A;  2O9X A;  2OJE D;  2VCA A;  5IY5 C;  1SF8 A;  4U5F E;  1S7Z A;  2JX0 A;  3FMS A;  3JSZ A;  3S27 A;  1M57 C;  2KYH A;  2LP4 A;  3H65 A;  2WVQ A;  3LUT B;  2A0B A;  4K1O A;  2NPU A;  1OCZ C;  3EGX A;  5L0D A;  3I4U A;  4U5G A;  1ZU4 A;  3DAG A;  3W8H A;  3QMK A;  2J9U A;  3C7J A;  4XQ1 A;  1T01 A;  3MX3 A;  1RJ9 A;  3T4R A;  1XWJ A;  1YYX A;  2EPO A;  2FFH A;  2J0X A;  2KK1 A;  2L7A A;  4K7B A;  5B1A C;  4U5H A;  4ZLC A;  3GOD A;  4MVS A;  2HJ3 A;  2YL7 A;  3EH2 A;  3V5X A;  2B0H A;  5KYU A;  3MYF A;  2P6V A;  3U9J A;  4ZLD A;  2M4E A;  4U9D A;  1G4U S;  5E33 A;  5L0I A;  2YHS A;  4KNV A;  4PFO A;  4YT5 A;  1T6I A;  3VM6 A;  1A7V A;  4EBK A;  4MS2 A;  4MVU A;  4JRZ A;  2XM4 A;  3O6X A;  3AJM A;  2Q9B A;  3LNM B;  3EGD A;  4JTA B;  4E7Z A;  3HNI A;  4G7H F;  2YRF A;  3Q6N A;  2J46 A;  1EQ1 A;  2J7P D;  4XLP F;  3ASO C;  4EKW A;  3CZ6 A;  4O6Y A;  1LI7 A;  1L7C A;  1LKX A;  1NBB A;  2LFD A;  1JR8 A;  3SXY A;  4BEM J;  1Z23 A;  1R4T A;  3IHU A;  3JT1 A;  4PR9 A;  2I15 A;  1JMW A;  2C04 A;  2M64 A;  3KPH A;  4JW1 A;  3NYJ A;  4O7G A;  4PJN A;  1XZP A;  2LCH A;  2ZXO A;  3WOD F;  3E70 C;  1WTY A;  2V3C C;  3ABL C;  3AG4 C;  3TQO A;  5T3T A;  5JRA A;  5KYY B;  1ZU5 A;  2Q00 A;  4AL0 A;  1EI7 A;  2GFH A;  5BQH A;  1OR2 A;  3EZI A;  3DXJ F;  4N06 A;  2GA0 A;  2VH3 A;  3WAQ A;  4AE4 B;  3JCU Q;  3MLG A;  4E17 A;  1KTM A;  3F47 A;  5DLJ A;  3IQ5 A;  4MW3 A;  5E3C A;  4CBE A;  1TQG A;  4I3M A;  3DZA A;  2OU6 A;  4QDL A;  4BJ1 A;  2J45 A;  2WVO A;  2VCC A;  1K40 A;  2OKU A;  4MVQ A;  3S0X A;  1FMW A;  3IQ6 A;  3L1M A;  1V4A A;  1TR2 A;  2QUP A;  1Q0G A;  3C8G A;  1E84 A;  4BJ6 A;  1Z6A A;  1S05 A;  3SNH A;  1LVK A;  2LQG A;  1WWP A;  2HMQ A;  3QVY A;  5EK0 A;  3RIP A;  5B3S C;  4JC7 A;  2J9W A;  4E18 A;  2R7T A;  2CNW D;  3EHM A;  4DRJ B;  1VTM P;  3ZQY A;  1VOM A;  1CPR A;  4JUR I;  4A4A A;  4YL3 A;  2EIN C;  5D92 A;  3HNK A;  1APC A;  1QLE C;  3GM3 A;  3RKO F;  4F4B A;  3DKA A;  3DI5 A;  2NUT B;  1JAF A;  2QNL A;  3W8I A;  4IGG A;  1T6Q A;  1DOV A;  1YYJ A;  2D5R B;  3LS1 A;  4XPX A;  2IXP A;  4YL1 A;  5DVW A;  3X2Q C;  4UDV A;  2OEV A;  1YA9 A;  3TOL A;  4CSA C;  5DQT A;  3LES A;  1WGW A;  3R2P A;  3VYW A;  3WHN A;  1TWG A;  2Q9C A;  3QZC A;  4XWJ A;  3T9O A;  1LIH A;  5KYX B;  1U89 A;  1C02 A;  2ZPA A;  3DMD A;  1MMN A;  3AG1 C;  5BUO A;  1MND A;  1BBH A;  2HZ8 A;  2L6G A;  4P9T A;  4BJ5 C;  1YA7 O;  1JRA A;  2IBF A;  4IRU A;  1QKR A;  5HV9 A;  4G7Z F;  5B1B C;  2XRH A;  4J7T A;  4JTC B; 
#chains in the Genus database with same CATH homology
 5JSL A;  3NMK A;  5JT4 A;  3ZQV A;  256B A;  1CGO A;  4IB4 A;  3NMJ A;  4WGY A;  2YL3 A;  2QLA A;  3M15 A;  4L6R A;  4WGZ A;  4U9E A;  4ULV A;  1QQ3 A;  2XLD A;  2YL1 A;  1E83 A;  2XL8 A;  1YYX A;  4CDV A;  1CPQ A;  3QVZ A;  2CCY A;  2YL7 A;  4D4X A;  4N4W A;  4U9D A;  1A7V A;  4CIP A;  4NC3 A;  2XM4 A;  4CDY A;  3HNJ A;  3HNI A;  2YL0 A;  3VRC A;  4D4N A;  2J9B A;  1CGN A;  1NBB A;  1RCP A;  2XM0 A;  5JVE A;  3DE8 A;  1MQV A;  2YLI A;  3DE9 A;  1GQA A;  2XLE A;  2YLG A;  5JP7 A;  3QW0 A;  5JRA A;  3QW1 A;  5B3I A;  1EKY A;  4JKV A;  3IQ5 A;  4EIY A;  1LM3 B;  4IAQ A;  3U8P A;  5JS5 A;  1QPU A;  4JEB A;  1M6T A;  1E85 A;  1YZA A;  3TOM A;  3IQ6 A;  3L1M A;  3M79 A;  4CDA A;  2XLV A;  2XLM A;  1E84 A;  5AGF A;  1E86 A;  2XLW A;  3M4C A;  1S05 A;  4JE9 A;  5JLI A;  3QVY A;  3ZTM A;  4CJG A;  3C63 A;  2BC5 A;  4CX9 A;  4N6H A;  3HNL A;  3NMI A;  3ZQY A;  1CPR A;  3HNK A;  1APC A;  2XL6 A;  1JAF A;  3C62 A;  1YYJ A;  3FOP A;  3M4B A;  5JUA A;  2YKZ A;  3ZWI A;  1YZC A;  2XLO A;  3TOL A;  3FOO A;  2YLD A;  2XLH A;  4ER9 A;  4JEA A;  1BBH A;  4CJO A;  2J8W A;  4IAR A;  3ZTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...