1E83A

Cytochrome c' from alcaligenes xylosoxidans - oxidized structure
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Unprecedented Proximal Binding of Nitric Oxide to Heme: Implications for Guanylate Cyclase
pubmed doi rcsb
molecule tags Electron transport
total genus 48
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2000-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1e83A00
5JSLA 3IQ5A 5JS5A 1LM3B 3QVYA 2XLWA 2YL7A 3NMIA 3QW1A 2XM4A 1YZAA 5JLIA 1E86A 3L1MA 4CJOA 2XL8A 2XLOA 1MQVA 5JRAA 4U9DA 3C63A 3IQ6A 5JUAA 4D4XA 4CDAA 1CGNA 2XLHA 1GQAA 3M15A 3HNLA 3VRCA 2XLVA 5JT4A 2XL6A 1BBHA 4D4NA 3FOOA 1E84A 4JEAA 4N4WA 5AGFA 3NMKA 1NBBA 1E83A 3ZTZA 3C62A 2YKZA 4WGZA 4NC3A 1CPRA 5B3IA 1RCPA 4IB4A 1APCA 3FOPA 2YL1A 4EIYA 2YL3A 3M4CA 3M4BA 5JVEA 2XM0A 4L6RA 2QLAA 4JKVA 3TOMA 3ZTMA 2XLDA 1JAFA 4JEBA 3QVZA 3HNJA 1S05A 3DE9A 4CDVA 3NMJA 1QQ3A 2CCYA 4CJGA 3U8PA 4WGYA 2XLMA 1CGOA 2BC5A 3ZQVA 1E85A 1CPQA 2YL0A 1EKYA 3M79A 3ZWIA 4U9EA 256BA 3HNIA 5JP7A 1QPUA 1M6TA 2J9BA 4ULVA 2XLEA 3ZQYA 4ER9A 1A7VA 4IAQA 2YLGA 3TOLA 4CX9A 4CDYA 3HNKA 2J8WA 4IARA 1YYXA 2YLIA 4CIPA 1YZCA 3QW0A 4JE9A 3DE8A 1YYJA 2YLDA 4N6HA
chains in the Genus database with same CATH superfamily
1HW2A 2ZXOA 1UFBA 2HV7A 3C8ZA 2QNLA 2R7UA 2XLWA 2YL7A 2HUJA 2P61A 1H7IA 1JPJA 2R9RB 5KYXA 3FMSA 3V7OA 4ZLCA 3U0CA 4RBNA 2YHSA 1VYKA 1Q0GA 4PFPA 5L3VA 3HJCA 2R7SA 1M57C 3TULA 1OKKD 1SMYF 1ST6A 4K7BA 4W8PA 3GM1A 2ZXRA 3C63A 1OW7A 2W9YA 3IQ6A 2OCCC 3LLKA 3X2QC 4O6NA 2D4UA 1KTMA 1MMAA 3CQZA 1Q0MA 5T1DB 1OXKA 4JZAA 1MMGA 1GQAA 3AOUA 1OQCA 4JTDB 4U5FE 2H7BA 3AG2C 1R4TA 2PX0A 3EHNA 3EZIA 2XLVA 2XL6A 3ABLC 2YRFA 2UUIA 2WZLA 4U5DE 3T6BA 5A6BD 2AWYA 4JC7A 2QUPA 4JEAA 1Y6DA 2OJQA 1GS9A 4JTAB 4N4WA 4OD4A 4BEMJ 1OW6A 1ZHWA 3QZCA 2P6VA 3I5PA 4DJ9A 4I1OB 5KYXB 4DOZA 2HJ3A 3RKOF 3DAGA 2WZFA 1ZHYA 2R03A 4IWBA 4OIOF 5AC4A 1VLSA 1UG7A 2J45A 5HV9A 1HMOA 3C62A 2YKZA 5F5FA 3LESA 4U5GA 1Z63A 2HJMA 2LFFA 2KW3C 3QMKA 1JOGA 1LS1A 1FMWA 1R5ID 1WASA 3W2VA 4IB4A 4JURI 4O7GA 1JRAA 3DAFA 1H9GA 1Z6AA 1MNEA 3CAXA 4EIYA 2YL3A 5COFA 4OIQF 2EPOA 3EH2A 1C02A 2FFHA 2EIJC 3ECSA 3WHNA 5DS5A 3PHF2 1RKEA 1V55C 2IBFA 2OJED 1FNTc 3W8IA 2JPUA 4MW3A 2A1DD 2V26A 4YT2A 1A41A 1Z7Qc 1LI7A 3GEHA 3U9JA 2I15A 2KC3A 4LACB 4G7ZF 4P9TA 4JEBA 3I4UA 3HNJA 1S05A 1WGWA 5K0IA 4AX2A 1MMNA 2HSBA 4GYTA 4QI2A 5A6BA 3NMJA 2Q00A 1D0XA 4CS8C 2CCYA 2J7PA 3AG4C 4I44A 3OEOA 3IPMO 3U8PA 3UR3C 4YT4A 2VCBA 4WGYA 2R7XA 1JMWA 2KK1A 5EHHA 2XLMA 1CGOA 1NG1A 2OU6A 1L7CA 2Y3BA 1ORJA 4ZLDA 3C8GD 4H54A 3FXHA 3DJUB 5TJ5E 1HE9A 256BA 4PJJA 2R7WA 2DYSC 3KYJA 1TWAA 1B68A 1O5HA 1ZU4A 1MMDA 1ORSC 2ASRA 4CSAA 1V74B 2OEVA 2CYDA 3B9QA 1I4YA 3EGDB 3DWWA 2Y3GA 3HTKC 3JSZA 2EINC 2L81A 3ZQYA 4ER9A 3B71A 4XWJA 1A7EA 5DLJA 1A7VA 3DKAA 2PBEA 3LEVA 1VMAA 3HNKA 2YWAA 3RYLA 1CGME 1FFHA 1K04A 2M64A 4U5HA 4Z9IA 2EPLX 1IW7F 2XXAA 4NTBA 1BR2A 1SYQA 1FFTC 4G7OF 1T6QA 4FAPB 1ZW3A 2KGOA 2Q9CA 4HFFB 2VB6A 2HV6A 2NUPA 5EK0A 4H4KC 4C3BA 1BDJB 4MTGA 3MX3A 2YLDA 4JVSA 4YN0B 3ITFA 3O6XA 3BEHA 3RF3A 4CS9C 3MYIA 2AWCA 3AG3C 1IZMA 3DD7A 3EGXB 2J0WA 1LKXA 2H7OA 3FAPB 3IQ5A 5JS5A 3QVYA 2TMVP 4F4BA 5HSWA 2AVKA 1QKRA 4B6IA 1T6IA 4XPWA 3NMIA 1RMVA 4MVZA 1LE2A 1M56C 2R25A 4HFKB 3U2MA 5JLIA 1Z5ZA 3N2ZB 5BQGA 1ZHTA 1E86A 2KYHA 4Q4ZF 2DB4A 2XLOA 1LIHA 2QY9A 3OWTA 5JUAA 4MVSA 2XXAB 1WTYA 2CNWD 4W8KA 1H6GA 2JX0A 5L0DA 2J9WA 1RJ9A 4NTFA 2NUPB 3M15A 4KNVA 3SZRA 1A0BA 3HNLA 3DJNB 2KSFA 1G4WR 4IJJA 1JR8A 1K05A 1V54C 5JT4A 1LPEA 4P9FA 4QDLA 3SP1A 3W2WA 4PR9A 1OR3A 4HEAJ 2R7RA 3AGTA 3SNHA 3EG9A 1D0YA 4JJFA 1NBBA 3TD7A 2OG2A 3NRHA 4PJLA 2Z15A 3H65A 2E87A 2R05A 1NU9C 4P6IC 4U5BE 5F28E 3RH3A 3ZC4A 4DBQA 3DXJF 2RD9A 2R7VA 1S7ZA 3POVA 1I4ZA 5E2QA 2D5RB 4CIHA 1OR2A 4ONSA 1J8YF 3H2VA 3J06A 4BJ5C 1XZPA 2YZSA 4NC3A 4EHPA 3S9OA 2MWQA 1RCPA 1T5OA 1APCA 3LLIA 1YA9A 2QTVA 2H7VC 4O6MA 3GEEA 3M4CA 1RKCA 3TK0A 1G5ZA 5JVEA 4XLPF 3K1IA 1LI5A 4RD9A 3SYNA 1VK5A 4BJ1A 1NFNA 2HKVA 2XM0A 3T6GB 3K6BA 5KYWA 1OCZC 2LP4A 1QLEC 1JPNA 4K1OA 2CNWA 1C03A 3TOMA 2EPKX 2XL4A 1WN0A 3EG9B 5KYUA 2XLDA 2EILC 3W4YA 4LDRA 4GEHA 5CI9A 2ZPAA 5GPGB 1M2OA 1Q0KA 1O87A 2W45A 4J7TA 5DS4A 2HMZA 4JW1A 3K1HA 4CJGA 2OQMA 3Q6MA 1OCCC 2EPMX 3ABKC 1T6UA 3L8JA 4KC9A 3U5SA 1ZYRF 3UMHA 2AU5A 1AVOB 4YJWA 3X1OA 2LSEA 2ICWG 3AG1C 2IXOA 1Z3IX 2KQ9A 3PDMP 1EKYA 2HZ8A 3M79A 4DBRA 1YA7O 3UMKA 4LDKA 2XS1A 2VH3A 2Y3DA 4KNWA 4DVYP 1OKKA 4YT8A 5JP7A 1U89A 4XEFA 4BEJA 3LJBA 5DQTA 1QPUA 2G3KA 3IEEA 5KYWB 4G0HA 4C3EA 3K66A 3DI5A 2XLEA 2XRHA 2I8BA 3GWNA 1K40A 3AGUA 1HY5A 3JSEO 4MVUA 1GGQA 2FAPB 2GWWA 3AJMA 4YWQA 4U5CE 2YVKA 3G4ZA 2LCHA 1VLTA 3C18A 4XEVA 3SXZA 4FESA 4MVRA 1WATA 1NFOA 4XLNF 4G7HF 4OINF 4CIPA 4WJ0A 3QW0A 5L0GA 3C7JA 3OA1A 4BG0A 1VYIA 2H8AA 2NSGA 2IM8A 2F22A 4JE9A 1TFOB 4Q7CA 3T6JA 1U0BB 1ZW2A 2WB7A 2W4MA 4LERA 3EPVA 1W2WA 4LLCA 5L0HA 4ULWA 3S84A 2L6HA 3W8HA 4MVQA 4AE4A 5JSLA 4WABA 3SEOA 2KNHA 1ZZPA 3SXYA 3N0TA 2HFIA 4GQHA 3G50A 1RKEB 3GM2A 1BZ4A 3QW1A 4XPYA 3SXKA 5D91A 3LS1A 4MNDA 1U6HA 1YZAA 4PK4A 3EHMA 3GODA 2V3CC 3ASOC 3RVZA 3O55A 2X51A 1EI7A 2WL8A 3K7DA 1BR1A 1RXQA 5B1BC 3WG7C 2XL8A 4CJOA 3TJ6A 1MQVA 3JT1A 1G4US 4KBLA 3VAYA 4U9DA 5JRAA 2L7AA 1HW1A 2WVQA 4D4XA 4NY3A 2A0UA 4CDAA 1CGNA 4CS7A 3FVYA 3S29A 4A2NB 1QVXA 3E9VA 2XLHA 3JZ0A 3KL4A 2VCAA 4NTAA 2C03A 3I5QA 2WZGA 4HE8D 4Q5SF 3B29A 3O10A 2CGEA 2XSEA 2C04A 3FHDA 3K1IC 3R7CA 1NZEA 4PJNA 1YVIA 4CBEA 4FX5A 2MHRA 1AUEA 2A6HF 3RFYA 4XPXA 2VC9A 1LE4A 2P1AA 2PFDA 4MTOA 1V4AA 5AGFA 2J9UA 4R32A 1WOLA 5L3QA 3PCVA 2NG1A 4MW8A 3C8GA 1XZQA 3CEXA 4MVMA 1ZHZA 3VM6A 1E83A 3JCUQ 4X0RA 1I5NA 2R02A 3LNMB 4PJMA 3ZTZA 4EKWA 5BQIA 4WGZA 3EH1A 2Q4FA 2LIGA 3Q7LA 4A4AA 2VCCA 3PMRA 4YL3A 1NLXA 2NPUA 3RIPA 2ZD9A 3EZHA 3NKEA 3RQGA 3U2LA 1PCXA 3ZVRA 3RQEA 2IXMA 1EA8A 1TFKB 3FOPA 3ATPA 3WAQA 5L0FA 4RDAA 3NYJA 3U9MA 1VOMA 1YJGA 3M4BA 4J30B 4BJ6A 1SZIA 2M4EA 4MS2A 3FAJA 4MQ9F 2QLAA 5A6JA 2EIMC 2GFHA 1BR4A 4JKVA 2GDCA 5F5HA 1DOVA 3NG1A 4EBKA 4NQFA 1AEPA 3ZTMA 5AC5A 3S0XA 1JAFA 1PV3A 3K33A 1PD1A 4YL1A 2IYLD 3KKBA 4CS8A 3C8GB 3UNGC 4CDVA 2IXPA 1YAUO 4Z9JA 3IHUA 4MVOA 1QQ3A 1FMVA 3MLGA 5BUOA 3F46A 4J7YA 3TJ5A 2L9JA 2J0XA 2OEXA 3KH2A 4E7ZA 1FR0A 5B1AC 3DM5A 1DOWA 1LVKA 2DYRC 2BC5A 3ZG1A 3ZQVA 2J9VA 1Q0DA 2YL0A 1YLMA 2BL2A 5EGYA 3L0IA 3ZWIA 2A68F 2HSQA 1NU7D 2G3VA 3Q6NA 4N06A 3HNIA 1RJ9B 2G62A 1XWJA 5KYNA 5E3AA 4CSAC 1E2XA 2AP3A 1M6TA 3CZ6A 4ULVA 5B3SC 1ORYA 4EBBA 2NUTA 2DGJA 2OOCA 3AQBA 4YL0A 4LLEA 3U8VA 3EQLF 1D0ZA 2ZXPA 1YYXA 1TKNA 3GEIA 4E0HA 2O9XA 1YZCA 4YT5A 3GORA 4XEKA 1YDIA 3NDBB 1GM5A 4AL0A 3FDQA 3EJNA 1T9KA 4XQ1A 4U5EE 1YYJA 4CS9A 1N1CA 3ZSUA 2LD6A 1OW8A 1LS4A 3T4RA 3JRMO 3S28A 3US6A 4OIPF 5E3CA 2GAQA 2J7PD 1ZU5A 2CDQA 3JYYA 1LM3B 3NYLA 3IQTA 1OCOC 3QTHA 1KNYA 2XM4A 1SF8A 5CI8A 3WODF 2GA0A 3GANA 3S90A 4EBJA 2Y69C 2NUTB 3O39A 4JJGA 5FZTA 3TQOA 5KYUB 4UDVA 4DRHB 2A6EF 3LEOA 5A69A 4K0DA 3L1MA 2LFDA 4FWVA 3IQCA 3E70C 1TWHA 2NSFA 1TWCA 1L3PA 4AL1A 4N6CA 3A9CA 3GM3A 1VB5A 3S27A 1TQGA 1M2VA 4IGGA 2FGYA 3Q7GA 3KPHA 3VF0A 2DI3A 2EIKC 1FTSA 2RSEB 3KMIA 3U3FA 3V5XA 3VRCA 2ETSA 2R7QA 3B0UX 2PNOA 3DMDA 3EGDA 4IAOA 4BJ6C 2IXNA 1Y4CA 1BBHA 1C17M 4D4NA 3FOOA 2B0JA 1E84A 2HS5A 4E18A 2KJGA 3JYHA 3EFOA 4JRZA 4C7OA 3NMKA 4ANJA 1O3UA 4XTKA 3LNRA 2Y3HA 3CSKA 1ZHXA 1D1AA 3KYIA 2W4BA 2PP4A 2X0CA 5A6KA 3AQCA 1YARO 3V5ZA 3LS0A 4BPMA 3M1CB 3MYFA 2YQYA 3N24A 4I3MA 4BJ5A 3L34A 2VASA 4DRIB 5L0CA 4NCQA 1EQ1A 1KU2A 3MBGA 3DZAA 3V5YA 1CPRA 4OIRF 4AK9A 4IRUA 3RW0A 4DRJB 4Z9HA 3B0PA 3BRJA 2ZXWC 4M63A 5B3IA 3JTLO 3EGXA 1M2VB 2PX3A 2JD3A 2QE9A 2YL1A 3RQFA 1FAPB 5DS6A 4DVZA 1OXBA 3GWLA 5CIVA 2J46A 2P7VA 2BE5F 2P0NA 2WVOA 4JCHA 2YEVA 3HLZA 4YK5A 5IY5C 1Q0FA 4L6RA 2Q7RA 2WVNA 4E0IA 2R7OA 1D1BA 3NYMA 4AE4B 1QSPA 1TWGA 3LUTB 3SXMA 1J8MF 2IOQA 2OKUA 2HMQA 1NSGB 4JCZA 3ABMC 5COMA 5KYYA 3EFOB 3QVZA 4MTFA 4C7OB 3DE9A 4C3DA 5A6AA 3U3BA 3R2PA 1HE1A 3VYWA 2XS8A 4PFOA 4G78A 1QZXA 4EUKB 1G8XA 3A11A 3ASNC 5T3WA 1A7DA 2PF4E 1OCRC 2L6FA 3G4XA 4JTCB 1E85A 5L0JA 1CPQA 3RVYA 5FCLA 1SR2A 1Z23A 2EPNA 2B0HA 3UGPA 5DQZA 4PACA 5D92A 2L6GA 3JRTA 4I1MA 2Q9BA 4U9EA 5COGA 2R7TA 1D1CA 4LDQA 3UGOA 3NKDA 1PD0A 3H2UA 4O6YA 5E33A 2J9BA 2A0BA 4JIOA 5T3TA 2LK4A 1HMDA 4QI0A 1WWPA 1VTMP 3MFNA 4IAQA 2YLGA 3TOLA 1T01A 2CW0F 4CDYA 3HKKA 4CX9A 5KYYB 2J8WA 4DXWA 3ZIBA 2LQGA 4KI2A 3LAYA 5L0IA 4IARA 1ZVZA 4E7SA 4EWCA 3B0VC 2YLIA 3T9OA 2Q9AA 1H9TA 4O79A 1F1MA 3L8IA 2UUHA 5DVWA 3ZDLA 2A69F 3F47A 2MYSA 4E17A 3DE8A 5BQHA 3DM9B 3UMIA 4J32B 4OD5A 1MNDA 1TR2A 4N6HA 2Y39A 2Q3TA 4BJTA
chains in the Genus database with same CATH topology
5JSLA 3IQ5A 5JS5A 1LM3B 3QVYA 2XLWA 2YL7A 3NMIA 3QW1A 2XM4A 1YZAA 5JLIA 1E86A 3L1MA 4CJOA 2XL8A 2XLOA 1MQVA 5JRAA 4U9DA 3C63A 3IQ6A 5JUAA 4D4XA 4CDAA 1CGNA 2XLHA 1GQAA 3M15A 3HNLA 3VRCA 2XLVA 5JT4A 2XL6A 1BBHA 4D4NA 3FOOA 1E84A 4JEAA 4N4WA 5AGFA 3NMKA 1NBBA 1E83A 3ZTZA 3C62A 2YKZA 4WGZA 4NC3A 1CPRA 5B3IA 1RCPA 4IB4A 1APCA 3FOPA 2YL1A 4EIYA 2YL3A 3M4CA 3M4BA 5JVEA 2XM0A 4L6RA 2QLAA 4JKVA 3TOMA 3ZTMA 2XLDA 1JAFA 4JEBA 3QVZA 3HNJA 1S05A 3DE9A 4CDVA 3NMJA 1QQ3A 2CCYA 4CJGA 3U8PA 4WGYA 2XLMA 1CGOA 2BC5A 3ZQVA 1E85A 1CPQA 2YL0A 1EKYA 3M79A 3ZWIA 4U9EA 256BA 3HNIA 5JP7A 1QPUA 1M6TA 2J9BA 4ULVA 2XLEA 3ZQYA 4ER9A 1A7VA 4IAQA 2YLGA 3TOLA 4CX9A 4CDYA 3HNKA 2J8WA 4IARA 1YYXA 2YLIA 4CIPA 1YZCA 3QW0A 4JE9A 3DE8A 1YYJA 2YLDA 4N6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JSL A;  3IQ5 A;  5JS5 A;  1LM3 B;  3QVY A;  2XLW A;  2YL7 A;  3NMI A;  3QW1 A;  2XM4 A;  1YZA A;  5JLI A;  1E86 A;  3L1M A;  4CJO A;  2XL8 A;  2XLO A;  1MQV A;  5JRA A;  4U9D A;  3C63 A;  3IQ6 A;  5JUA A;  4D4X A;  4CDA A;  1CGN A;  2XLH A;  1GQA A;  3M15 A;  3HNL A;  3VRC A;  2XLV A;  5JT4 A;  2XL6 A;  1BBH A;  4D4N A;  3FOO A;  1E84 A;  4JEA A;  4N4W A;  5AGF A;  3NMK A;  1NBB A;  1E83 A;  3ZTZ A;  3C62 A;  2YKZ A;  4WGZ A;  4NC3 A;  1CPR A;  5B3I A;  1RCP A;  4IB4 A;  1APC A;  3FOP A;  2YL1 A;  4EIY A;  2YL3 A;  3M4C A;  3M4B A;  5JVE A;  2XM0 A;  4L6R A;  2QLA A;  4JKV A;  3TOM A;  3ZTM A;  2XLD A;  1JAF A;  4JEB A;  3QVZ A;  3HNJ A;  1S05 A;  3DE9 A;  4CDV A;  3NMJ A;  1QQ3 A;  2CCY A;  4CJG A;  3U8P A;  4WGY A;  2XLM A;  1CGO A;  2BC5 A;  3ZQV A;  1E85 A;  1CPQ A;  2YL0 A;  1EKY A;  3M79 A;  3ZWI A;  4U9E A;  256B A;  3HNI A;  5JP7 A;  1QPU A;  1M6T A;  2J9B A;  4ULV A;  2XLE A;  3ZQY A;  4ER9 A;  1A7V A;  4IAQ A;  2YLG A;  3TOL A;  4CX9 A;  4CDY A;  3HNK A;  2J8W A;  4IAR A;  1YYX A;  2YLI A;  4CIP A;  1YZC A;  3QW0 A;  4JE9 A;  3DE8 A;  1YYJ A;  2YLD A;  4N6H A; 
#chains in the Genus database with same CATH topology
 1HW2 A;  2ZXO A;  1UFB A;  2HV7 A;  3C8Z A;  2QNL A;  2R7U A;  2XLW A;  2YL7 A;  2HUJ A;  2P61 A;  1H7I A;  1JPJ A;  2R9R B;  5KYX A;  3FMS A;  3V7O A;  4ZLC A;  3U0C A;  4RBN A;  2YHS A;  1VYK A;  1Q0G A;  4PFP A;  5L3V A;  3HJC A;  2R7S A;  1M57 C;  3TUL A;  1OKK D;  1SMY F;  1ST6 A;  4K7B A;  4W8P A;  3GM1 A;  2ZXR A;  3C63 A;  1OW7 A;  2W9Y A;  3IQ6 A;  2OCC C;  3LLK A;  3X2Q C;  4O6N A;  2D4U A;  1KTM A;  1MMA A;  3CQZ A;  1Q0M A;  5T1D B;  1OXK A;  4JZA A;  1MMG A;  1GQA A;  3AOU A;  1OQC A;  4JTD B;  4U5F E;  2H7B A;  3AG2 C;  1R4T A;  2PX0 A;  3EHN A;  3EZI A;  2XLV A;  2XL6 A;  3ABL C;  2YRF A;  2UUI A;  2WZL A;  4U5D E;  3T6B A;  5A6B D;  2AWY A;  4JC7 A;  2QUP A;  4JEA A;  1Y6D A;  2OJQ A;  1GS9 A;  4JTA B;  4N4W A;  4OD4 A;  4BEM J;  1OW6 A;  1ZHW A;  3QZC A;  2P6V A;  3I5P A;  4DJ9 A;  4I1O B;  5KYX B;  4DOZ A;  2HJ3 A;  3RKO F;  3DAG A;  2WZF A;  1ZHY A;  2R03 A;  4IWB A;  4OIO F;  5AC4 A;  1VLS A;  1UG7 A;  2J45 A;  5HV9 A;  1HMO A;  3C62 A;  2YKZ A;  5F5F A;  3LES A;  4U5G A;  1Z63 A;  2HJM A;  2LFF A;  2KW3 C;  3QMK A;  1JOG A;  1LS1 A;  1FMW A;  1R5I D;  1WAS A;  3W2V A;  4IB4 A;  4JUR I;  4O7G A;  1JRA A;  3DAF A;  1H9G A;  1Z6A A;  1MNE A;  3CAX A;  4EIY A;  2YL3 A;  5COF A;  4OIQ F;  2EPO A;  3EH2 A;  1C02 A;  2FFH A;  2EIJ C;  3ECS A;  3WHN A;  5DS5 A;  3PHF 2;  1RKE A;  1V55 C;  2IBF A;  2OJE D;  1FNT c;  3W8I A;  2JPU A;  4MW3 A;  2A1D D;  2V26 A;  4YT2 A;  1A41 A;  1Z7Q c;  1LI7 A;  3GEH A;  3U9J A;  2I15 A;  2KC3 A;  4LAC B;  4G7Z F;  4P9T A;  4JEB A;  3I4U A;  3HNJ A;  1S05 A;  1WGW A;  5K0I A;  4AX2 A;  1MMN A;  2HSB A;  4GYT A;  4QI2 A;  5A6B A;  3NMJ A;  2Q00 A;  1D0X A;  4CS8 C;  2CCY A;  2J7P A;  3AG4 C;  4I44 A;  3OEO A;  3IPM O;  3U8P A;  3UR3 C;  4YT4 A;  2VCB A;  4WGY A;  2R7X A;  1JMW A;  2KK1 A;  5EHH A;  2XLM A;  1CGO A;  1NG1 A;  2OU6 A;  1L7C A;  2Y3B A;  1ORJ A;  4ZLD A;  3C8G D;  4H54 A;  3FXH A;  3DJU B;  5TJ5 E;  1HE9 A;  256B A;  4PJJ A;  2R7W A;  2DYS C;  3KYJ A;  1TWA A;  1B68 A;  1O5H A;  1ZU4 A;  1MMD A;  1ORS C;  2ASR A;  4CSA A;  1V74 B;  2OEV A;  2CYD A;  3B9Q A;  1I4Y A;  3EGD B;  3DWW A;  2Y3G A;  3HTK C;  3JSZ A;  2EIN C;  2L81 A;  3ZQY A;  4ER9 A;  3B71 A;  4XWJ A;  1A7E A;  5DLJ A;  1A7V A;  3DKA A;  2PBE A;  3LEV A;  1VMA A;  3HNK A;  2YWA A;  3RYL A;  1CGM E;  1FFH A;  1K04 A;  2M64 A;  4U5H A;  4Z9I A;  2EPL X;  1IW7 F;  2XXA A;  4NTB A;  1BR2 A;  1SYQ A;  1FFT C;  4G7O F;  1T6Q A;  4FAP B;  1ZW3 A;  2KGO A;  2Q9C A;  4HFF B;  2VB6 A;  2HV6 A;  2NUP A;  5EK0 A;  4H4K C;  4C3B A;  1BDJ B;  4MTG A;  3MX3 A;  2YLD A;  4JVS A;  4YN0 B;  3ITF A;  3O6X A;  3BEH A;  3RF3 A;  4CS9 C;  3MYI A;  2AWC A;  3AG3 C;  1IZM A;  3DD7 A;  3EGX B;  2J0W A;  1LKX A;  2H7O A;  3FAP B;  3IQ5 A;  5JS5 A;  3QVY A;  2TMV P;  4F4B A;  5HSW A;  2AVK A;  1QKR A;  4B6I A;  1T6I A;  4XPW A;  3NMI A;  1RMV A;  4MVZ A;  1LE2 A;  1M56 C;  2R25 A;  4HFK B;  3U2M A;  5JLI A;  1Z5Z A;  3N2Z B;  5BQG A;  1ZHT A;  1E86 A;  2KYH A;  4Q4Z F;  2DB4 A;  2XLO A;  1LIH A;  2QY9 A;  3OWT A;  5JUA A;  4MVS A;  2XXA B;  1WTY A;  2CNW D;  4W8K A;  1H6G A;  2JX0 A;  5L0D A;  2J9W A;  1RJ9 A;  4NTF A;  2NUP B;  3M15 A;  4KNV A;  3SZR A;  1A0B A;  3HNL A;  3DJN B;  2KSF A;  1G4W R;  4IJJ A;  1JR8 A;  1K05 A;  1V54 C;  5JT4 A;  1LPE A;  4P9F A;  4QDL A;  3SP1 A;  3W2W A;  4PR9 A;  1OR3 A;  4HEA J;  2R7R A;  3AGT A;  3SNH A;  3EG9 A;  1D0Y A;  4JJF A;  1NBB A;  3TD7 A;  2OG2 A;  3NRH A;  4PJL A;  2Z15 A;  3H65 A;  2E87 A;  2R05 A;  1NU9 C;  4P6I C;  4U5B E;  5F28 E;  3RH3 A;  3ZC4 A;  4DBQ A;  3DXJ F;  2RD9 A;  2R7V A;  1S7Z A;  3POV A;  1I4Z A;  5E2Q A;  2D5R B;  4CIH A;  1OR2 A;  4ONS A;  1J8Y F;  3H2V A;  3J06 A;  4BJ5 C;  1XZP A;  2YZS A;  4NC3 A;  4EHP A;  3S9O A;  2MWQ A;  1RCP A;  1T5O A;  1APC A;  3LLI A;  1YA9 A;  2QTV A;  2H7V C;  4O6M A;  3GEE A;  3M4C A;  1RKC A;  3TK0 A;  1G5Z A;  5JVE A;  4XLP F;  3K1I A;  1LI5 A;  4RD9 A;  3SYN A;  1VK5 A;  4BJ1 A;  1NFN A;  2HKV A;  2XM0 A;  3T6G B;  3K6B A;  5KYW A;  1OCZ C;  2LP4 A;  1QLE C;  1JPN A;  4K1O A;  2CNW A;  1C03 A;  3TOM A;  2EPK X;  2XL4 A;  1WN0 A;  3EG9 B;  5KYU A;  2XLD A;  2EIL C;  3W4Y A;  4LDR A;  4GEH A;  5CI9 A;  2ZPA A;  5GPG B;  1M2O A;  1Q0K A;  1O87 A;  2W45 A;  4J7T A;  5DS4 A;  2HMZ A;  4JW1 A;  3K1H A;  4CJG A;  2OQM A;  3Q6M A;  1OCC C;  2EPM X;  3ABK C;  1T6U A;  3L8J A;  4KC9 A;  3U5S A;  1ZYR F;  3UMH A;  2AU5 A;  1AVO B;  4YJW A;  3X1O A;  2LSE A;  2ICW G;  3AG1 C;  2IXO A;  1Z3I X;  2KQ9 A;  3PDM P;  1EKY A;  2HZ8 A;  3M79 A;  4DBR A;  1YA7 O;  3UMK A;  4LDK A;  2XS1 A;  2VH3 A;  2Y3D A;  4KNW A;  4DVY P;  1OKK A;  4YT8 A;  5JP7 A;  1U89 A;  4XEF A;  4BEJ A;  3LJB A;  5DQT A;  1QPU A;  2G3K A;  3IEE A;  5KYW B;  4G0H A;  4C3E A;  3K66 A;  3DI5 A;  2XLE A;  2XRH A;  2I8B A;  3GWN A;  1K40 A;  3AGU A;  1HY5 A;  3JSE O;  4MVU A;  1GGQ A;  2FAP B;  2GWW A;  3AJM A;  4YWQ A;  4U5C E;  2YVK A;  3G4Z A;  2LCH A;  1VLT A;  3C18 A;  4XEV A;  3SXZ A;  4FES A;  4MVR A;  1WAT A;  1NFO A;  4XLN F;  4G7H F;  4OIN F;  4CIP A;  4WJ0 A;  3QW0 A;  5L0G A;  3C7J A;  3OA1 A;  4BG0 A;  1VYI A;  2H8A A;  2NSG A;  2IM8 A;  2F22 A;  4JE9 A;  1TFO B;  4Q7C A;  3T6J A;  1U0B B;  1ZW2 A;  2WB7 A;  2W4M A;  4LER A;  3EPV A;  1W2W A;  4LLC A;  5L0H A;  4ULW A;  3S84 A;  2L6H A;  3W8H A;  4MVQ A;  4AE4 A;  5JSL A;  4WAB A;  3SEO A;  2KNH A;  1ZZP A;  3SXY A;  3N0T A;  2HFI A;  4GQH A;  3G50 A;  1RKE B;  3GM2 A;  1BZ4 A;  3QW1 A;  4XPY A;  3SXK A;  5D91 A;  3LS1 A;  4MND A;  1U6H A;  1YZA A;  4PK4 A;  3EHM A;  3GOD A;  2V3C C;  3ASO C;  3RVZ A;  3O55 A;  2X51 A;  1EI7 A;  2WL8 A;  3K7D A;  1BR1 A;  1RXQ A;  5B1B C;  3WG7 C;  2XL8 A;  4CJO A;  3TJ6 A;  1MQV A;  3JT1 A;  1G4U S;  4KBL A;  3VAY A;  4U9D A;  5JRA A;  2L7A A;  1HW1 A;  2WVQ A;  4D4X A;  4NY3 A;  2A0U A;  4CDA A;  1CGN A;  4CS7 A;  3FVY A;  3S29 A;  4A2N B;  1QVX A;  3E9V A;  2XLH A;  3JZ0 A;  3KL4 A;  2VCA A;  4NTA A;  2C03 A;  3I5Q A;  2WZG A;  4HE8 D;  4Q5S F;  3B29 A;  3O10 A;  2CGE A;  2XSE A;  2C04 A;  3FHD A;  3K1I C;  3R7C A;  1NZE A;  4PJN A;  1YVI A;  4CBE A;  4FX5 A;  2MHR A;  1AUE A;  2A6H F;  3RFY A;  4XPX A;  2VC9 A;  1LE4 A;  2P1A A;  2PFD A;  4MTO A;  1V4A A;  5AGF A;  2J9U A;  4R32 A;  1WOL A;  5L3Q A;  3PCV A;  2NG1 A;  4MW8 A;  3C8G A;  1XZQ A;  3CEX A;  4MVM A;  1ZHZ A;  3VM6 A;  1E83 A;  3JCU Q;  4X0R A;  1I5N A;  2R02 A;  3LNM B;  4PJM A;  3ZTZ A;  4EKW A;  5BQI A;  4WGZ A;  3EH1 A;  2Q4F A;  2LIG A;  3Q7L A;  4A4A A;  2VCC A;  3PMR A;  4YL3 A;  1NLX A;  2NPU A;  3RIP A;  2ZD9 A;  3EZH A;  3NKE A;  3RQG A;  3U2L A;  1PCX A;  3ZVR A;  3RQE A;  2IXM A;  1EA8 A;  1TFK B;  3FOP A;  3ATP A;  3WAQ A;  5L0F A;  4RDA A;  3NYJ A;  3U9M A;  1VOM A;  1YJG A;  3M4B A;  4J30 B;  4BJ6 A;  1SZI A;  2M4E A;  4MS2 A;  3FAJ A;  4MQ9 F;  2QLA A;  5A6J A;  2EIM C;  2GFH A;  1BR4 A;  4JKV A;  2GDC A;  5F5H A;  1DOV A;  3NG1 A;  4EBK A;  4NQF A;  1AEP A;  3ZTM A;  5AC5 A;  3S0X A;  1JAF A;  1PV3 A;  3K33 A;  1PD1 A;  4YL1 A;  2IYL D;  3KKB A;  4CS8 A;  3C8G B;  3UNG C;  4CDV A;  2IXP A;  1YAU O;  4Z9J A;  3IHU A;  4MVO A;  1QQ3 A;  1FMV A;  3MLG A;  5BUO A;  3F46 A;  4J7Y A;  3TJ5 A;  2L9J A;  2J0X A;  2OEX A;  3KH2 A;  4E7Z A;  1FR0 A;  5B1A C;  3DM5 A;  1DOW A;  1LVK A;  2DYR C;  2BC5 A;  3ZG1 A;  3ZQV A;  2J9V A;  1Q0D A;  2YL0 A;  1YLM A;  2BL2 A;  5EGY A;  3L0I A;  3ZWI A;  2A68 F;  2HSQ A;  1NU7 D;  2G3V A;  3Q6N A;  4N06 A;  3HNI A;  1RJ9 B;  2G62 A;  1XWJ A;  5KYN A;  5E3A A;  4CSA C;  1E2X A;  2AP3 A;  1M6T A;  3CZ6 A;  4ULV A;  5B3S C;  1ORY A;  4EBB A;  2NUT A;  2DGJ A;  2OOC A;  3AQB A;  4YL0 A;  4LLE A;  3U8V A;  3EQL F;  1D0Z A;  2ZXP A;  1YYX A;  1TKN A;  3GEI A;  4E0H A;  2O9X A;  1YZC A;  4YT5 A;  3GOR A;  4XEK A;  1YDI A;  3NDB B;  1GM5 A;  4AL0 A;  3FDQ A;  3EJN A;  1T9K A;  4XQ1 A;  4U5E E;  1YYJ A;  4CS9 A;  1N1C A;  3ZSU A;  2LD6 A;  1OW8 A;  1LS4 A;  3T4R A;  3JRM O;  3S28 A;  3US6 A;  4OIP F;  5E3C A;  2GAQ A;  2J7P D;  1ZU5 A;  2CDQ A;  3JYY A;  1LM3 B;  3NYL A;  3IQT A;  1OCO C;  3QTH A;  1KNY A;  2XM4 A;  1SF8 A;  5CI8 A;  3WOD F;  2GA0 A;  3GAN A;  3S90 A;  4EBJ A;  2Y69 C;  2NUT B;  3O39 A;  4JJG A;  5FZT A;  3TQO A;  5KYU B;  4UDV A;  4DRH B;  2A6E F;  3LEO A;  5A69 A;  4K0D A;  3L1M A;  2LFD A;  4FWV A;  3IQC A;  3E70 C;  1TWH A;  2NSF A;  1TWC A;  1L3P A;  4AL1 A;  4N6C A;  3A9C A;  3GM3 A;  1VB5 A;  3S27 A;  1TQG A;  1M2V A;  4IGG A;  2FGY A;  3Q7G A;  3KPH A;  3VF0 A;  2DI3 A;  2EIK C;  1FTS A;  2RSE B;  3KMI A;  3U3F A;  3V5X A;  3VRC A;  2ETS A;  2R7Q A;  3B0U X;  2PNO A;  3DMD A;  3EGD A;  4IAO A;  4BJ6 C;  2IXN A;  1Y4C A;  1BBH A;  1C17 M;  4D4N A;  3FOO A;  2B0J A;  1E84 A;  2HS5 A;  4E18 A;  2KJG A;  3JYH A;  3EFO A;  4JRZ A;  4C7O A;  3NMK A;  4ANJ A;  1O3U A;  4XTK A;  3LNR A;  2Y3H A;  3CSK A;  1ZHX A;  1D1A A;  3KYI A;  2W4B A;  2PP4 A;  2X0C A;  5A6K A;  3AQC A;  1YAR O;  3V5Z A;  3LS0 A;  4BPM A;  3M1C B;  3MYF A;  2YQY A;  3N24 A;  4I3M A;  4BJ5 A;  3L34 A;  2VAS A;  4DRI B;  5L0C A;  4NCQ A;  1EQ1 A;  1KU2 A;  3MBG A;  3DZA A;  3V5Y A;  1CPR A;  4OIR F;  4AK9 A;  4IRU A;  3RW0 A;  4DRJ B;  4Z9H A;  3B0P A;  3BRJ A;  2ZXW C;  4M63 A;  5B3I A;  3JTL O;  3EGX A;  1M2V B;  2PX3 A;  2JD3 A;  2QE9 A;  2YL1 A;  3RQF A;  1FAP B;  5DS6 A;  4DVZ A;  1OXB A;  3GWL A;  5CIV A;  2J46 A;  2P7V A;  2BE5 F;  2P0N A;  2WVO A;  4JCH A;  2YEV A;  3HLZ A;  4YK5 A;  5IY5 C;  1Q0F A;  4L6R A;  2Q7R A;  2WVN A;  4E0I A;  2R7O A;  1D1B A;  3NYM A;  4AE4 B;  1QSP A;  1TWG A;  3LUT B;  3SXM A;  1J8M F;  2IOQ A;  2OKU A;  2HMQ A;  1NSG B;  4JCZ A;  3ABM C;  5COM A;  5KYY A;  3EFO B;  3QVZ A;  4MTF A;  4C7O B;  3DE9 A;  4C3D A;  5A6A A;  3U3B A;  3R2P A;  1HE1 A;  3VYW A;  2XS8 A;  4PFO A;  4G78 A;  1QZX A;  4EUK B;  1G8X A;  3A11 A;  3ASN C;  5T3W A;  1A7D A;  2PF4 E;  1OCR C;  2L6F A;  3G4X A;  4JTC B;  1E85 A;  5L0J A;  1CPQ A;  3RVY A;  5FCL A;  1SR2 A;  1Z23 A;  2EPN A;  2B0H A;  3UGP A;  5DQZ A;  4PAC A;  5D92 A;  2L6G A;  3JRT A;  4I1M A;  2Q9B A;  4U9E A;  5COG A;  2R7T A;  1D1C A;  4LDQ A;  3UGO A;  3NKD A;  1PD0 A;  3H2U A;  4O6Y A;  5E33 A;  2J9B A;  2A0B A;  4JIO A;  5T3T A;  2LK4 A;  1HMD A;  4QI0 A;  1WWP A;  1VTM P;  3MFN A;  4IAQ A;  2YLG A;  3TOL A;  1T01 A;  2CW0 F;  4CDY A;  3HKK A;  4CX9 A;  5KYY B;  2J8W A;  4DXW A;  3ZIB A;  2LQG A;  4KI2 A;  3LAY A;  5L0I A;  4IAR A;  1ZVZ A;  4E7S A;  4EWC A;  3B0V C;  2YLI A;  3T9O A;  2Q9A A;  1H9T A;  4O79 A;  1F1M A;  3L8I A;  2UUH A;  5DVW A;  3ZDL A;  2A69 F;  3F47 A;  2MYS A;  4E17 A;  3DE8 A;  5BQH A;  3DM9 B;  3UMI A;  4J32 B;  4OD5 A;  1MND A;  1TR2 A;  4N6H A;  2Y39 A;  2Q3T A;  4BJT A; 
#chains in the Genus database with same CATH homology
 5JSL A;  3IQ5 A;  5JS5 A;  1LM3 B;  3QVY A;  2XLW A;  2YL7 A;  3NMI A;  3QW1 A;  2XM4 A;  1YZA A;  5JLI A;  1E86 A;  3L1M A;  4CJO A;  2XL8 A;  2XLO A;  1MQV A;  5JRA A;  4U9D A;  3C63 A;  3IQ6 A;  5JUA A;  4D4X A;  4CDA A;  1CGN A;  2XLH A;  1GQA A;  3M15 A;  3HNL A;  3VRC A;  2XLV A;  5JT4 A;  2XL6 A;  1BBH A;  4D4N A;  3FOO A;  1E84 A;  4JEA A;  4N4W A;  5AGF A;  3NMK A;  1NBB A;  1E83 A;  3ZTZ A;  3C62 A;  2YKZ A;  4WGZ A;  4NC3 A;  1CPR A;  5B3I A;  1RCP A;  4IB4 A;  1APC A;  3FOP A;  2YL1 A;  4EIY A;  2YL3 A;  3M4C A;  3M4B A;  5JVE A;  2XM0 A;  4L6R A;  2QLA A;  4JKV A;  3TOM A;  3ZTM A;  2XLD A;  1JAF A;  4JEB A;  3QVZ A;  3HNJ A;  1S05 A;  3DE9 A;  4CDV A;  3NMJ A;  1QQ3 A;  2CCY A;  4CJG A;  3U8P A;  4WGY A;  2XLM A;  1CGO A;  2BC5 A;  3ZQV A;  1E85 A;  1CPQ A;  2YL0 A;  1EKY A;  3M79 A;  3ZWI A;  4U9E A;  256B A;  3HNI A;  5JP7 A;  1QPU A;  1M6T A;  2J9B A;  4ULV A;  2XLE A;  3ZQY A;  4ER9 A;  1A7V A;  4IAQ A;  2YLG A;  3TOL A;  4CX9 A;  4CDY A;  3HNK A;  2J8W A;  4IAR A;  1YYX A;  2YLI A;  4CIP A;  1YZC A;  3QW0 A;  4JE9 A;  3DE8 A;  1YYJ A;  2YLD A;  4N6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...