1E83A

Cytochrome c' from alcaligenes xylosoxidans - oxidized structure
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
126
structure length
126
Chain Sequence
b'EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Unprecedented Proximal Binding of Nitric Oxide to Heme: Implications for Guanylate Cyclase
pubmed doi rcsb
molecule tags Electron transport
total genus 48
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2000-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1e83A00
3ZQYA 4CDYA 1E86A 5JVEA 3DE9A 1BBHA 5JLIA 5JUAA 3C62A 3QW0A 3C63A 3M4CA 2YL0A 4IAQA 1E84A 2YLIA 4CX9A 2YKZA 3M79A 2J8WA 2XLMA 3HNJA 2QLAA 1E85A 1A7VA 4U9DA 5JT4A 4CDVA 3ZTMA 1CGNA 5JSLA 3U8PA 1E83A 2XLVA 1QQ3A 4ER9A 2YLDA 4NC3A 1CPQA 1LM3B 3QVZA 2YL1A 1QPUA 1YZAA 3HNKA 3HNLA 1RCPA 5JP7A 1S05A 3QVYA 3IQ6A 1YZCA 3FOOA 1JAFA 4CDAA 1YYXA 2XLOA 2XLWA 2XL6A 2XM0A 4N4WA 5AGFA 2XM4A 4WGYA 1GQAA 4U9EA 256BA 3M4BA 3FOPA 4ULVA 2YLGA 4IARA 1APCA 1CPRA 4JEBA 3NMKA 3IQ5A 3NMJA 1MQVA 4CJGA 4EIYA 5B3IA 5JS5A 4IB4A 3VRCA 2BC5A 3ZTZA 3TOMA 4N6HA 4WGZA 4JKVA 4JE9A 1NBBA 3QW1A 2XLEA 3DE8A 2YL3A 3TOLA 1M6TA 3M15A 4JEAA 4D4NA 3L1MA 1EKYA 5JRAA 1CGOA 2XLDA 2XL8A 1YYJA 3ZWIA 3HNIA 2CCYA 3NMIA 2YL7A 4D4XA 4CIPA 4CJOA 3ZQVA 4L6RA 2XLHA 2J9BA
chains in the Genus database with same CATH superfamily
3TULA 2J9UA 4F4BA 4JURI 2DI3A 4AL0A 2HMZA 2J9VA 4E7SA 1NLXA 4CIHA 3T6JA 1L3PA 2IXNA 1HMOA 1Y6DA 2XSEA 1LIHA 3QW0A 4DOZA 1JPJA 4K7BA 1V54C 1LVKA 3RVYA 2VH3A 2Q9AA 4NCQA 1OQCA 2RD9A 4MVQA 4U5FE 3GORA 3U8VA 2HV6A 3S90A 4ONSA 1RXQA 3PCVA 3ABKC 2KQ9A 2LP4A 3RFYA 2WZGA 3Q6NA 4YN0B 1VYIA 4E17A 3M79A 3CQZA 2LQGA 4I44A 3EQLF 5EHHA 3C8GA 3ZC4A 3OA1A 3Q7LA 3EGDB 5CI8A 5B1BC 1E85A 5IY5C 4XLPF 4G7OF 2VASA 1QSPA 4XEKA 2A0UA 2M64A 3ABLC 1RKEA 1VYKA 4IWBA 4N6CA 4YL3A 3VF0A 1GGQA 2J7PD 3UMIA 2LCHA 2XRHA 2A6EF 2TMVP 1GM5A 3MX3A 2WL8A 5GPGB 2KK1A 1OCOC 3V5XA 3GM1A 1KTMA 1JPNA 2LK4A 1QQ3A 3W4YA 2ZXPA 2YLDA 4IRUA 4JJFA 1M56C 1KNYA 1CPQA 4CS8A 3GEHA 3S84A 2CDQA 5K0IA 3U3FA 2X0CA 2RSEB 4A4AA 2WVQA 3HNLA 2L81A 3Q7GA 4YJWA 3UNGC 2R7RA 5JP7A 3EG9A 2LFFA 3QVYA 1YZCA 1MNEA 4C3BA 5DQZA 4BEMJ 1YJGA 2Y3HA 4JZAA 2YEVA 3CAXA 3GWLA 1ZW2A 3MFNA 4CDAA 2XL6A 5L0DA 3EH1A 5AGFA 1HMDA 1T01A 5DS5A 2AP3A 3IQTA 1A7DA 3DZAA 3LS0A 2NUPB 1NU9C 3FHDA 4G7HF 4RDAA 3FOPA 1MNDA 1WWPA 3EFOA 3LLKA 3N24A 4ULWA 4OIPF 3KMIA 2IXPA 3U9JA 4H54A 4JIOA 3G4ZA 1RJ9B 1G5ZA 3H65A 1BR1A 2J0WA 1C02A 4KBLA 4O6YA 2C04A 4DBQA 4J7TA 1HE9A 2PX0A 3LNRA 4PR9A 1MQVA 1ZYRF 4EIYA 3FAPB 2DYRC 3CZ6A 3EHNA 4GEHA 4AE4B 3VRCA 3WG7C 4N6HA 1MMNA 3FXHA 2EIKC 4XPXA 2EPNA 2L6GA 1NBBA 3QW1A 3F46A 2NG1A 2WVOA 3DE8A 4JVSA 4IGGA 2XXAA 3NDBB 2JX0A 3TOLA 3S0XA 1RMVA 3HTKC 4JTAB 4OD5A 1JMWA 3QZCA 3TJ5A 5KYYB 4JEAA 3ITFA 2A6HF 3DMDA 5A6AA 1PV3A 3PDMP 4ZLDA 5JRAA 2QNLA 1M2VB 3LNMB 1YLMA 2AWYA 2YZSA 4Z9JA 2EPOA 3KPHA 1FFHA 4C3DA 4OIOF 1DOVA 4AX2A 4MVZA 4O6MA 2NUTA 4Q7CA 4AL1A 4CS9C 4DVYP 3JCUQ 4QDLA 2PF4E 2EILC 1T5OA 5KYXA 2CCYA 2HS5A 4LDQA 5COGA 1U0BB 3JYYA 3JYHA 3EH2A 5A6BA 4CIPA 2I8BA 1L7CA 4DRHB 5KYUA 3ZIBA 1MMAA 3ZG1A 3KYIA 3LEOA 4MTGA 1Z3IX 1QKRA 1XZPA 2DGJA 4J32B 5FZTA 3G50A 3K1IA 2LFDA 5E3AA 2VCBA 2JPUA 3W2VA 4CDYA 5JVEA 5KYWA 1E86A 4QI2A 1BBHA 1GS9A 1UFBA 3RW0A 5JUAA 3K1HA 2UUIA 1FR0A 3S28A 1OXBA 1R5ID 2KGOA 3M4CA 5HV9A 4K0DA 1ZHXA 4O79A 2QY9A 1FNTc 2YL0A 3RIPA 4DBRA 4JCHA 1A41A 2PX3A 3WODF 3L8JA 3EGXA 2YLIA 4CX9A 1A0BA 2YKZA 4BJTA 3I4UA 3L0IA 2J8WA 5L3VA 3DAFA 2M4EA 4K1OA 5L0CA 4UDVA 1NFNA 1YARO 4MVOA 3O6XA 5A6KA 2B0JA 1WOLA 3DAGA 3HKKA 4H4KC 4JC7A 4YL0A 3JSZA 2OQMA 1ZHYA 2R7WA 4PJJA 1XWJA 1K40A 1G8XA 3F47A 3E70C 1T9KA 2R7XA 1E83A 2HSBA 3VAYA 2XLVA 4C7OA 2J0XA 2OJQA 4PFOA 4ER9A 3ASNC 2I15A 1J8YF 2EPMX 2R7QA 1OR2A 2ZD9A 2D5RB 4XWJA 2XS8A 2OKUA 3NYLA 4XPYA 3W8IA 1WTYA 1ZW3A 2Q9BA 3C8GB 1TFOB 5EK0A 4WJ0A 5B3SC 4Z9IA 3AG2C 2MHRA 3UGOA 2EPKX 3IQ6A 2IBFA 4W8PA 3KKBA 1ZZPA 3FOOA 1O87A 1YA9A 2ZXOA 1IZMA 2LSEA 4BJ6A 4EUKB 5L0GA 2GFHA 2QUPA 3RVZA 4PK4A 3MYFA 4B6IA 1D0XA 2J46A 3JZ0A 3LESA 2OU6A 5E33A 4GQHA 1GQAA 4MTOA 1K05A 3VM6A 2Y69C 1AUEA 1O5HA 1MMDA 4O6NA 3RQFA 2YLGA 4LDRA 3C8GD 3S27A 4IARA 3V5ZA 2F22A 4KI2A 1LPEA 4PJMA 4MW8A 3WHNA 2NSGA 1CPRA 1S7ZA 3LUTB 4JEBA 3SXMA 3UR3C 4EBBA 2QTVA 1WATA 3JSEO 5COMA 3AG4C 4YT4A 1VB5A 2YVKA 2FGYA 3NMJA 3DI5A 4FX5A 4NTAA 3ZDLA 2J7PA 3GWNA 1F1MA 4CJGA 1YAUO 5JS5A 4G7ZF 5T3WA 1VTMP 1JRAA 3U0CA 1YA7O 2R25A 3NYJA 4OIRF 2H7OA 4QI0A 3M1CB 3R2PA 2XLEA 3H2UA 4JE9A 1D1AA 3TD7A 3EPVA 3X1OA 3B9QA 4YWQA 4HFFB 1M6TA 2EIJC 2R7OA 1WASA 4XPWA 3AOUA 2X51A 5L0JA 2CGEA 3LLIA 3M15A 2KJGA 4EBJA 1Q0MA 2GWWA 2CNWD 2J9WA 2A0BA 3O55A 4LLCA 3JRTA 1I4YA 1VMAA 3FAJA 4YT2A 1CGOA 1TQGA 2XLDA 2YRFA 1Z23A 2R9RB 4DRJB 2XL8A 2YHSA 4MVMA 3DWWA 4XEFA 2IXMA 3I5PA 1I5NA 1HW1A 4I1OB 3T4RA 4G78A 4P6IC 3ZWIA 1KU2A 3GEIA 4MS2A 2LIGA 3NMIA 2P6VA 1YVIA 4CJOA 3B0VC 1ORSC 3QMKA 1TWCA 2JD3A 4KNWA 3AG3C 4PJNA 3SXKA 3SXZA 2ICWG 3E9VA 2J9BA 4IJJA 3U2MA 4DXWA 3SXYA 4YT8A 2WZLA 1BZ4A 4OIQF 1LI7A 2NUPA 3B29A 3CSKA 4YK5A 2AWCA 3KH2A 3DE9A 3RQEA 5DQTA 2O9XA 2V3CC 5F5HA 3C63A 1ORYA 2Y3GA 4U5GA 4U5HA 2NUTB 3S9OA 4LERA 3DD7A 1LI5A 1V4AA 2R03A 4MQ9F 4JJGA 4MVRA 3IHUA 3CEXA 4IAQA 3K33A 4MTFA 1Z63A 3X2QC 5T3TA 3AGUA 3UMKA 1ZHZA 3U3BA 4AE4A 3NG1A 3HNJA 3K66A 4LDKA 2QLAA 4X0RA 4EBKA 3NYMA 3NKDA 4CBEA 2FFHA 1HY5A 5TJ5E 3ZQYA 2G3VA 3BRJA 2NPUA 1T6IA 1LE2A 3GEEA 3JRMO 4LLEA 3FVYA 3VYWA 2NSFA 4NTBA 3ZTMA 2ETSA 4CDVA 3LAYA 4AK9A 3MYIA 2KC3A 2HJ3A 1TWHA 4HFKB 3L34A 1T6QA 2L7AA 1W2WA 3U8PA 4DRIB 5A6BD 5KYYA 1NG1A 1D0YA 5AC4A 3ZSUA 2KYHA 2HZ8A 3T6GB 5CI9A 2OJED 2R7SA 1V74B 1HW2A 4NC3A 1OKKD 1NU7D 1D1CA 2FAPB 3A9CA 3LJBA 1C17M 1TWAA 3QVZA 1OCRC 1QPUA 1ZU5A 4XTKA 1YZAA 2R02A 3AQCA 3HNKA 3I5QA 3IPMO 3MBGA 3SEOA 1RCPA 4NTFA 1S05A 3DXJF 1IW7F 3O39A 4P9TA 2IYLD 3RYLA 4CSAA 2DYSC 1JAFA 3WAQA 3O10A 1OW6A 1AVOB 2XLOA 3RH3A 2R7VA 2OG2A 1OW8A 4N4WA 2XM4A 3NRHA 4ZLCA 4WGYA 3PHF2 2R7UA 1C03A 5A6JA 2KW3C 3K7DA 2D4UA 1Y4CA 256BA 2W4BA 1I4ZA 3OEOA 4U5EE 1Z5ZA 3H2VA 4RD9A 4ULVA 2Z15A 2Y39A 4OD4A 5E3CA 2P0NA 3ABMC 1FAPB 2ZPAA 1LKXA 3NMKA 2OOCA 4N06A 1CGME 4XLNF 2HMQA 1N1CA 3IQ5A 4Q4ZF 5BQIA 4YT5A 5L0FA 4PFPA 5B3IA 5EGYA 2W4MA 5D92A 1OCZC 4IB4A 3AJMA 3SP1A 2BC5A 2YQYA 3A11A 2Q7RA 3TOMA 1D1BA 3B0PA 4DJ9A 5CIVA 3W8HA 2G3KA 1RKEB 2MWQA 3JTLO 4JW1A 1O3UA 2YL3A 5T1DB 4BG0A 4J30B 4PACA 5KYNA 5AC5A 4I3MA 2Y3DA 1U89A 2IXOA 3MLGA 2PBEA 2VB6A 5B1AC 5HSWA 2DB4A 3Q6MA 3LEVA 4KC9A 4U5DE 4D4NA 1DOWA 2E87A 3GM2A 3L1MA 5BUOA 3JT1A 2Q00A 2Y3BA 1QZXA 4Z9HA 3AGTA 1AEPA 2WZFA 1G4US 1EQ1A 5E2QA 4XQ1A 1D0ZA 3EZIA 2OEXA 4IAOA 2H8AA 1SF8A 2W9YA 1UG7A 2ASRA 3OWTA 3EG9B 4BJ6C 2WVNA 1TR2A 1PD1A 1BR4A 4JCZA 3J06A 3EHMA 2CW0F 3KL4A 2BE5F 2P61A 3TK0A 4BJ5C 4D4XA 2ZXWC 3RF3A 3DJNB 4HEAJ 5L3QA 2Q4FA 1ST6A 3ZQVA 1NFOA 1M57C 3HJCA 3EGDA 4G0HA 1QVXA 4RBNA 3ATPA 2OCCC 3EFOB 4LACB 2HJMA 4A2NB 2J45A 3AG1C 3V7OA 4FESA 1NSGB 2B0HA 5DLJA 4E0HA 4Q5SF 1U6HA 5JLIA 3C62A 4CS8C 2P7VA 2R05A 4NY3A 4HE8D 2EIMC 1JR8A 5BQHA 2A68F 4MW3A 3GODA 3V5YA 1OXKA 1K04A 2CYDA 4JTDB 3DJUB 1LS1A 1LS4A 2XS1A 3K6BA 4U5BE 1QLEC 3U9MA 1E84A 4J7YA 1Z6AA 1E2XA 4M63A 1LE4A 5F5FA 2HUJA 1H9GA 4EWCA 4E0IA 2CNWA 2W45A 2XLMA 4EHPA 3B0UX 2R7TA 2HFIA 2XXAB 2IOQA 1A7EA 2GAQA 1A7VA 2HSQA 1B68A 2V26A 4U9DA 3SNHA 4YL1A 3U2LA 5JT4A 3KYJA 1Z7Qc 1M2OA 1CGNA 2PP4A 5JSLA 2GA0A 3TQOA 4WABA 3LS1A 1J8MF 3US6A 3RQGA 3NKEA 3FMSA 3B71A 3U5SA 1VK5A 1G4WR 3ASOC 3S29A 1Q0GA 1BDJB 1LM3B 1RJ9A 3UMHA 3FDQA 3AQBA 3UGPA 1H9TA 4JTCB 3QTHA 3C7JA 2Q3TA 2YL1A 2BL2A 5KYXB 3POVA 2VC9A 2HKVA 3HLZA 2VCAA 5D91A 5DVWA 2H7VC 1PCXA 2XL4A 3SYNA 4CS9A 4DVZA 1H6GA 3EJNA 1PD0A 4CS7A 2G62A 2Q9CA 3W2WA 5KYUB 4E7ZA 1FTSA 1MMGA 4MVSA 3R7CA 2KSFA 1YYXA 1SZIA 2XLWA 2XM0A 3C8ZA 4NQFA 5L0HA 5COFA 3SZRA 1ZVZA 1R4TA 2VCCA 5A69A 1Q0DA 4U9EA 2H7BA 1SMYF 1VOMA 3M4BA 3T9OA 5KYWB 2GDCA 5DS6A 4GYTA 4FAPB 3DKAA 1YDIA 2KNHA 4FWVA 5BQGA 3N0TA 1APCA 3N2ZB 2EPLX 4EKWA 1V55C 1SR2A 2LD6A 1TFKB 1OR3A 4MNDA 2AU5A 1ORJA 1M2VA 2P1AA 1BR2A 3GM3A 1FMWA 3EGXB 1H7IA 5FCLA 4P9FA 1EI7A 1ZU4A 2L6HA 4BPMA 5DS4A 2WB7A 1T6UA 4BJ5A 1SYQA 3ZTZA 4U5CE 2PFDA 4WGZA 3RKOF 4JKVA 1FFTC 4OINF 3IEEA 5F28E 3G4XA 1OKKA 1TKNA 4MVUA 4ANJA 3K1IC 1OW7A 4XEVA 4JRZA 3IQCA 4KNVA 4I1MA 1VLTA 3GANA 1Q0FA 1EA8A 4PJLA 1WGWA 4C7OB 2C03A 4W8KA 2OEVA 3BEHA 1EKYA 1XZQA 2AVKA 3DM9B 4E18A 1TWGA 2UUHA 1RKCA 5L0IA 3EZHA 3C18A 1ZHTA 1YYJA 2ZXRA 1ZHWA 2HV7A 2MYSA 2YWAA 1HE1A 4O7GA 3TJ6A 4CSAC 2L6FA 2L9JA 4C3EA 1FMVA 1OCCC 3HNIA 4BEJA 4R32A 2EINC 2A1DD 2A69F 1VLSA 3ECSA 2IM8A 2YL7A 4BJ1A 2PNOA 3ZVRA 3T6BA 2QE9A 4L6RA 3PMRA 1WN0A 2XLHA 3DM5A 1NZEA 1Q0KA 1JOGA 3L8IA
chains in the Genus database with same CATH topology
3ZQYA 4CDYA 1E86A 5JVEA 3DE9A 1BBHA 5JLIA 5JUAA 3C62A 3QW0A 3C63A 3M4CA 2YL0A 4IAQA 1E84A 2YLIA 4CX9A 2YKZA 3M79A 2J8WA 2XLMA 3HNJA 2QLAA 1E85A 1A7VA 4U9DA 5JT4A 4CDVA 3ZTMA 1CGNA 5JSLA 3U8PA 1E83A 2XLVA 1QQ3A 4ER9A 2YLDA 4NC3A 1CPQA 1LM3B 3QVZA 2YL1A 1QPUA 1YZAA 3HNKA 3HNLA 1RCPA 5JP7A 1S05A 3QVYA 3IQ6A 1YZCA 3FOOA 1JAFA 4CDAA 1YYXA 2XLOA 2XLWA 2XL6A 2XM0A 4N4WA 5AGFA 2XM4A 4WGYA 1GQAA 4U9EA 256BA 3M4BA 3FOPA 4ULVA 2YLGA 4IARA 1APCA 1CPRA 4JEBA 3NMKA 3IQ5A 3NMJA 1MQVA 4CJGA 4EIYA 5B3IA 5JS5A 4IB4A 3VRCA 2BC5A 3ZTZA 3TOMA 4N6HA 4WGZA 4JKVA 4JE9A 1NBBA 3QW1A 2XLEA 3DE8A 2YL3A 3TOLA 1M6TA 3M15A 4JEAA 4D4NA 3L1MA 1EKYA 5JRAA 1CGOA 2XLDA 2XL8A 1YYJA 3ZWIA 3HNIA 2CCYA 3NMIA 2YL7A 4D4XA 4CIPA 4CJOA 3ZQVA 4L6RA 2XLHA 2J9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQY A;  4CDY A;  1E86 A;  5JVE A;  3DE9 A;  1BBH A;  5JLI A;  5JUA A;  3C62 A;  3QW0 A;  3C63 A;  3M4C A;  2YL0 A;  4IAQ A;  1E84 A;  2YLI A;  4CX9 A;  2YKZ A;  3M79 A;  2J8W A;  2XLM A;  3HNJ A;  2QLA A;  1E85 A;  1A7V A;  4U9D A;  5JT4 A;  4CDV A;  3ZTM A;  1CGN A;  5JSL A;  3U8P A;  1E83 A;  2XLV A;  1QQ3 A;  4ER9 A;  2YLD A;  4NC3 A;  1CPQ A;  1LM3 B;  3QVZ A;  2YL1 A;  1QPU A;  1YZA A;  3HNK A;  3HNL A;  1RCP A;  5JP7 A;  1S05 A;  3QVY A;  3IQ6 A;  1YZC A;  3FOO A;  1JAF A;  4CDA A;  1YYX A;  2XLO A;  2XLW A;  2XL6 A;  2XM0 A;  4N4W A;  5AGF A;  2XM4 A;  4WGY A;  1GQA A;  4U9E A;  256B A;  3M4B A;  3FOP A;  4ULV A;  2YLG A;  4IAR A;  1APC A;  1CPR A;  4JEB A;  3NMK A;  3IQ5 A;  3NMJ A;  1MQV A;  4CJG A;  4EIY A;  5B3I A;  5JS5 A;  4IB4 A;  3VRC A;  2BC5 A;  3ZTZ A;  3TOM A;  4N6H A;  4WGZ A;  4JKV A;  4JE9 A;  1NBB A;  3QW1 A;  2XLE A;  3DE8 A;  2YL3 A;  3TOL A;  1M6T A;  3M15 A;  4JEA A;  4D4N A;  3L1M A;  1EKY A;  5JRA A;  1CGO A;  2XLD A;  2XL8 A;  1YYJ A;  3ZWI A;  3HNI A;  2CCY A;  3NMI A;  2YL7 A;  4D4X A;  4CIP A;  4CJO A;  3ZQV A;  4L6R A;  2XLH A;  2J9B A; 
#chains in the Genus database with same CATH topology
 3TUL A;  2J9U A;  4F4B A;  4JUR I;  2DI3 A;  4AL0 A;  2HMZ A;  2J9V A;  4E7S A;  1NLX A;  4CIH A;  3T6J A;  1L3P A;  2IXN A;  1HMO A;  1Y6D A;  2XSE A;  1LIH A;  3QW0 A;  4DOZ A;  1JPJ A;  4K7B A;  1V54 C;  1LVK A;  3RVY A;  2VH3 A;  2Q9A A;  4NCQ A;  1OQC A;  2RD9 A;  4MVQ A;  4U5F E;  3GOR A;  3U8V A;  2HV6 A;  3S90 A;  4ONS A;  1RXQ A;  3PCV A;  3ABK C;  2KQ9 A;  2LP4 A;  3RFY A;  2WZG A;  3Q6N A;  4YN0 B;  1VYI A;  4E17 A;  3M79 A;  3CQZ A;  2LQG A;  4I44 A;  3EQL F;  5EHH A;  3C8G A;  3ZC4 A;  3OA1 A;  3Q7L A;  3EGD B;  5CI8 A;  5B1B C;  1E85 A;  5IY5 C;  4XLP F;  4G7O F;  2VAS A;  1QSP A;  4XEK A;  2A0U A;  2M64 A;  3ABL C;  1RKE A;  1VYK A;  4IWB A;  4N6C A;  4YL3 A;  3VF0 A;  1GGQ A;  2J7P D;  3UMI A;  2LCH A;  2XRH A;  2A6E F;  2TMV P;  1GM5 A;  3MX3 A;  2WL8 A;  5GPG B;  2KK1 A;  1OCO C;  3V5X A;  3GM1 A;  1KTM A;  1JPN A;  2LK4 A;  1QQ3 A;  3W4Y A;  2ZXP A;  2YLD A;  4IRU A;  4JJF A;  1M56 C;  1KNY A;  1CPQ A;  4CS8 A;  3GEH A;  3S84 A;  2CDQ A;  5K0I A;  3U3F A;  2X0C A;  2RSE B;  4A4A A;  2WVQ A;  3HNL A;  2L81 A;  3Q7G A;  4YJW A;  3UNG C;  2R7R A;  5JP7 A;  3EG9 A;  2LFF A;  3QVY A;  1YZC A;  1MNE A;  4C3B A;  5DQZ A;  4BEM J;  1YJG A;  2Y3H A;  4JZA A;  2YEV A;  3CAX A;  3GWL A;  1ZW2 A;  3MFN A;  4CDA A;  2XL6 A;  5L0D A;  3EH1 A;  5AGF A;  1HMD A;  1T01 A;  5DS5 A;  2AP3 A;  3IQT A;  1A7D A;  3DZA A;  3LS0 A;  2NUP B;  1NU9 C;  3FHD A;  4G7H F;  4RDA A;  3FOP A;  1MND A;  1WWP A;  3EFO A;  3LLK A;  3N24 A;  4ULW A;  4OIP F;  3KMI A;  2IXP A;  3U9J A;  4H54 A;  4JIO A;  3G4Z A;  1RJ9 B;  1G5Z A;  3H65 A;  1BR1 A;  2J0W A;  1C02 A;  4KBL A;  4O6Y A;  2C04 A;  4DBQ A;  4J7T A;  1HE9 A;  2PX0 A;  3LNR A;  4PR9 A;  1MQV A;  1ZYR F;  4EIY A;  3FAP B;  2DYR C;  3CZ6 A;  3EHN A;  4GEH A;  4AE4 B;  3VRC A;  3WG7 C;  4N6H A;  1MMN A;  3FXH A;  2EIK C;  4XPX A;  2EPN A;  2L6G A;  1NBB A;  3QW1 A;  3F46 A;  2NG1 A;  2WVO A;  3DE8 A;  4JVS A;  4IGG A;  2XXA A;  3NDB B;  2JX0 A;  3TOL A;  3S0X A;  1RMV A;  3HTK C;  4JTA B;  4OD5 A;  1JMW A;  3QZC A;  3TJ5 A;  5KYY B;  4JEA A;  3ITF A;  2A6H F;  3DMD A;  5A6A A;  1PV3 A;  3PDM P;  4ZLD A;  5JRA A;  2QNL A;  1M2V B;  3LNM B;  1YLM A;  2AWY A;  2YZS A;  4Z9J A;  2EPO A;  3KPH A;  1FFH A;  4C3D A;  4OIO F;  1DOV A;  4AX2 A;  4MVZ A;  4O6M A;  2NUT A;  4Q7C A;  4AL1 A;  4CS9 C;  4DVY P;  3JCU Q;  4QDL A;  2PF4 E;  2EIL C;  1T5O A;  5KYX A;  2CCY A;  2HS5 A;  4LDQ A;  5COG A;  1U0B B;  3JYY A;  3JYH A;  3EH2 A;  5A6B A;  4CIP A;  2I8B A;  1L7C A;  4DRH B;  5KYU A;  3ZIB A;  1MMA A;  3ZG1 A;  3KYI A;  3LEO A;  4MTG A;  1Z3I X;  1QKR A;  1XZP A;  2DGJ A;  4J32 B;  5FZT A;  3G50 A;  3K1I A;  2LFD A;  5E3A A;  2VCB A;  2JPU A;  3W2V A;  4CDY A;  5JVE A;  5KYW A;  1E86 A;  4QI2 A;  1BBH A;  1GS9 A;  1UFB A;  3RW0 A;  5JUA A;  3K1H A;  2UUI A;  1FR0 A;  3S28 A;  1OXB A;  1R5I D;  2KGO A;  3M4C A;  5HV9 A;  4K0D A;  1ZHX A;  4O79 A;  2QY9 A;  1FNT c;  2YL0 A;  3RIP A;  4DBR A;  4JCH A;  1A41 A;  2PX3 A;  3WOD F;  3L8J A;  3EGX A;  2YLI A;  4CX9 A;  1A0B A;  2YKZ A;  4BJT A;  3I4U A;  3L0I A;  2J8W A;  5L3V A;  3DAF A;  2M4E A;  4K1O A;  5L0C A;  4UDV A;  1NFN A;  1YAR O;  4MVO A;  3O6X A;  5A6K A;  2B0J A;  1WOL A;  3DAG A;  3HKK A;  4H4K C;  4JC7 A;  4YL0 A;  3JSZ A;  2OQM A;  1ZHY A;  2R7W A;  4PJJ A;  1XWJ A;  1K40 A;  1G8X A;  3F47 A;  3E70 C;  1T9K A;  2R7X A;  1E83 A;  2HSB A;  3VAY A;  2XLV A;  4C7O A;  2J0X A;  2OJQ A;  4PFO A;  4ER9 A;  3ASN C;  2I15 A;  1J8Y F;  2EPM X;  2R7Q A;  1OR2 A;  2ZD9 A;  2D5R B;  4XWJ A;  2XS8 A;  2OKU A;  3NYL A;  4XPY A;  3W8I A;  1WTY A;  1ZW3 A;  2Q9B A;  3C8G B;  1TFO B;  5EK0 A;  4WJ0 A;  5B3S C;  4Z9I A;  3AG2 C;  2MHR A;  3UGO A;  2EPK X;  3IQ6 A;  2IBF A;  4W8P A;  3KKB A;  1ZZP A;  3FOO A;  1O87 A;  1YA9 A;  2ZXO A;  1IZM A;  2LSE A;  4BJ6 A;  4EUK B;  5L0G A;  2GFH A;  2QUP A;  3RVZ A;  4PK4 A;  3MYF A;  4B6I A;  1D0X A;  2J46 A;  3JZ0 A;  3LES A;  2OU6 A;  5E33 A;  4GQH A;  1GQA A;  4MTO A;  1K05 A;  3VM6 A;  2Y69 C;  1AUE A;  1O5H A;  1MMD A;  4O6N A;  3RQF A;  2YLG A;  4LDR A;  3C8G D;  3S27 A;  4IAR A;  3V5Z A;  2F22 A;  4KI2 A;  1LPE A;  4PJM A;  4MW8 A;  3WHN A;  2NSG A;  1CPR A;  1S7Z A;  3LUT B;  4JEB A;  3SXM A;  3UR3 C;  4EBB A;  2QTV A;  1WAT A;  3JSE O;  5COM A;  3AG4 C;  4YT4 A;  1VB5 A;  2YVK A;  2FGY A;  3NMJ A;  3DI5 A;  4FX5 A;  4NTA A;  3ZDL A;  2J7P A;  3GWN A;  1F1M A;  4CJG A;  1YAU O;  5JS5 A;  4G7Z F;  5T3W A;  1VTM P;  1JRA A;  3U0C A;  1YA7 O;  2R25 A;  3NYJ A;  4OIR F;  2H7O A;  4QI0 A;  3M1C B;  3R2P A;  2XLE A;  3H2U A;  4JE9 A;  1D1A A;  3TD7 A;  3EPV A;  3X1O A;  3B9Q A;  4YWQ A;  4HFF B;  1M6T A;  2EIJ C;  2R7O A;  1WAS A;  4XPW A;  3AOU A;  2X51 A;  5L0J A;  2CGE A;  3LLI A;  3M15 A;  2KJG A;  4EBJ A;  1Q0M A;  2GWW A;  2CNW D;  2J9W A;  2A0B A;  3O55 A;  4LLC A;  3JRT A;  1I4Y A;  1VMA A;  3FAJ A;  4YT2 A;  1CGO A;  1TQG A;  2XLD A;  2YRF A;  1Z23 A;  2R9R B;  4DRJ B;  2XL8 A;  2YHS A;  4MVM A;  3DWW A;  4XEF A;  2IXM A;  3I5P A;  1I5N A;  1HW1 A;  4I1O B;  3T4R A;  4G78 A;  4P6I C;  3ZWI A;  1KU2 A;  3GEI A;  4MS2 A;  2LIG A;  3NMI A;  2P6V A;  1YVI A;  4CJO A;  3B0V C;  1ORS C;  3QMK A;  1TWC A;  2JD3 A;  4KNW A;  3AG3 C;  4PJN A;  3SXK A;  3SXZ A;  2ICW G;  3E9V A;  2J9B A;  4IJJ A;  3U2M A;  4DXW A;  3SXY A;  4YT8 A;  2WZL A;  1BZ4 A;  4OIQ F;  1LI7 A;  2NUP A;  3B29 A;  3CSK A;  4YK5 A;  2AWC A;  3KH2 A;  3DE9 A;  3RQE A;  5DQT A;  2O9X A;  2V3C C;  5F5H A;  3C63 A;  1ORY A;  2Y3G A;  4U5G A;  4U5H A;  2NUT B;  3S9O A;  4LER A;  3DD7 A;  1LI5 A;  1V4A A;  2R03 A;  4MQ9 F;  4JJG A;  4MVR A;  3IHU A;  3CEX A;  4IAQ A;  3K33 A;  4MTF A;  1Z63 A;  3X2Q C;  5T3T A;  3AGU A;  3UMK A;  1ZHZ A;  3U3B A;  4AE4 A;  3NG1 A;  3HNJ A;  3K66 A;  4LDK A;  2QLA A;  4X0R A;  4EBK A;  3NYM A;  3NKD A;  4CBE A;  2FFH A;  1HY5 A;  5TJ5 E;  3ZQY A;  2G3V A;  3BRJ A;  2NPU A;  1T6I A;  1LE2 A;  3GEE A;  3JRM O;  4LLE A;  3FVY A;  3VYW A;  2NSF A;  4NTB A;  3ZTM A;  2ETS A;  4CDV A;  3LAY A;  4AK9 A;  3MYI A;  2KC3 A;  2HJ3 A;  1TWH A;  4HFK B;  3L34 A;  1T6Q A;  2L7A A;  1W2W A;  3U8P A;  4DRI B;  5A6B D;  5KYY A;  1NG1 A;  1D0Y A;  5AC4 A;  3ZSU A;  2KYH A;  2HZ8 A;  3T6G B;  5CI9 A;  2OJE D;  2R7S A;  1V74 B;  1HW2 A;  4NC3 A;  1OKK D;  1NU7 D;  1D1C A;  2FAP B;  3A9C A;  3LJB A;  1C17 M;  1TWA A;  3QVZ A;  1OCR C;  1QPU A;  1ZU5 A;  4XTK A;  1YZA A;  2R02 A;  3AQC A;  3HNK A;  3I5Q A;  3IPM O;  3MBG A;  3SEO A;  1RCP A;  4NTF A;  1S05 A;  3DXJ F;  1IW7 F;  3O39 A;  4P9T A;  2IYL D;  3RYL A;  4CSA A;  2DYS C;  1JAF A;  3WAQ A;  3O10 A;  1OW6 A;  1AVO B;  2XLO A;  3RH3 A;  2R7V A;  2OG2 A;  1OW8 A;  4N4W A;  2XM4 A;  3NRH A;  4ZLC A;  4WGY A;  3PHF 2;  2R7U A;  1C03 A;  5A6J A;  2KW3 C;  3K7D A;  2D4U A;  1Y4C A;  256B A;  2W4B A;  1I4Z A;  3OEO A;  4U5E E;  1Z5Z A;  3H2V A;  4RD9 A;  4ULV A;  2Z15 A;  2Y39 A;  4OD4 A;  5E3C A;  2P0N A;  3ABM C;  1FAP B;  2ZPA A;  1LKX A;  3NMK A;  2OOC A;  4N06 A;  1CGM E;  4XLN F;  2HMQ A;  1N1C A;  3IQ5 A;  4Q4Z F;  5BQI A;  4YT5 A;  5L0F A;  4PFP A;  5B3I A;  5EGY A;  2W4M A;  5D92 A;  1OCZ C;  4IB4 A;  3AJM A;  3SP1 A;  2BC5 A;  2YQY A;  3A11 A;  2Q7R A;  3TOM A;  1D1B A;  3B0P A;  4DJ9 A;  5CIV A;  3W8H A;  2G3K A;  1RKE B;  2MWQ A;  3JTL O;  4JW1 A;  1O3U A;  2YL3 A;  5T1D B;  4BG0 A;  4J30 B;  4PAC A;  5KYN A;  5AC5 A;  4I3M A;  2Y3D A;  1U89 A;  2IXO A;  3MLG A;  2PBE A;  2VB6 A;  5B1A C;  5HSW A;  2DB4 A;  3Q6M A;  3LEV A;  4KC9 A;  4U5D E;  4D4N A;  1DOW A;  2E87 A;  3GM2 A;  3L1M A;  5BUO A;  3JT1 A;  2Q00 A;  2Y3B A;  1QZX A;  4Z9H A;  3AGT A;  1AEP A;  2WZF A;  1G4U S;  1EQ1 A;  5E2Q A;  4XQ1 A;  1D0Z A;  3EZI A;  2OEX A;  4IAO A;  2H8A A;  1SF8 A;  2W9Y A;  1UG7 A;  2ASR A;  3OWT A;  3EG9 B;  4BJ6 C;  2WVN A;  1TR2 A;  1PD1 A;  1BR4 A;  4JCZ A;  3J06 A;  3EHM A;  2CW0 F;  3KL4 A;  2BE5 F;  2P61 A;  3TK0 A;  4BJ5 C;  4D4X A;  2ZXW C;  3RF3 A;  3DJN B;  4HEA J;  5L3Q A;  2Q4F A;  1ST6 A;  3ZQV A;  1NFO A;  1M57 C;  3HJC A;  3EGD A;  4G0H A;  1QVX A;  4RBN A;  3ATP A;  2OCC C;  3EFO B;  4LAC B;  2HJM A;  4A2N B;  2J45 A;  3AG1 C;  3V7O A;  4FES A;  1NSG B;  2B0H A;  5DLJ A;  4E0H A;  4Q5S F;  1U6H A;  5JLI A;  3C62 A;  4CS8 C;  2P7V A;  2R05 A;  4NY3 A;  4HE8 D;  2EIM C;  1JR8 A;  5BQH A;  2A68 F;  4MW3 A;  3GOD A;  3V5Y A;  1OXK A;  1K04 A;  2CYD A;  4JTD B;  3DJU B;  1LS1 A;  1LS4 A;  2XS1 A;  3K6B A;  4U5B E;  1QLE C;  3U9M A;  1E84 A;  4J7Y A;  1Z6A A;  1E2X A;  4M63 A;  1LE4 A;  5F5F A;  2HUJ A;  1H9G A;  4EWC A;  4E0I A;  2CNW A;  2W45 A;  2XLM A;  4EHP A;  3B0U X;  2R7T A;  2HFI A;  2XXA B;  2IOQ A;  1A7E A;  2GAQ A;  1A7V A;  2HSQ A;  1B68 A;  2V26 A;  4U9D A;  3SNH A;  4YL1 A;  3U2L A;  5JT4 A;  3KYJ A;  1Z7Q c;  1M2O A;  1CGN A;  2PP4 A;  5JSL A;  2GA0 A;  3TQO A;  4WAB A;  3LS1 A;  1J8M F;  3US6 A;  3RQG A;  3NKE A;  3FMS A;  3B71 A;  3U5S A;  1VK5 A;  1G4W R;  3ASO C;  3S29 A;  1Q0G A;  1BDJ B;  1LM3 B;  1RJ9 A;  3UMH A;  3FDQ A;  3AQB A;  3UGP A;  1H9T A;  4JTC B;  3QTH A;  3C7J A;  2Q3T A;  2YL1 A;  2BL2 A;  5KYX B;  3POV A;  2VC9 A;  2HKV A;  3HLZ A;  2VCA A;  5D91 A;  5DVW A;  2H7V C;  1PCX A;  2XL4 A;  3SYN A;  4CS9 A;  4DVZ A;  1H6G A;  3EJN A;  1PD0 A;  4CS7 A;  2G62 A;  2Q9C A;  3W2W A;  5KYU B;  4E7Z A;  1FTS A;  1MMG A;  4MVS A;  3R7C A;  2KSF A;  1YYX A;  1SZI A;  2XLW A;  2XM0 A;  3C8Z A;  4NQF A;  5L0H A;  5COF A;  3SZR A;  1ZVZ A;  1R4T A;  2VCC A;  5A69 A;  1Q0D A;  4U9E A;  2H7B A;  1SMY F;  1VOM A;  3M4B A;  3T9O A;  5KYW B;  2GDC A;  5DS6 A;  4GYT A;  4FAP B;  3DKA A;  1YDI A;  2KNH A;  4FWV A;  5BQG A;  3N0T A;  1APC A;  3N2Z B;  2EPL X;  4EKW A;  1V55 C;  1SR2 A;  2LD6 A;  1TFK B;  1OR3 A;  4MND A;  2AU5 A;  1ORJ A;  1M2V A;  2P1A A;  1BR2 A;  3GM3 A;  1FMW A;  3EGX B;  1H7I A;  5FCL A;  4P9F A;  1EI7 A;  1ZU4 A;  2L6H A;  4BPM A;  5DS4 A;  2WB7 A;  1T6U A;  4BJ5 A;  1SYQ A;  3ZTZ A;  4U5C E;  2PFD A;  4WGZ A;  3RKO F;  4JKV A;  1FFT C;  4OIN F;  3IEE A;  5F28 E;  3G4X A;  1OKK A;  1TKN A;  4MVU A;  4ANJ A;  3K1I C;  1OW7 A;  4XEV A;  4JRZ A;  3IQC A;  4KNV A;  4I1M A;  1VLT A;  3GAN A;  1Q0F A;  1EA8 A;  4PJL A;  1WGW A;  4C7O B;  2C03 A;  4W8K A;  2OEV A;  3BEH A;  1EKY A;  1XZQ A;  2AVK A;  3DM9 B;  4E18 A;  1TWG A;  2UUH A;  1RKC A;  5L0I A;  3EZH A;  3C18 A;  1ZHT A;  1YYJ A;  2ZXR A;  1ZHW A;  2HV7 A;  2MYS A;  2YWA A;  1HE1 A;  4O7G A;  3TJ6 A;  4CSA C;  2L6F A;  2L9J A;  4C3E A;  1FMV A;  1OCC C;  3HNI A;  4BEJ A;  4R32 A;  2EIN C;  2A1D D;  2A69 F;  1VLS A;  3ECS A;  2IM8 A;  2YL7 A;  4BJ1 A;  2PNO A;  3ZVR A;  3T6B A;  2QE9 A;  4L6R A;  3PMR A;  1WN0 A;  2XLH A;  3DM5 A;  1NZE A;  1Q0K A;  1JOG A;  3L8I A; 
#chains in the Genus database with same CATH homology
 3ZQY A;  4CDY A;  1E86 A;  5JVE A;  3DE9 A;  1BBH A;  5JLI A;  5JUA A;  3C62 A;  3QW0 A;  3C63 A;  3M4C A;  2YL0 A;  4IAQ A;  1E84 A;  2YLI A;  4CX9 A;  2YKZ A;  3M79 A;  2J8W A;  2XLM A;  3HNJ A;  2QLA A;  1E85 A;  1A7V A;  4U9D A;  5JT4 A;  4CDV A;  3ZTM A;  1CGN A;  5JSL A;  3U8P A;  1E83 A;  2XLV A;  1QQ3 A;  4ER9 A;  2YLD A;  4NC3 A;  1CPQ A;  1LM3 B;  3QVZ A;  2YL1 A;  1QPU A;  1YZA A;  3HNK A;  3HNL A;  1RCP A;  5JP7 A;  1S05 A;  3QVY A;  3IQ6 A;  1YZC A;  3FOO A;  1JAF A;  4CDA A;  1YYX A;  2XLO A;  2XLW A;  2XL6 A;  2XM0 A;  4N4W A;  5AGF A;  2XM4 A;  4WGY A;  1GQA A;  4U9E A;  256B A;  3M4B A;  3FOP A;  4ULV A;  2YLG A;  4IAR A;  1APC A;  1CPR A;  4JEB A;  3NMK A;  3IQ5 A;  3NMJ A;  1MQV A;  4CJG A;  4EIY A;  5B3I A;  5JS5 A;  4IB4 A;  3VRC A;  2BC5 A;  3ZTZ A;  3TOM A;  4N6H A;  4WGZ A;  4JKV A;  4JE9 A;  1NBB A;  3QW1 A;  2XLE A;  3DE8 A;  2YL3 A;  3TOL A;  1M6T A;  3M15 A;  4JEA A;  4D4N A;  3L1M A;  1EKY A;  5JRA A;  1CGO A;  2XLD A;  2XL8 A;  1YYJ A;  3ZWI A;  3HNI A;  2CCY A;  3NMI A;  2YL7 A;  4D4X A;  4CIP A;  4CJO A;  3ZQV A;  4L6R A;  2XLH A;  2J9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...