1E84A

Cytochrome c' from alcaligenes xylosoxidans - reduced structure
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Unprecedented Proximal Binding of Nitric Oxide to Heme: Implications for Guanylate Cyclase
pubmed doi rcsb
molecule tags Electron transport
total genus 49
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2000-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1e84A00
2YL0A 1APCA 4ULVA 1CGOA 3M4BA 1CGNA 2BC5A 3IQ5A 5AGFA 3NMIA 1M6TA 3U8PA 5JLIA 1EKYA 4D4NA 256BA 2J8WA 5JRAA 4CDVA 2XL6A 5B3IA 3QW0A 5JVEA 1YYXA 2XLWA 2CCYA 4L6RA 2YKZA 1BBHA 2XLOA 1YZCA 3DE9A 4CDAA 1YYJA 2XM4A 3C63A 4N4WA 3QW1A 1E86A 1CPQA 3M4CA 4U9EA 1JAFA 4WGZA 4CIPA 1QPUA 3IQ6A 1E84A 4JEAA 2XL8A 3ZQYA 1YZAA 5JS5A 3ZTZA 2J9BA 4CX9A 4CDYA 1A7VA 1GQAA 4IB4A 3QVZA 2YLGA 2YL3A 3HNLA 3HNJA 2YLIA 4JKVA 3ZQVA 4IARA 4JEBA 4EIYA 2XLDA 4U9DA 3HNKA 4JE9A 2XLEA 2YLDA 2QLAA 3TOLA 3HNIA 3L1MA 3TOMA 3VRCA 1E85A 2YL7A 1QQ3A 3FOPA 1RCPA 1E83A 5JP7A 2XLHA 4WGYA 1NBBA 1MQVA 4CJOA 3NMKA 3QVYA 4D4XA 3DE8A 4N6HA 3C62A 2XLVA 3ZWIA 2YL1A 1S05A 5JSLA 2XM0A 3FOOA 4NC3A 3M15A 3NMJA 4CJGA 4ER9A 2XLMA 1CPRA 1LM3B 5JT4A 5JUAA 3ZTMA 4IAQA 3M79A
chains in the Genus database with same CATH superfamily
1H9GA 2ZXOA 2NG1A 3L8IA 3PCVA 2A68F 3DKAA 5B1BC 3MLGA 4ULVA 2Y3DA 1VTMP 4E17A 1ZU5A 1TFOB 2WVQA 3ABMC 1CGNA 2BC5A 2CNWA 3G4ZA 4N6CA 4XEKA 2WZLA 3S9OA 3DJUB 3ZDLA 3RKOF 1NLXA 1C02A 2G62A 2R7OA 3LNMB 5E3AA 4D4NA 3GM3A 2J8WA 3B29A 2R02A 2G3KA 3EHNA 3FHDA 3IHUA 1T9KA 1A0BA 1OR2A 3MX3A 1JMWA 4KBLA 3V5ZA 4MTGA 2HV7A 3UGPA 2F22A 2P1AA 2XLWA 2CCYA 5CIVA 2YKZA 3DZAA 3GODA 2XLOA 4XLPF 3GEIA 3B0VC 4U5GA 2BL2A 3C63A 5A6KA 2HV6A 4AK9A 3C7JA 5F5HA 1K05A 3QW1A 2NUPA 3VYWA 1GM5A 3U3BA 2W4BA 2VASA 1O5HA 3RFYA 4JURI 4WGZA 4EWCA 4ZLDA 4OIPF 4CIPA 5KYNA 1IZMA 4G7ZF 2PX3A 2Q9AA 4JEAA 1Z7Qc 4HEAJ 1B68A 3U2LA 2EPKX 1WASA 2ZXRA 5JS5A 4JTDB 1JR8A 2L9JA 3EGXB 3K66A 2ZXWC 1ZW2A 3JZ0A 5E2QA 2J9BA 1CGME 2Y3BA 4E0HA 5BQIA 3M1CB 2FGYA 2KK1A 4NQFA 4MTFA 3U3FA 2OU6A 3JRTA 4DJ9A 1YA7O 1M57C 1V4AA 1D1BA 2NUTA 4XTKA 4DOZA 4MVRA 1H7IA 4EBJA 4YWQA 4O6YA 3RW0A 3S90A 2YLIA 3OEOA 3NDBB 1OXBA 2RSEB 1FFTC 5B3SC 1VOMA 2CNWD 2GFHA 4LACB 1LIHA 3SYNA 1K04A 1YDIA 3ASNC 4IARA 3AQCA 3EH2A 4PACA 2KQ9A 4XWJA 1J8MF 1LE2A 1MMDA 2YHSA 4JEBA 2QE9A 3TJ6A 1ZHZA 5L3VA 5E33A 4NTBA 2NSFA 2R7QA 1LI7A 1NFNA 2EPLX 5AC5A 1ORSC 3UMHA 2LFFA 3L1MA 1E85A 5KYXA 2JPUA 3RQGA 1XZPA 2FAPB 2HMZA 3UGOA 1HW2A 1GGQA 1R4TA 4DRJB 5FCLA 1VYIA 3TK0A 2KYHA 3N24A 4PJNA 5L0FA 2A6HF 4BEJA 4JJGA 5KYWA 3KYJA 4O6NA 3C8GA 3FDQA 3T6GB 2YZSA 4I1OB 2IXPA 2CDQA 3VAYA 4CS9A 2WVOA 3QVYA 4K7BA 4D4XA 5L0HA 2J9WA 3LLIA 4BJ6A 4WJ0A 3C62A 1TWAA 1RJ9A 2J46A 4F4BA 1A7EA 1RKEB 3A11A 1IW7F 2YL1A 4XPWA 3DM9B 2XS1A 2QTVA 1M2VA 4PK4A 5JSLA 3R7CA 4JCHA 4NC3A 1RXQA 3O10A 5COGA 1L7CA 2KGOA 1BDJB 4U5EE 5DQZA 4BG0A 2W4MA 1LS4A 3L34A 3M15A 2KNHA 3NMJA 4BJ5A 1CPRA 4MW3A 3C8ZA 4OD4A 1G4US 4OINF 2QUPA 3HKKA 3NYLA 4Z9IA 4W8PA 1L3PA 4ANJA 3B71A 4G0HA 3ZTMA 3LEVA 3H65A 1D0XA 4PFPA 4FWVA 2ZPAA 4ONSA 2HMQA 1KU2A 3FXHA 3MYIA 4XPXA 3RVZA 1U89A 2MYSA 1BR1A 3MYFA 5CI9A 4XQ1A 2AP3A 2R7WA 2XRHA 3G4XA 2XXAA 3PDMP 1T6IA 2Q4FA 3WODF 2A0UA 1LVKA 2AWYA 4BEMJ 3ASOC 1FTSA 3U8PA 4CIHA 1EKYA 3KPHA 5B1AC 4AL1A 1LPEA 1KNYA 2GAQA 1FAPB 1NG1A 3FAPB 3RVYA 3MBGA 2H7OA 2HZ8A 4AE4A 4QI2A 2EINC 4Q4ZF 3EGDB 3QW0A 5JVEA 1Q0FA 1UG7A 1W2WA 4C3EA 3O39A 4G7OF 1BBHA 1G4WR 2VC9A 3DE9A 5EK0A 1TKNA 4CDAA 2IXOA 1RMVA 4MVOA 2PX0A 3LLKA 4G78A 3U0CA 2VH3A 1H9TA 1HMDA 2CW0F 3GANA 4XEFA 2R7XA 3SXYA 2VCAA 1YJGA 5DVWA 3U2MA 1ST6A 3EZHA 1E84A 3UMIA 1S7ZA 3K7DA 4H54A 4YL3A 2LFDA 1WTYA 4AL0A 2XL8A 5A6BA 5DS5A 4Z9JA 2HUJA 3ZQYA 1HY5A 2KW3C 3ZVRA 2R7RA 2P7VA 2TMVP 3ZTZA 1MMAA 2YEVA 1XWJA 3AQBA 1U6HA 3X1OA 4CX9A 4IAOA 4NY3A 1Z6AA 4C3BA 4U5HA 3B0UX 2XS8A 4Q5SF 1OCCC 1Q0DA 1FMWA 2HSBA 5L0JA 1ZHXA 3E70C 3ITFA 4IB4A 4BJ1A 3ABKC 1EA8A 2YLGA 2YL3A 4H4KC 3NKDA 4I44A 4YT5A 1M2OA 4IGGA 1BR2A 4EKWA 2NUPB 3AGUA 4P9FA 4E7SA 2OJQA 1A7DA 3IEEA 2YWAA 2H7BA 1TWHA 3U8VA 2A6EF 4DRHB 4JKVA 3H2VA 2P6VA 3Q6NA 1VLTA 5KYUA 2Q9BA 3LAYA 2XL4A 1J8YF 4YL0A 4CS8A 4JZAA 3ZIBA 3GORA 4HFKB 4M63A 3UNGC 4EIYA 1PV3A 3T6JA 3LUTB 3QMKA 3WHNA 3PHF2 3EH1A 4U9DA 1ORYA 3POVA 4JE9A 4J7TA 4MVZA 4XPYA 3WG7C 4DVYP 4CS9C 1JRAA 3TOMA 1ZZPA 1NU7D 1JPJA 3ECSA 5L0DA 2Q3TA 4BJ6C 2NUTB 5EHHA 1LKXA 4FAPB 2BE5F 1PD1A 2IM8A 3I4UA 2WZGA 1D0YA 3PMRA 1QQ3A 1DOWA 4Q7CA 3EZIA 4BPMA 2ICWG 2LD6A 3K33A 2R05A 5JP7A 2XLHA 3F47A 1RKCA 2Q00A 4WGYA 3W8HA 5A6BD 4CJOA 4LERA 4N06A 3EPVA 4BJ5C 4P9TA 2EPMX 4RD9A 1LS1A 2JD3A 4LDRA 3FAJA 1V55C 4LLCA 1ORJA 3VF0A 2JX0A 3NYMA 2UUIA 2VB6A 3V5XA 1WATA 2J7PA 5KYXB 1OW7A 1S05A 2NSGA 5T1DB 1O87A 3IPMO 2KC3A 3JRMO 3JT1A 4YL1A 4C7OA 1OCRC 3U5SA 4DRIB 4ER9A 1OQCA 4MS2A 5KYWB 4LDQA 4DXWA 5JT4A 3L8JA 3C8GB 3Q7LA 3CQZA 3SP1A 3UR3C 2EPNA 2Y3GA 2DGJA 3JTLO 3S29A 1QKRA 1K40A 3M79A 1ZHYA 4XEVA 3DXJF 3S84A 3T6BA 4JJFA 1Y4CA 1BZ4A 2MHRA 2XSEA 2CYDA 2YL0A 4RDAA 5COFA 1ZW3A 2P61A 2X51A 3CZ6A 1RJ9B 1CGOA 4UDVA 2R7SA 3EJNA 4G7HF 1D0ZA 1O3UA 1OCZC 3M4BA 3N2ZB 3TULA 3RQEA 1M2VB 4PJJA 1T6QA 3NYJA 3IQ5A 3GM1A 2OOCA 5AGFA 4EUKB 2WVNA 1DOVA 4I1MA 5FZTA 3S27A 5BUOA 4U5DE 256BA 1YVIA 3W4YA 1YA9A 2VCBA 4CDVA 3AOUA 5T3TA 2XL6A 2P0NA 1I4ZA 5B3IA 1A41A 1Q0GA 2D4UA 1QSPA 2W9YA 1FFHA 1YYXA 1YZCA 1I5NA 4NCQA 2XM4A 2IOQA 2HJ3A 2RD9A 2QNLA 3RYLA 1Z3IX 3DAGA 1CPQA 4QI0A 1VK5A 1Q0MA 3M4CA 1LE4A 4PFOA 2XXAB 2AVKA 2DYSC 4B6IA 3IQ6A 3AG3C 4YN0B 2Z15A 4E18A 3J06A 1SZIA 3ZG1A 4KI2A 2E87A 2L7AA 4MTOA 4DBQA 1V54C 4YT2A 3EFOA 1YZAA 2IXMA 4C3DA 5IY5C 3KYIA 2HJMA 3Q7GA 4MVQA 3DWWA 4K1OA 3SEOA 3LS1A 4AE4B 4BJTA 3NKEA 3EHMA 1ZVZA 1A7VA 4CS8C 1GQAA 5L0IA 3O55A 2C03A 1Z5ZA 3DAFA 5HSWA 1EQ1A 3QVZA 3DM5A 2PF4E 3HNLA 3C8GD 1HMOA 3U9MA 3R2PA 3RF3A 3V7OA 1C17M 2W45A 3EQLF 1AEPA 1NSGB 3GWLA 1G5ZA 1PCXA 3WAQA 3OA1A 2X0CA 3K1IA 1G8XA 2V26A 3ZQVA 2KSFA 2DI3A 1PD0A 1OKKA 2AWCA 4JCZA 2YQYA 3EG9A 2EIJC 2OG2A 3F46A 1NZEA 2PP4A 3I5QA 2OJED 3CAXA 2XLDA 3LJBA 5T3WA 1HE9A 4E7ZA 3DI5A 1FMVA 1TFKB 2WB7A 1T01A 1Z63A 4HFFB 1QLEC 3HNKA 4CBEA 4YJWA 5L3QA 2XLEA 3KKBA 4DBRA 5F5FA 2A0BA 1Q0KA 3TOLA 3HNIA 4WABA 1WOLA 1T6UA 2J45A 5DQTA 2R25A 1MMNA 3KL4A 3I5PA 3CEXA 4PJLA 4EBKA 4OIRF 4ZLCA 5KYYA 2YRFA 1ZHTA 4EHPA 3FOPA 2LCHA 2Q9CA 1RCPA 1U0BB 1OCOC 5KYUB 3ABLC 1LI5A 1VMAA 5COMA 1NBBA 3GWNA 1MNEA 3B0PA 1V74B 1R5ID 3IQCA 2YVKA 4O79A 5HV9A 2L6GA 4PR9A 2PFDA 3AJMA 1JOGA 2DB4A 3ZC4A 5DLJA 3GM2A 4JW1A 2GDCA 2H8AA 2IYLD 3ZWIA 4CSAA 1VB5A 3JSZA 2EILC 4MQ9F 3UMKA 5L0GA 2XM0A 4QDLA 2OEVA 2J0WA 3JYHA 4K0DA 4MNDA 4ULWA 1TR2A 2M4EA 1FNTc 1HW1A 1WWPA 1LM3B 2R7TA 4JTAB 1KTMA 3K1HA 2FFHA 2UUHA 1OKKD 4RBNA 2G3VA 2L6HA 4IAQA 3T9OA 3GEHA 3RH3A 1ZYRF 1NU9C 2OKUA 2PNOA 2HKVA 2Y3HA 4U5FE 4HE8D 1APCA 2CGEA 4YT4A 2LQGA 2B0JA 3QTHA 4NTFA 5A6JA 2WZFA 2M64A 4DVZA 3V5YA 3HJCA 3Q6MA 3AG1C 3T4RA 1JPNA 1OW8A 1SF8A 3FVYA 1M6TA 2HS5A 2WL8A 3NMIA 4CS7A 3S28A 3HTKC 5JLIA 1BR4A 4C7OB 1MNDA 3ATPA 3HLZA 2ZXPA 3SXKA 2OEXA 5JRAA 4XLNF 2J9VA 3EGXA 3E9VA 3K6BA 2J9UA 5DS4A 4FESA 3CSKA 4JVSA 2DYRC 4NTAA 4OIQF 2B0HA 3NRHA 4L6RA 2Q7RA 3RIPA 4EBBA 1YYJA 2L81A 3IQTA 4A2NB 1I4YA 2ASRA 2HFIA 4MW8A 4N4WA 3TQOA 4LLEA 2H7VC 1E86A 2V3CC 4GEHA 4JTCB 4MVSA 3SXMA 4LDKA 4U9EA 3JYYA 1JAFA 2L6FA 1UFBA 1MMGA 1QPUA 4MVUA 3O6XA 4GYTA 3TD7A 3QZCA 3GEEA 4GQHA 2LSEA 2A1DD 1OXKA 2EPOA 1HE1A 2QY9A 1Y6DA 1QVXA 3LEOA 4IJJA 3K1IC 4X0RA 4P6IC 1VLSA 1QZXA 1OR3A 3JCUQ 3W2VA 1OW6A 5TJ5E 4CDYA 1XZQA 1WGWA 2PBEA 1N1CA 3KMIA 2MWQA 4J32B 2I8BA 3ZSUA 2KJGA 3HNJA 4U5BE 5E3CA 1AUEA 5BQGA 3L0IA 2NPUA 2R03A 3DD7A 1VYKA 3MFNA 3VM6A 2VCCA 3U9JA 5A69A 1D1AA 4U5CE 1SYQA 2GWWA 2Y69C 3EFOB 5DS6A 2AU5A 3RQFA 2J7PD 3G50A 3TJ5A 4A4AA 3AG2C 2LP4A 4Z9HA 3SNHA 2D5RB 3OWTA 4AX2A 3S0XA 1AVOB 2OQMA 2R7UA 2LK4A 4KNWA 4I3MA 1ZHWA 2IXNA 3AG4C 4IRUA 4KC9A 4MVMA 1M56C 2YLDA 2QLAA 4JC7A 4R32A 5D92A 5GPGB 3SZRA 1RKEA 4JRZA 3VRCA 1GS9A 1Z23A 2J0XA 3N0TA 4W8KA 3NG1A 3US6A 2YL7A 3W8IA 4YT8A 4IWBA 1ZU4A 3C18A 4CSAC 5K0IA 4YK5A 5BQHA 4J30B 3DJNB 1E83A 3KH2A 2LIGA 2O9XA 1D1CA 4J7YA 3BRJA 5F28E 2EIKC 1FR0A 3EG9B 1MQVA 4O6MA 4E0IA 2ZD9A 1YARO 3NMKA 2HSQA 4FX5A 1NFOA 3B9QA 3DE8A 2I15A 4N6HA 3W2WA 2XLVA 2C04A 5CI8A 3LS0A 3A9CA 2R9RB 5D91A 1TQGA 2A69F 2Y39A 1E2XA 4JIOA 4OD5A 1YAUO 5A6AA 1TWGA 3FOOA 5KYYB 5L0CA 3AGTA 1C03A 4O7GA 3BEHA 3JSEO 3X2QC 4CJGA 2IBFA 5AC4A 1SR2A 2ETSA 2R7VA 2XLMA 1T5OA 3LESA 2GA0A 2OCCC 3FMSA 3DMDA 5JUAA 1YLMA 1WN0A 3H2UA 5EGYA 2EIMC 4OIOF 3EGDA 3SXZA 3LNRA 1H6GA 1F1MA 4PJMA 1EI7A 1SMYF 4KNVA 1TWCA
chains in the Genus database with same CATH topology
2YL0A 1APCA 4ULVA 1CGOA 3M4BA 1CGNA 2BC5A 3IQ5A 5AGFA 3NMIA 1M6TA 3U8PA 5JLIA 1EKYA 4D4NA 256BA 2J8WA 5JRAA 4CDVA 2XL6A 5B3IA 3QW0A 5JVEA 1YYXA 2XLWA 2CCYA 4L6RA 2YKZA 1BBHA 2XLOA 1YZCA 3DE9A 4CDAA 1YYJA 2XM4A 3C63A 4N4WA 3QW1A 1E86A 1CPQA 3M4CA 4U9EA 1JAFA 4WGZA 4CIPA 1QPUA 3IQ6A 1E84A 4JEAA 2XL8A 3ZQYA 1YZAA 5JS5A 3ZTZA 2J9BA 4CX9A 4CDYA 1A7VA 1GQAA 4IB4A 3QVZA 2YLGA 2YL3A 3HNLA 3HNJA 2YLIA 4JKVA 3ZQVA 4IARA 4JEBA 4EIYA 2XLDA 4U9DA 3HNKA 4JE9A 2XLEA 2YLDA 2QLAA 3TOLA 3HNIA 3L1MA 3TOMA 3VRCA 1E85A 2YL7A 1QQ3A 3FOPA 1RCPA 1E83A 5JP7A 2XLHA 4WGYA 1NBBA 1MQVA 4CJOA 3NMKA 3QVYA 4D4XA 3DE8A 4N6HA 3C62A 2XLVA 3ZWIA 2YL1A 1S05A 5JSLA 2XM0A 3FOOA 4NC3A 3M15A 3NMJA 4CJGA 4ER9A 2XLMA 1CPRA 1LM3B 5JT4A 5JUAA 3ZTMA 4IAQA 3M79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YL0 A;  1APC A;  4ULV A;  1CGO A;  3M4B A;  1CGN A;  2BC5 A;  3IQ5 A;  5AGF A;  3NMI A;  1M6T A;  3U8P A;  5JLI A;  1EKY A;  4D4N A;  256B A;  2J8W A;  5JRA A;  4CDV A;  2XL6 A;  5B3I A;  3QW0 A;  5JVE A;  1YYX A;  2XLW A;  2CCY A;  4L6R A;  2YKZ A;  1BBH A;  2XLO A;  1YZC A;  3DE9 A;  4CDA A;  1YYJ A;  2XM4 A;  3C63 A;  4N4W A;  3QW1 A;  1E86 A;  1CPQ A;  3M4C A;  4U9E A;  1JAF A;  4WGZ A;  4CIP A;  1QPU A;  3IQ6 A;  1E84 A;  4JEA A;  2XL8 A;  3ZQY A;  1YZA A;  5JS5 A;  3ZTZ A;  2J9B A;  4CX9 A;  4CDY A;  1A7V A;  1GQA A;  4IB4 A;  3QVZ A;  2YLG A;  2YL3 A;  3HNL A;  3HNJ A;  2YLI A;  4JKV A;  3ZQV A;  4IAR A;  4JEB A;  4EIY A;  2XLD A;  4U9D A;  3HNK A;  4JE9 A;  2XLE A;  2YLD A;  2QLA A;  3TOL A;  3HNI A;  3L1M A;  3TOM A;  3VRC A;  1E85 A;  2YL7 A;  1QQ3 A;  3FOP A;  1RCP A;  1E83 A;  5JP7 A;  2XLH A;  4WGY A;  1NBB A;  1MQV A;  4CJO A;  3NMK A;  3QVY A;  4D4X A;  3DE8 A;  4N6H A;  3C62 A;  2XLV A;  3ZWI A;  2YL1 A;  1S05 A;  5JSL A;  2XM0 A;  3FOO A;  4NC3 A;  3M15 A;  3NMJ A;  4CJG A;  4ER9 A;  2XLM A;  1CPR A;  1LM3 B;  5JT4 A;  5JUA A;  3ZTM A;  4IAQ A;  3M79 A; 
#chains in the Genus database with same CATH topology
 1H9G A;  2ZXO A;  2NG1 A;  3L8I A;  3PCV A;  2A68 F;  3DKA A;  5B1B C;  3MLG A;  4ULV A;  2Y3D A;  1VTM P;  4E17 A;  1ZU5 A;  1TFO B;  2WVQ A;  3ABM C;  1CGN A;  2BC5 A;  2CNW A;  3G4Z A;  4N6C A;  4XEK A;  2WZL A;  3S9O A;  3DJU B;  3ZDL A;  3RKO F;  1NLX A;  1C02 A;  2G62 A;  2R7O A;  3LNM B;  5E3A A;  4D4N A;  3GM3 A;  2J8W A;  3B29 A;  2R02 A;  2G3K A;  3EHN A;  3FHD A;  3IHU A;  1T9K A;  1A0B A;  1OR2 A;  3MX3 A;  1JMW A;  4KBL A;  3V5Z A;  4MTG A;  2HV7 A;  3UGP A;  2F22 A;  2P1A A;  2XLW A;  2CCY A;  5CIV A;  2YKZ A;  3DZA A;  3GOD A;  2XLO A;  4XLP F;  3GEI A;  3B0V C;  4U5G A;  2BL2 A;  3C63 A;  5A6K A;  2HV6 A;  4AK9 A;  3C7J A;  5F5H A;  1K05 A;  3QW1 A;  2NUP A;  3VYW A;  1GM5 A;  3U3B A;  2W4B A;  2VAS A;  1O5H A;  3RFY A;  4JUR I;  4WGZ A;  4EWC A;  4ZLD A;  4OIP F;  4CIP A;  5KYN A;  1IZM A;  4G7Z F;  2PX3 A;  2Q9A A;  4JEA A;  1Z7Q c;  4HEA J;  1B68 A;  3U2L A;  2EPK X;  1WAS A;  2ZXR A;  5JS5 A;  4JTD B;  1JR8 A;  2L9J A;  3EGX B;  3K66 A;  2ZXW C;  1ZW2 A;  3JZ0 A;  5E2Q A;  2J9B A;  1CGM E;  2Y3B A;  4E0H A;  5BQI A;  3M1C B;  2FGY A;  2KK1 A;  4NQF A;  4MTF A;  3U3F A;  2OU6 A;  3JRT A;  4DJ9 A;  1YA7 O;  1M57 C;  1V4A A;  1D1B A;  2NUT A;  4XTK A;  4DOZ A;  4MVR A;  1H7I A;  4EBJ A;  4YWQ A;  4O6Y A;  3RW0 A;  3S90 A;  2YLI A;  3OEO A;  3NDB B;  1OXB A;  2RSE B;  1FFT C;  5B3S C;  1VOM A;  2CNW D;  2GFH A;  4LAC B;  1LIH A;  3SYN A;  1K04 A;  1YDI A;  3ASN C;  4IAR A;  3AQC A;  3EH2 A;  4PAC A;  2KQ9 A;  4XWJ A;  1J8M F;  1LE2 A;  1MMD A;  2YHS A;  4JEB A;  2QE9 A;  3TJ6 A;  1ZHZ A;  5L3V A;  5E33 A;  4NTB A;  2NSF A;  2R7Q A;  1LI7 A;  1NFN A;  2EPL X;  5AC5 A;  1ORS C;  3UMH A;  2LFF A;  3L1M A;  1E85 A;  5KYX A;  2JPU A;  3RQG A;  1XZP A;  2FAP B;  2HMZ A;  3UGO A;  1HW2 A;  1GGQ A;  1R4T A;  4DRJ B;  5FCL A;  1VYI A;  3TK0 A;  2KYH A;  3N24 A;  4PJN A;  5L0F A;  2A6H F;  4BEJ A;  4JJG A;  5KYW A;  3KYJ A;  4O6N A;  3C8G A;  3FDQ A;  3T6G B;  2YZS A;  4I1O B;  2IXP A;  2CDQ A;  3VAY A;  4CS9 A;  2WVO A;  3QVY A;  4K7B A;  4D4X A;  5L0H A;  2J9W A;  3LLI A;  4BJ6 A;  4WJ0 A;  3C62 A;  1TWA A;  1RJ9 A;  2J46 A;  4F4B A;  1A7E A;  1RKE B;  3A11 A;  1IW7 F;  2YL1 A;  4XPW A;  3DM9 B;  2XS1 A;  2QTV A;  1M2V A;  4PK4 A;  5JSL A;  3R7C A;  4JCH A;  4NC3 A;  1RXQ A;  3O10 A;  5COG A;  1L7C A;  2KGO A;  1BDJ B;  4U5E E;  5DQZ A;  4BG0 A;  2W4M A;  1LS4 A;  3L34 A;  3M15 A;  2KNH A;  3NMJ A;  4BJ5 A;  1CPR A;  4MW3 A;  3C8Z A;  4OD4 A;  1G4U S;  4OIN F;  2QUP A;  3HKK A;  3NYL A;  4Z9I A;  4W8P A;  1L3P A;  4ANJ A;  3B71 A;  4G0H A;  3ZTM A;  3LEV A;  3H65 A;  1D0X A;  4PFP A;  4FWV A;  2ZPA A;  4ONS A;  2HMQ A;  1KU2 A;  3FXH A;  3MYI A;  4XPX A;  3RVZ A;  1U89 A;  2MYS A;  1BR1 A;  3MYF A;  5CI9 A;  4XQ1 A;  2AP3 A;  2R7W A;  2XRH A;  3G4X A;  2XXA A;  3PDM P;  1T6I A;  2Q4F A;  3WOD F;  2A0U A;  1LVK A;  2AWY A;  4BEM J;  3ASO C;  1FTS A;  3U8P A;  4CIH A;  1EKY A;  3KPH A;  5B1A C;  4AL1 A;  1LPE A;  1KNY A;  2GAQ A;  1FAP B;  1NG1 A;  3FAP B;  3RVY A;  3MBG A;  2H7O A;  2HZ8 A;  4AE4 A;  4QI2 A;  2EIN C;  4Q4Z F;  3EGD B;  3QW0 A;  5JVE A;  1Q0F A;  1UG7 A;  1W2W A;  4C3E A;  3O39 A;  4G7O F;  1BBH A;  1G4W R;  2VC9 A;  3DE9 A;  5EK0 A;  1TKN A;  4CDA A;  2IXO A;  1RMV A;  4MVO A;  2PX0 A;  3LLK A;  4G78 A;  3U0C A;  2VH3 A;  1H9T A;  1HMD A;  2CW0 F;  3GAN A;  4XEF A;  2R7X A;  3SXY A;  2VCA A;  1YJG A;  5DVW A;  3U2M A;  1ST6 A;  3EZH A;  1E84 A;  3UMI A;  1S7Z A;  3K7D A;  4H54 A;  4YL3 A;  2LFD A;  1WTY A;  4AL0 A;  2XL8 A;  5A6B A;  5DS5 A;  4Z9J A;  2HUJ A;  3ZQY A;  1HY5 A;  2KW3 C;  3ZVR A;  2R7R A;  2P7V A;  2TMV P;  3ZTZ A;  1MMA A;  2YEV A;  1XWJ A;  3AQB A;  1U6H A;  3X1O A;  4CX9 A;  4IAO A;  4NY3 A;  1Z6A A;  4C3B A;  4U5H A;  3B0U X;  2XS8 A;  4Q5S F;  1OCC C;  1Q0D A;  1FMW A;  2HSB A;  5L0J A;  1ZHX A;  3E70 C;  3ITF A;  4IB4 A;  4BJ1 A;  3ABK C;  1EA8 A;  2YLG A;  2YL3 A;  4H4K C;  3NKD A;  4I44 A;  4YT5 A;  1M2O A;  4IGG A;  1BR2 A;  4EKW A;  2NUP B;  3AGU A;  4P9F A;  4E7S A;  2OJQ A;  1A7D A;  3IEE A;  2YWA A;  2H7B A;  1TWH A;  3U8V A;  2A6E F;  4DRH B;  4JKV A;  3H2V A;  2P6V A;  3Q6N A;  1VLT A;  5KYU A;  2Q9B A;  3LAY A;  2XL4 A;  1J8Y F;  4YL0 A;  4CS8 A;  4JZA A;  3ZIB A;  3GOR A;  4HFK B;  4M63 A;  3UNG C;  4EIY A;  1PV3 A;  3T6J A;  3LUT B;  3QMK A;  3WHN A;  3PHF 2;  3EH1 A;  4U9D A;  1ORY A;  3POV A;  4JE9 A;  4J7T A;  4MVZ A;  4XPY A;  3WG7 C;  4DVY P;  4CS9 C;  1JRA A;  3TOM A;  1ZZP A;  1NU7 D;  1JPJ A;  3ECS A;  5L0D A;  2Q3T A;  4BJ6 C;  2NUT B;  5EHH A;  1LKX A;  4FAP B;  2BE5 F;  1PD1 A;  2IM8 A;  3I4U A;  2WZG A;  1D0Y A;  3PMR A;  1QQ3 A;  1DOW A;  4Q7C A;  3EZI A;  4BPM A;  2ICW G;  2LD6 A;  3K33 A;  2R05 A;  5JP7 A;  2XLH A;  3F47 A;  1RKC A;  2Q00 A;  4WGY A;  3W8H A;  5A6B D;  4CJO A;  4LER A;  4N06 A;  3EPV A;  4BJ5 C;  4P9T A;  2EPM X;  4RD9 A;  1LS1 A;  2JD3 A;  4LDR A;  3FAJ A;  1V55 C;  4LLC A;  1ORJ A;  3VF0 A;  2JX0 A;  3NYM A;  2UUI A;  2VB6 A;  3V5X A;  1WAT A;  2J7P A;  5KYX B;  1OW7 A;  1S05 A;  2NSG A;  5T1D B;  1O87 A;  3IPM O;  2KC3 A;  3JRM O;  3JT1 A;  4YL1 A;  4C7O A;  1OCR C;  3U5S A;  4DRI B;  4ER9 A;  1OQC A;  4MS2 A;  5KYW B;  4LDQ A;  4DXW A;  5JT4 A;  3L8J A;  3C8G B;  3Q7L A;  3CQZ A;  3SP1 A;  3UR3 C;  2EPN A;  2Y3G A;  2DGJ A;  3JTL O;  3S29 A;  1QKR A;  1K40 A;  3M79 A;  1ZHY A;  4XEV A;  3DXJ F;  3S84 A;  3T6B A;  4JJF A;  1Y4C A;  1BZ4 A;  2MHR A;  2XSE A;  2CYD A;  2YL0 A;  4RDA A;  5COF A;  1ZW3 A;  2P61 A;  2X51 A;  3CZ6 A;  1RJ9 B;  1CGO A;  4UDV A;  2R7S A;  3EJN A;  4G7H F;  1D0Z A;  1O3U A;  1OCZ C;  3M4B A;  3N2Z B;  3TUL A;  3RQE A;  1M2V B;  4PJJ A;  1T6Q A;  3NYJ A;  3IQ5 A;  3GM1 A;  2OOC A;  5AGF A;  4EUK B;  2WVN A;  1DOV A;  4I1M A;  5FZT A;  3S27 A;  5BUO A;  4U5D E;  256B A;  1YVI A;  3W4Y A;  1YA9 A;  2VCB A;  4CDV A;  3AOU A;  5T3T A;  2XL6 A;  2P0N A;  1I4Z A;  5B3I A;  1A41 A;  1Q0G A;  2D4U A;  1QSP A;  2W9Y A;  1FFH A;  1YYX A;  1YZC A;  1I5N A;  4NCQ A;  2XM4 A;  2IOQ A;  2HJ3 A;  2RD9 A;  2QNL A;  3RYL A;  1Z3I X;  3DAG A;  1CPQ A;  4QI0 A;  1VK5 A;  1Q0M A;  3M4C A;  1LE4 A;  4PFO A;  2XXA B;  2AVK A;  2DYS C;  4B6I A;  3IQ6 A;  3AG3 C;  4YN0 B;  2Z15 A;  4E18 A;  3J06 A;  1SZI A;  3ZG1 A;  4KI2 A;  2E87 A;  2L7A A;  4MTO A;  4DBQ A;  1V54 C;  4YT2 A;  3EFO A;  1YZA A;  2IXM A;  4C3D A;  5IY5 C;  3KYI A;  2HJM A;  3Q7G A;  4MVQ A;  3DWW A;  4K1O A;  3SEO A;  3LS1 A;  4AE4 B;  4BJT A;  3NKE A;  3EHM A;  1ZVZ A;  1A7V A;  4CS8 C;  1GQA A;  5L0I A;  3O55 A;  2C03 A;  1Z5Z A;  3DAF A;  5HSW A;  1EQ1 A;  3QVZ A;  3DM5 A;  2PF4 E;  3HNL A;  3C8G D;  1HMO A;  3U9M A;  3R2P A;  3RF3 A;  3V7O A;  1C17 M;  2W45 A;  3EQL F;  1AEP A;  1NSG B;  3GWL A;  1G5Z A;  1PCX A;  3WAQ A;  3OA1 A;  2X0C A;  3K1I A;  1G8X A;  2V26 A;  3ZQV A;  2KSF A;  2DI3 A;  1PD0 A;  1OKK A;  2AWC A;  4JCZ A;  2YQY A;  3EG9 A;  2EIJ C;  2OG2 A;  3F46 A;  1NZE A;  2PP4 A;  3I5Q A;  2OJE D;  3CAX A;  2XLD A;  3LJB A;  5T3W A;  1HE9 A;  4E7Z A;  3DI5 A;  1FMV A;  1TFK B;  2WB7 A;  1T01 A;  1Z63 A;  4HFF B;  1QLE C;  3HNK A;  4CBE A;  4YJW A;  5L3Q A;  2XLE A;  3KKB A;  4DBR A;  5F5F A;  2A0B A;  1Q0K A;  3TOL A;  3HNI A;  4WAB A;  1WOL A;  1T6U A;  2J45 A;  5DQT A;  2R25 A;  1MMN A;  3KL4 A;  3I5P A;  3CEX A;  4PJL A;  4EBK A;  4OIR F;  4ZLC A;  5KYY A;  2YRF A;  1ZHT A;  4EHP A;  3FOP A;  2LCH A;  2Q9C A;  1RCP A;  1U0B B;  1OCO C;  5KYU B;  3ABL C;  1LI5 A;  1VMA A;  5COM A;  1NBB A;  3GWN A;  1MNE A;  3B0P A;  1V74 B;  1R5I D;  3IQC A;  2YVK A;  4O79 A;  5HV9 A;  2L6G A;  4PR9 A;  2PFD A;  3AJM A;  1JOG A;  2DB4 A;  3ZC4 A;  5DLJ A;  3GM2 A;  4JW1 A;  2GDC A;  2H8A A;  2IYL D;  3ZWI A;  4CSA A;  1VB5 A;  3JSZ A;  2EIL C;  4MQ9 F;  3UMK A;  5L0G A;  2XM0 A;  4QDL A;  2OEV A;  2J0W A;  3JYH A;  4K0D A;  4MND A;  4ULW A;  1TR2 A;  2M4E A;  1FNT c;  1HW1 A;  1WWP A;  1LM3 B;  2R7T A;  4JTA B;  1KTM A;  3K1H A;  2FFH A;  2UUH A;  1OKK D;  4RBN A;  2G3V A;  2L6H A;  4IAQ A;  3T9O A;  3GEH A;  3RH3 A;  1ZYR F;  1NU9 C;  2OKU A;  2PNO A;  2HKV A;  2Y3H A;  4U5F E;  4HE8 D;  1APC A;  2CGE A;  4YT4 A;  2LQG A;  2B0J A;  3QTH A;  4NTF A;  5A6J A;  2WZF A;  2M64 A;  4DVZ A;  3V5Y A;  3HJC A;  3Q6M A;  3AG1 C;  3T4R A;  1JPN A;  1OW8 A;  1SF8 A;  3FVY A;  1M6T A;  2HS5 A;  2WL8 A;  3NMI A;  4CS7 A;  3S28 A;  3HTK C;  5JLI A;  1BR4 A;  4C7O B;  1MND A;  3ATP A;  3HLZ A;  2ZXP A;  3SXK A;  2OEX A;  5JRA A;  4XLN F;  2J9V A;  3EGX A;  3E9V A;  3K6B A;  2J9U A;  5DS4 A;  4FES A;  3CSK A;  4JVS A;  2DYR C;  4NTA A;  4OIQ F;  2B0H A;  3NRH A;  4L6R A;  2Q7R A;  3RIP A;  4EBB A;  1YYJ A;  2L81 A;  3IQT A;  4A2N B;  1I4Y A;  2ASR A;  2HFI A;  4MW8 A;  4N4W A;  3TQO A;  4LLE A;  2H7V C;  1E86 A;  2V3C C;  4GEH A;  4JTC B;  4MVS A;  3SXM A;  4LDK A;  4U9E A;  3JYY A;  1JAF A;  2L6F A;  1UFB A;  1MMG A;  1QPU A;  4MVU A;  3O6X A;  4GYT A;  3TD7 A;  3QZC A;  3GEE A;  4GQH A;  2LSE A;  2A1D D;  1OXK A;  2EPO A;  1HE1 A;  2QY9 A;  1Y6D A;  1QVX A;  3LEO A;  4IJJ A;  3K1I C;  4X0R A;  4P6I C;  1VLS A;  1QZX A;  1OR3 A;  3JCU Q;  3W2V A;  1OW6 A;  5TJ5 E;  4CDY A;  1XZQ A;  1WGW A;  2PBE A;  1N1C A;  3KMI A;  2MWQ A;  4J32 B;  2I8B A;  3ZSU A;  2KJG A;  3HNJ A;  4U5B E;  5E3C A;  1AUE A;  5BQG A;  3L0I A;  2NPU A;  2R03 A;  3DD7 A;  1VYK A;  3MFN A;  3VM6 A;  2VCC A;  3U9J A;  5A69 A;  1D1A A;  4U5C E;  1SYQ A;  2GWW A;  2Y69 C;  3EFO B;  5DS6 A;  2AU5 A;  3RQF A;  2J7P D;  3G50 A;  3TJ5 A;  4A4A A;  3AG2 C;  2LP4 A;  4Z9H A;  3SNH A;  2D5R B;  3OWT A;  4AX2 A;  3S0X A;  1AVO B;  2OQM A;  2R7U A;  2LK4 A;  4KNW A;  4I3M A;  1ZHW A;  2IXN A;  3AG4 C;  4IRU A;  4KC9 A;  4MVM A;  1M56 C;  2YLD A;  2QLA A;  4JC7 A;  4R32 A;  5D92 A;  5GPG B;  3SZR A;  1RKE A;  4JRZ A;  3VRC A;  1GS9 A;  1Z23 A;  2J0X A;  3N0T A;  4W8K A;  3NG1 A;  3US6 A;  2YL7 A;  3W8I A;  4YT8 A;  4IWB A;  1ZU4 A;  3C18 A;  4CSA C;  5K0I A;  4YK5 A;  5BQH A;  4J30 B;  3DJN B;  1E83 A;  3KH2 A;  2LIG A;  2O9X A;  1D1C A;  4J7Y A;  3BRJ A;  5F28 E;  2EIK C;  1FR0 A;  3EG9 B;  1MQV A;  4O6M A;  4E0I A;  2ZD9 A;  1YAR O;  3NMK A;  2HSQ A;  4FX5 A;  1NFO A;  3B9Q A;  3DE8 A;  2I15 A;  4N6H A;  3W2W A;  2XLV A;  2C04 A;  5CI8 A;  3LS0 A;  3A9C A;  2R9R B;  5D91 A;  1TQG A;  2A69 F;  2Y39 A;  1E2X A;  4JIO A;  4OD5 A;  1YAU O;  5A6A A;  1TWG A;  3FOO A;  5KYY B;  5L0C A;  3AGT A;  1C03 A;  4O7G A;  3BEH A;  3JSE O;  3X2Q C;  4CJG A;  2IBF A;  5AC4 A;  1SR2 A;  2ETS A;  2R7V A;  2XLM A;  1T5O A;  3LES A;  2GA0 A;  2OCC C;  3FMS A;  3DMD A;  5JUA A;  1YLM A;  1WN0 A;  3H2U A;  5EGY A;  2EIM C;  4OIO F;  3EGD A;  3SXZ A;  3LNR A;  1H6G A;  1F1M A;  4PJM A;  1EI7 A;  1SMY F;  4KNV A;  1TWC A; 
#chains in the Genus database with same CATH homology
 2YL0 A;  1APC A;  4ULV A;  1CGO A;  3M4B A;  1CGN A;  2BC5 A;  3IQ5 A;  5AGF A;  3NMI A;  1M6T A;  3U8P A;  5JLI A;  1EKY A;  4D4N A;  256B A;  2J8W A;  5JRA A;  4CDV A;  2XL6 A;  5B3I A;  3QW0 A;  5JVE A;  1YYX A;  2XLW A;  2CCY A;  4L6R A;  2YKZ A;  1BBH A;  2XLO A;  1YZC A;  3DE9 A;  4CDA A;  1YYJ A;  2XM4 A;  3C63 A;  4N4W A;  3QW1 A;  1E86 A;  1CPQ A;  3M4C A;  4U9E A;  1JAF A;  4WGZ A;  4CIP A;  1QPU A;  3IQ6 A;  1E84 A;  4JEA A;  2XL8 A;  3ZQY A;  1YZA A;  5JS5 A;  3ZTZ A;  2J9B A;  4CX9 A;  4CDY A;  1A7V A;  1GQA A;  4IB4 A;  3QVZ A;  2YLG A;  2YL3 A;  3HNL A;  3HNJ A;  2YLI A;  4JKV A;  3ZQV A;  4IAR A;  4JEB A;  4EIY A;  2XLD A;  4U9D A;  3HNK A;  4JE9 A;  2XLE A;  2YLD A;  2QLA A;  3TOL A;  3HNI A;  3L1M A;  3TOM A;  3VRC A;  1E85 A;  2YL7 A;  1QQ3 A;  3FOP A;  1RCP A;  1E83 A;  5JP7 A;  2XLH A;  4WGY A;  1NBB A;  1MQV A;  4CJO A;  3NMK A;  3QVY A;  4D4X A;  3DE8 A;  4N6H A;  3C62 A;  2XLV A;  3ZWI A;  2YL1 A;  1S05 A;  5JSL A;  2XM0 A;  3FOO A;  4NC3 A;  3M15 A;  3NMJ A;  4CJG A;  4ER9 A;  2XLM A;  1CPR A;  1LM3 B;  5JT4 A;  5JUA A;  3ZTM A;  4IAQ A;  3M79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...