1E84A

Cytochrome c' from alcaligenes xylosoxidans - reduced structure
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Unprecedented Proximal Binding of Nitric Oxide to Heme: Implications for Guanylate Cyclase
pubmed doi rcsb
molecule tags Electron transport
total genus 49
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2000-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1e84A00
5JT4A 4WGZA 2J9BA 4D4XA 1GQAA 5JVEA 1QPUA 5JRAA 3M4CA 1LM3B 1YZAA 4D4NA 4JE9A 1QQ3A 3NMKA 3ZTZA 5JS5A 4CJGA 2XM0A 3IQ6A 4IB4A 2CCYA 3ZTMA 1JAFA 2YL1A 3M15A 1S05A 3QVZA 3HNJA 1CPQA 2YLDA 2XLMA 3ZWIA 3TOMA 4JKVA 3QW0A 2YLIA 3VRCA 2XLEA 1M6TA 4JEAA 3ZQYA 3QW1A 3FOPA 1E84A 4CDVA 1CPRA 4U9DA 4ER9A 2XM4A 3HNKA 3HNLA 3NMJA 2XLWA 4U9EA 3DE9A 4IARA 1APCA 2BC5A 3C63A 2J8WA 2XLVA 2XLHA 5B3IA 5JLIA 2YL3A 3TOLA 4CDAA 1BBHA 2XLOA 4N6HA 4CDYA 3IQ5A 1YYJA 3ZQVA 1NBBA 3FOOA 4NC3A 4WGYA 3QVYA 4CIPA 4JEBA 1E85A 1CGNA 4CJOA 2XL6A 2XLDA 3L1MA 2YL7A 2QLAA 1MQVA 4L6RA 3HNIA 2YL0A 5AGFA 3M4BA 4IAQA 2YKZA 3C62A 1YYXA 1YZCA 4EIYA 2YLGA 3M79A 5JSLA 4ULVA 3DE8A 5JUAA 1E86A 5JP7A 3U8PA 256BA 1EKYA 1RCPA 2XL8A 4CX9A 3NMIA 4N4WA 1CGOA 1A7VA 1E83A
chains in the Genus database with same CATH superfamily
1LPEA 3HKKA 1D0ZA 1FAPB 1FMWA 4MW8A 1J8MF 3LEOA 3K7DA 4CIHA 2R7RA 2Q9BA 2XXAA 2DYSC 3O39A 3FHDA 1LM3B 3O10A 3K33A 4O6YA 3B29A 1FR0A 4C7OB 4U5GA 1MMAA 3J06A 4R32A 1QQ3A 3C8ZA 4HFKB 4ANJA 4EBBA 1QVXA 3IQ6A 4IB4A 4OINF 4UDVA 4Q7CA 4ONSA 3NYJA 3GM3A 1MMDA 1JRAA 3EG9A 2Q9AA 2YL1A 2HKVA 4W8PA 2IXMA 3QVZA 2CGEA 3ABLC 4HE8D 3WAQA 1M2OA 2Q9CA 2MHRA 2NUTA 2J9WA 3RQGA 5A6AA 2KW3C 4BG0A 3LEVA 2YRFA 3LLKA 4YT5A 5AC4A 1YAUO 4O6NA 3L0IA 3VF0A 3QTHA 2AVKA 1OR3A 2GA0A 2EPNA 1SR2A 2CNWD 2V3CC 3TK0A 2LFFA 2WL8A 2VCCA 4J30B 5KYWB 1PD1A 4QI2A 2LCHA 3FOPA 4MS2A 5A6BD 4O79A 2V26A 4U5BE 3GEHA 4XWJA 3E9VA 4AL1A 3DJUB 4CDVA 5CI8A 1U89A 3CQZA 3U8VA 2OOCA 3DD7A 3FMSA 4ER9A 3ITFA 4C7OA 2R9RB 3SXKA 5L0HA 2R7OA 2XLWA 3RFYA 2LQGA 4LDRA 3SXMA 4EBJA 2H7VC 3QMKA 4BJTA 1APCA 3C63A 2JPUA 2XLVA 2EIJC 2ZXWC 3TD7A 2EIKC 3DKAA 4DOZA 3K6BA 5A6KA 4DRIB 5B3IA 4XLPF 3FVYA 1BBHA 1AUEA 5GPGB 4X0RA 2XLOA 3S27A 4N6HA 2P0NA 4DVZA 1T6IA 4U5CE 3IQ5A 3L34A 3U2LA 4C3DA 3T6JA 4YL1A 2WZFA 3K1IA 1M2VB 4NC3A 4WGYA 4XQ1A 4PFOA 5DLJA 5IY5C 2ZPAA 4A2NB 3U3FA 1E85A 1VB5A 1SF8A 3C18A 2Q3TA 4IWBA 4Z9IA 2XL6A 3A11A 3F47A 4PJNA 5KYWA 3JYYA 3POVA 1OXBA 3I5QA 1G8XA 1VK5A 5COGA 3B0VC 2VCBA 2A6HF 1MQVA 2IYLD 4XPXA 4YL0A 4DRHB 1ZZPA 4BJ5C 2YL0A 3UNGC 3LJBA 1L3PA 5CIVA 5BQIA 4KBLA 3RVZA 1C03A 2R7XA 3U3BA 3B71A 3ZSUA 4DRJB 1I5NA 1K04A 3CSKA 3KL4A 4EKWA 4EIYA 3IEEA 3Q7GA 3DAGA 3VYWA 5JSLA 4ULVA 3SYNA 3SZRA 1NSGB 4ULWA 4PFPA 2L81A 4Z9JA 3GEIA 4PJJA 2ICWG 3AG2C 4E0HA 1XZPA 3KPHA 1FFHA 2R7UA 3W2WA 3H2UA 2OCCC 2IOQA 3U8PA 3DI5A 4DVYP 1EKYA 2KK1A 2Z15A 3EFOB 3ASOC 3K1HA 2I8BA 4N4WA 4P9TA 1CGOA 2AWCA 1FFTC 4LACB 4MNDA 2OKUA 4U5HA 4BEMJ 5DQTA 2GDCA 4WGZA 2DYRC 1WASA 2J9BA 1VYIA 1DOWA 2MYSA 2W45A 1GQAA 4I1OB 4D4XA 3MYIA 2A6EF 3UMIA 1D0YA 3V5XA 2R7WA 1GS9A 2AWYA 1CGME 4OIOF 2G3KA 2DB4A 5JRAA 4G7ZF 4FWVA 1YARO 5T3WA 3U9JA 4E7SA 1YDIA 2EPKX 1YZAA 2CW0F 4JC7A 3LNMB 1E2XA 1TQGA 5JS5A 1YA9A 2XS1A 1Z7Qc 2W9YA 2XM0A 4H4KC 4MVUA 4JCHA 4CJGA 2CCYA 3GEEA 5KYYB 2QUPA 1JMWA 3PHF2 1PCXA 3DMDA 3S9OA 5CI9A 2P7VA 3PCVA 3UR3C 2QY9A 3ZDLA 4LDKA 5TJ5E 3TJ5A 1ZHYA 1FNTc 3DZAA 1ZHWA 5D92A 3TOMA 3S84A 4KNWA 4C3BA 3EZIA 2C04A 1Y4CA 3EFOA 4JKVA 2UUHA 1H9GA 1D1AA 1JR8A 1MMNA 2A0UA 3EGDB 2YLIA 4JTCB 4PJLA 2J46A 4LDQA 4PACA 4LERA 1JPJA 4IGGA 4JURI 2YQYA 1AEPA 3Q6NA 2XRHA 2BL2A 3NDBB 1Q0KA 3EZHA 2J7PA 2YVKA 2EPOA 3QW1A 3WODF 1E84A 5DS5A 2R25A 1OW7A 2IXPA 3F46A 2XSEA 1CPRA 2F22A 2KGOA 3B9QA 4MVSA 4XPWA 4Z9HA 1NG1A 1A7EA 3HNKA 3HNLA 3NMJA 1BZ4A 1UFBA 1MMGA 3PMRA 3RF3A 2WVQA 4U9EA 1BR1A 2J9UA 2XL4A 4YL3A 4IRUA 3JSZA 5L0CA 1V74B 1HW1A 1OXKA 3DE9A 2L9JA 3AGUA 4IARA 3DJNB 3ATPA 4YN0B 3TJ6A 4C3EA 1LI5A 1W2WA 3LLIA 1YA7O 2G62A 3ABMC 3KKBA 3US6A 3ZG1A 4MW3A 4P6IC 3EJNA 5A69A 1S7ZA 1PD0A 2NSGA 4CDYA 3BEHA 4XLNF 3AQCA 1OCCC 3G4ZA 4CIPA 3R2PA 4XPYA 4DBQA 2Y3BA 1NBBA 1V4AA 1SZIA 3FOOA 3VAYA 1Z23A 1ZU4A 2O9XA 1NFNA 3AG3C 3T6GB 3E70C 3EGDA 3QVYA 3FXHA 1VLTA 3NYMA 3M1CB 2EPMX 2GWWA 3UMKA 5KYUB 2IXNA 1EQ1A 1JOGA 2E87A 1OW8A 1WTYA 2UUIA 4G7HF 2W4BA 4OIPF 4JRZA 2M64A 1Q0GA 3EH1A 3SEOA 1N1CA 1LIHA 2YL7A 1AVOB 2QLAA 2MWQA 4A4AA 4L6RA 3KYJA 3L8JA 3ZIBA 4DXWA 5AGFA 4E0IA 2R7QA 1TFOB 1HW2A 4JCZA 3N0TA 4IJJA 2Y39A 1VYKA 2GAQA 2HMZA 3AG1C 3N2ZB 4G78A 4QDLA 5COFA 4F4BA 1ZW3A 3NKDA 4JJGA 4OIQF 3DE8A 1NLXA 2CDQA 3FAJA 5DVWA 1OKKA 2RSEB 4CS9C 1NU9C 4BJ5A 2Y3HA 2WZGA 1E86A 1VLSA 2HS5A 2VC9A 3GM1A 1TR2A 3LNRA 3S0XA 2R7TA 2ZXPA 5B3SC 3V5ZA 1T6UA 1SYQA 256BA 3C8GB 5JP7A 1DOVA 2RD9A 2XL8A 3T6BA 4CX9A 4ZLDA 1R5ID 3NMIA 4JTDB 1A7VA 1E83A 3KYIA 4WJ0A 5BQHA 4KI2A 1TWHA 5KYUA 2JD3A 5T1DB 4MVMA 1RJ9B 1K05A 1T01A 1TWAA 3DXJF 1QPUA 2EILC 4JTAB 3GWLA 1BR2A 5F5FA 1B68A 4JW1A 3DM5A 4CS8A 1G4US 1RKEB 5K0IA 4U5FE 1UG7A 4IAOA 2LD6A 3GODA 3JT1A 4BJ1A 1MNDA 4N6CA 3EQLF 2Y3GA 5B1AC 1H7IA 4DBRA 1YLMA 3G50A 5FZTA 1MNEA 2H7BA 4OD5A 1Q0FA 4MTOA 4MTFA 1S05A 2OU6A 1M2VA 3QZCA 1A41A 3U5SA 3UGPA 4CS8C 3GWNA 5L0DA 2LP4A 2XLMA 4JJFA 2HV6A 4W8KA 4CS7A 1Z63A 4GQHA 2IBFA 2PP4A 3GM2A 5F28E 3R7CA 1KTMA 2YWAA 3C8GA 4K0DA 1WGWA 2J45A 1U6HA 5AC5A 2HFIA 3C7JA 3QW0A 2XLEA 3NG1A 4KNVA 2ASRA 2D5RB 3N24A 4O6MA 1O87A 1A0BA 4M63A 4JEAA 4DJ9A 4EUKB 3NKEA 3W8HA 3ZQYA 4CBEA 2ZD9A 1RJ9A 2Q7RA 3U0CA 2WVOA 3CZ6A 1OCRC 3FAPB 4OIRF 2VB6A 3MX3A 4JZAA 1LS1A 2WVNA 3LS1A 3Q6MA 1M57C 1KU2A 2KNHA 4U9DA 2KC3A 4B6IA 1RKEA 1D1BA 1WN0A 2DGJA 3IQTA 4YJWA 3RYLA 1I4YA 4MVOA 2P1AA 2VH3A 3I5PA 1NU7D 3KH2A 1FMVA 3SP1A 4K7BA 2M4EA 1C02A 2JX0A 4RDAA 5T3TA 2BC5A 2YEVA 2KJGA 5E3AA 3DWWA 1OCZC 3TULA 2J8WA 3U9MA 4CSAC 5BQGA 5JLIA 4PR9A 2WZLA 1WWPA 1IW7F 2YL3A 3W8IA 4CDAA 5L0IA 2VASA 4XTKA 1QLEC 1XWJA 1OQCA 3V7OA 3ZVRA 3CAXA 2WB7A 2J7PD 1A7DA 2LSEA 3EG9B 1YYJA 3BRJA 2ETSA 3ZQVA 2HJ3A 1HMOA 5DS4A 1QSPA 1XZQA 4EHPA 2PF4E 4YT8A 1V55C 4AE4B 4I3MA 3RH3A 3L8IA 2IXOA 4JEBA 2ZXRA 1CGNA 2R7SA 1HE1A 2NUPB 2HZ8A 1LI7A 3AGTA 3T9OA 1GGQA 3Q7LA 1ZU5A 4MQ9F 5HV9A 2LFDA 4WABA 5KYYA 3JSEO 2J0XA 3MBGA 2YZSA 3A9CA 2QNLA 3JRMO 1WATA 2A69F 4FX5A 4AX2A 1VOMA 2KQ9A 4YT2A 1TWGA 2Q4FA 2YKZA 5EK0A 4XEKA 1Y6DA 1YYXA 3O55A 1H6GA 1LE2A 2L6GA 2YLGA 3IQCA 3M79A 3DM9B 1O5HA 1D1CA 3DAFA 1Z6AA 3JCUQ 2NPUA 3G4XA 4EWCA 3AJMA 2FAPB 2B0JA 2AP3A 4MVRA 4YT4A 5KYXB 4J32B 1L7CA 3H65A 2HMQA 1LE4A 2PBEA 5D91A 5E33A 4YWQA 3LUTB 5B1BC 5L0JA 2H8AA 3AOUA 1RCPA 2C03A 5L0FA 2X51A 4GYTA 4AE4A 2H7OA 5BUOA 2KSFA 2HV7A 1ZVZA 2D4UA 4YK5A 3B0PA 3SNHA 1VMAA 2NUPA 4BJ6A 4CS9A 3AQBA 3T4RA 4E7ZA 5JT4A 1BDJB 2KYHA 2DI3A 2A0BA 4QI0A 1IZMA 5DQZA 3S28A 5JVEA 1C17M 3UGOA 3FDQA 1J8YF 1TWCA 2AU5A 3M4CA 4J7YA 4Q5SF 1OKKD 2I15A 1RXQA 1Z3IX 1LS4A 5DS6A 3TQOA 3UMHA 3X1OA 2Q00A 4JIOA 4D4NA 3JTLO 4JE9A 2FGYA 3NMKA 3ZTZA 1F1MA 3EHMA 3IPMO 2CNWA 4BJ6C 3ZTMA 3LAYA 2R7VA 2R03A 3IHUA 3EH2A 1JAFA 2OJED 3NRHA 3OEOA 3RIPA 3M15A 5A6BA 4I44A 2J9VA 3HLZA 3MFNA 4XEFA 3HNJA 5EHHA 5KYXA 3H2VA 1CPQA 2W4MA 2LK4A 2YLDA 1WOLA 2XS8A 3ZWIA 4MVQA 2BE5F 2CYDA 2OG2A 3OWTA 1D0XA 3RVYA 3WG7C 1YJGA 3I4UA 4FAPB 4J7TA 3EPVA 4XEVA 4G7OF 4ZLCA 3ECSA 4NTFA 2Y3DA 1Z5ZA 1M56C 2GFHA 3OA1A 2J0WA 3VRCA 4BEJA 1GM5A 5E3CA 5COMA 2L6FA 3RW0A 1M6TA 1QKRA 3JRTA 2OJQA 4CSAA 1V54C 3MYFA 2IM8A 1U0BB 1BR4A 1ORYA 5E2QA 1ZHXA 3SXYA 4O7GA 1T6QA 3GORA 2TMVP 1ORJA 3VM6A 5FCLA 2Y69C 1Q0DA 4NTBA 3NYLA 3ABKC 2HSBA 1H9TA 1G5ZA 1PV3A 2XM4A 3EHNA 3HJCA 1T9KA 1SMYF 5L3QA 1LKXA 3SXZA 3W2VA 1JPNA 4KC9A 1ORSC 3K1IC 3S29A 3C8GD 3LS0A 2HJMA 3S90A 4GEHA 4H54A 2G3VA 4P9FA 3EGXB 4E18A 4MVZA 2B0HA 2OEXA 2XLHA 2R02A 4G0HA 3CEXA 4NCQA 5A6JA 5KYNA 3TOLA 1EI7A 2PX3A 2EIMC 4I1MA 5L0GA 1RMVA 3ZC4A 2LIGA 1ZHTA 1ZYRF 2L6HA 5HSWA 1YVIA 1RKCA 2X0CA 2PX0A 1TFKB 1NZEA 4LLCA 4AK9A 1ZW2A 1EA8A 3O6XA 1I4ZA 4NTAA 1TKNA 1LVKA 1KNYA 1NFOA 2L7AA 2OQMA 2OEVA 4NY3A 4RD9A 4RBNA 2QTVA 2PFDA 3MLGA 4PK4A 4CJOA 2ZXOA 2XLDA 4MTGA 4JVSA 2QE9A 3L1MA 4N06A 2PNOA 4OD4A 3K66A 1VTMP 2YHSA 4NQFA 2XXAB 2P61A 3AG4C 4K1OA 3W4YA 2R05A 4FESA 2HUJA 4E17A 1FTSA 3HNIA 4AL0A 2NSFA 1ZHZA 2EINC 2A1DD 3M4BA 4IAQA 3X2QC 2VCAA 4U5EE 3KMIA 3RKOF 5F5HA 3C62A 5EGYA 1HY5A 1G4WR 1YZCA 3JYHA 2FFHA 3LESA 2HSQA 3U2MA 1HE9A 1QZXA 3EGXA 3WHNA 1OCOC 3ASNC 4EBKA 3PDMP 5JUAA 1O3UA 3RQFA 1OR2A 1T5OA 3RQEA 4HFFB 3HTKC 1ST6A 3B0UX 4BPMA 4PJMA 5L3VA 1OW6A 2NUTB 4LLEA 3V5YA 2A68F 4Q4ZF 3JZ0A 1K40A 1R4TA 1HMDA 2EPLX 1Q0MA 2P6VA 4U5DE 4HEAJ 2NG1A 3GANA
chains in the Genus database with same CATH topology
5JT4A 4WGZA 2J9BA 4D4XA 1GQAA 5JVEA 1QPUA 5JRAA 3M4CA 1LM3B 1YZAA 4D4NA 4JE9A 1QQ3A 3NMKA 3ZTZA 5JS5A 4CJGA 2XM0A 3IQ6A 4IB4A 2CCYA 3ZTMA 1JAFA 2YL1A 3M15A 1S05A 3QVZA 3HNJA 1CPQA 2YLDA 2XLMA 3ZWIA 3TOMA 4JKVA 3QW0A 2YLIA 3VRCA 2XLEA 1M6TA 4JEAA 3ZQYA 3QW1A 3FOPA 1E84A 4CDVA 1CPRA 4U9DA 4ER9A 2XM4A 3HNKA 3HNLA 3NMJA 2XLWA 4U9EA 3DE9A 4IARA 1APCA 2BC5A 3C63A 2J8WA 2XLVA 2XLHA 5B3IA 5JLIA 2YL3A 3TOLA 4CDAA 1BBHA 2XLOA 4N6HA 4CDYA 3IQ5A 1YYJA 3ZQVA 1NBBA 3FOOA 4NC3A 4WGYA 3QVYA 4CIPA 4JEBA 1E85A 1CGNA 4CJOA 2XL6A 2XLDA 3L1MA 2YL7A 2QLAA 1MQVA 4L6RA 3HNIA 2YL0A 5AGFA 3M4BA 4IAQA 2YKZA 3C62A 1YYXA 1YZCA 4EIYA 2YLGA 3M79A 5JSLA 4ULVA 3DE8A 5JUAA 1E86A 5JP7A 3U8PA 256BA 1EKYA 1RCPA 2XL8A 4CX9A 3NMIA 4N4WA 1CGOA 1A7VA 1E83A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JT4 A;  4WGZ A;  2J9B A;  4D4X A;  1GQA A;  5JVE A;  1QPU A;  5JRA A;  3M4C A;  1LM3 B;  1YZA A;  4D4N A;  4JE9 A;  1QQ3 A;  3NMK A;  3ZTZ A;  5JS5 A;  4CJG A;  2XM0 A;  3IQ6 A;  4IB4 A;  2CCY A;  3ZTM A;  1JAF A;  2YL1 A;  3M15 A;  1S05 A;  3QVZ A;  3HNJ A;  1CPQ A;  2YLD A;  2XLM A;  3ZWI A;  3TOM A;  4JKV A;  3QW0 A;  2YLI A;  3VRC A;  2XLE A;  1M6T A;  4JEA A;  3ZQY A;  3QW1 A;  3FOP A;  1E84 A;  4CDV A;  1CPR A;  4U9D A;  4ER9 A;  2XM4 A;  3HNK A;  3HNL A;  3NMJ A;  2XLW A;  4U9E A;  3DE9 A;  4IAR A;  1APC A;  2BC5 A;  3C63 A;  2J8W A;  2XLV A;  2XLH A;  5B3I A;  5JLI A;  2YL3 A;  3TOL A;  4CDA A;  1BBH A;  2XLO A;  4N6H A;  4CDY A;  3IQ5 A;  1YYJ A;  3ZQV A;  1NBB A;  3FOO A;  4NC3 A;  4WGY A;  3QVY A;  4CIP A;  4JEB A;  1E85 A;  1CGN A;  4CJO A;  2XL6 A;  2XLD A;  3L1M A;  2YL7 A;  2QLA A;  1MQV A;  4L6R A;  3HNI A;  2YL0 A;  5AGF A;  3M4B A;  4IAQ A;  2YKZ A;  3C62 A;  1YYX A;  1YZC A;  4EIY A;  2YLG A;  3M79 A;  5JSL A;  4ULV A;  3DE8 A;  5JUA A;  1E86 A;  5JP7 A;  3U8P A;  256B A;  1EKY A;  1RCP A;  2XL8 A;  4CX9 A;  3NMI A;  4N4W A;  1CGO A;  1A7V A;  1E83 A; 
#chains in the Genus database with same CATH topology
 1LPE A;  3HKK A;  1D0Z A;  1FAP B;  1FMW A;  4MW8 A;  1J8M F;  3LEO A;  3K7D A;  4CIH A;  2R7R A;  2Q9B A;  2XXA A;  2DYS C;  3O39 A;  3FHD A;  1LM3 B;  3O10 A;  3K33 A;  4O6Y A;  3B29 A;  1FR0 A;  4C7O B;  4U5G A;  1MMA A;  3J06 A;  4R32 A;  1QQ3 A;  3C8Z A;  4HFK B;  4ANJ A;  4EBB A;  1QVX A;  3IQ6 A;  4IB4 A;  4OIN F;  4UDV A;  4Q7C A;  4ONS A;  3NYJ A;  3GM3 A;  1MMD A;  1JRA A;  3EG9 A;  2Q9A A;  2YL1 A;  2HKV A;  4W8P A;  2IXM A;  3QVZ A;  2CGE A;  3ABL C;  4HE8 D;  3WAQ A;  1M2O A;  2Q9C A;  2MHR A;  2NUT A;  2J9W A;  3RQG A;  5A6A A;  2KW3 C;  4BG0 A;  3LEV A;  2YRF A;  3LLK A;  4YT5 A;  5AC4 A;  1YAU O;  4O6N A;  3L0I A;  3VF0 A;  3QTH A;  2AVK A;  1OR3 A;  2GA0 A;  2EPN A;  1SR2 A;  2CNW D;  2V3C C;  3TK0 A;  2LFF A;  2WL8 A;  2VCC A;  4J30 B;  5KYW B;  1PD1 A;  4QI2 A;  2LCH A;  3FOP A;  4MS2 A;  5A6B D;  4O79 A;  2V26 A;  4U5B E;  3GEH A;  4XWJ A;  3E9V A;  4AL1 A;  3DJU B;  4CDV A;  5CI8 A;  1U89 A;  3CQZ A;  3U8V A;  2OOC A;  3DD7 A;  3FMS A;  4ER9 A;  3ITF A;  4C7O A;  2R9R B;  3SXK A;  5L0H A;  2R7O A;  2XLW A;  3RFY A;  2LQG A;  4LDR A;  3SXM A;  4EBJ A;  2H7V C;  3QMK A;  4BJT A;  1APC A;  3C63 A;  2JPU A;  2XLV A;  2EIJ C;  2ZXW C;  3TD7 A;  2EIK C;  3DKA A;  4DOZ A;  3K6B A;  5A6K A;  4DRI B;  5B3I A;  4XLP F;  3FVY A;  1BBH A;  1AUE A;  5GPG B;  4X0R A;  2XLO A;  3S27 A;  4N6H A;  2P0N A;  4DVZ A;  1T6I A;  4U5C E;  3IQ5 A;  3L34 A;  3U2L A;  4C3D A;  3T6J A;  4YL1 A;  2WZF A;  3K1I A;  1M2V B;  4NC3 A;  4WGY A;  4XQ1 A;  4PFO A;  5DLJ A;  5IY5 C;  2ZPA A;  4A2N B;  3U3F A;  1E85 A;  1VB5 A;  1SF8 A;  3C18 A;  2Q3T A;  4IWB A;  4Z9I A;  2XL6 A;  3A11 A;  3F47 A;  4PJN A;  5KYW A;  3JYY A;  3POV A;  1OXB A;  3I5Q A;  1G8X A;  1VK5 A;  5COG A;  3B0V C;  2VCB A;  2A6H F;  1MQV A;  2IYL D;  4XPX A;  4YL0 A;  4DRH B;  1ZZP A;  4BJ5 C;  2YL0 A;  3UNG C;  3LJB A;  1L3P A;  5CIV A;  5BQI A;  4KBL A;  3RVZ A;  1C03 A;  2R7X A;  3U3B A;  3B71 A;  3ZSU A;  4DRJ B;  1I5N A;  1K04 A;  3CSK A;  3KL4 A;  4EKW A;  4EIY A;  3IEE A;  3Q7G A;  3DAG A;  3VYW A;  5JSL A;  4ULV A;  3SYN A;  3SZR A;  1NSG B;  4ULW A;  4PFP A;  2L81 A;  4Z9J A;  3GEI A;  4PJJ A;  2ICW G;  3AG2 C;  4E0H A;  1XZP A;  3KPH A;  1FFH A;  2R7U A;  3W2W A;  3H2U A;  2OCC C;  2IOQ A;  3U8P A;  3DI5 A;  4DVY P;  1EKY A;  2KK1 A;  2Z15 A;  3EFO B;  3ASO C;  3K1H A;  2I8B A;  4N4W A;  4P9T A;  1CGO A;  2AWC A;  1FFT C;  4LAC B;  4MND A;  2OKU A;  4U5H A;  4BEM J;  5DQT A;  2GDC A;  4WGZ A;  2DYR C;  1WAS A;  2J9B A;  1VYI A;  1DOW A;  2MYS A;  2W45 A;  1GQA A;  4I1O B;  4D4X A;  3MYI A;  2A6E F;  3UMI A;  1D0Y A;  3V5X A;  2R7W A;  1GS9 A;  2AWY A;  1CGM E;  4OIO F;  2G3K A;  2DB4 A;  5JRA A;  4G7Z F;  4FWV A;  1YAR O;  5T3W A;  3U9J A;  4E7S A;  1YDI A;  2EPK X;  1YZA A;  2CW0 F;  4JC7 A;  3LNM B;  1E2X A;  1TQG A;  5JS5 A;  1YA9 A;  2XS1 A;  1Z7Q c;  2W9Y A;  2XM0 A;  4H4K C;  4MVU A;  4JCH A;  4CJG A;  2CCY A;  3GEE A;  5KYY B;  2QUP A;  1JMW A;  3PHF 2;  1PCX A;  3DMD A;  3S9O A;  5CI9 A;  2P7V A;  3PCV A;  3UR3 C;  2QY9 A;  3ZDL A;  4LDK A;  5TJ5 E;  3TJ5 A;  1ZHY A;  1FNT c;  3DZA A;  1ZHW A;  5D92 A;  3TOM A;  3S84 A;  4KNW A;  4C3B A;  3EZI A;  2C04 A;  1Y4C A;  3EFO A;  4JKV A;  2UUH A;  1H9G A;  1D1A A;  1JR8 A;  1MMN A;  2A0U A;  3EGD B;  2YLI A;  4JTC B;  4PJL A;  2J46 A;  4LDQ A;  4PAC A;  4LER A;  1JPJ A;  4IGG A;  4JUR I;  2YQY A;  1AEP A;  3Q6N A;  2XRH A;  2BL2 A;  3NDB B;  1Q0K A;  3EZH A;  2J7P A;  2YVK A;  2EPO A;  3QW1 A;  3WOD F;  1E84 A;  5DS5 A;  2R25 A;  1OW7 A;  2IXP A;  3F46 A;  2XSE A;  1CPR A;  2F22 A;  2KGO A;  3B9Q A;  4MVS A;  4XPW A;  4Z9H A;  1NG1 A;  1A7E A;  3HNK A;  3HNL A;  3NMJ A;  1BZ4 A;  1UFB A;  1MMG A;  3PMR A;  3RF3 A;  2WVQ A;  4U9E A;  1BR1 A;  2J9U A;  2XL4 A;  4YL3 A;  4IRU A;  3JSZ A;  5L0C A;  1V74 B;  1HW1 A;  1OXK A;  3DE9 A;  2L9J A;  3AGU A;  4IAR A;  3DJN B;  3ATP A;  4YN0 B;  3TJ6 A;  4C3E A;  1LI5 A;  1W2W A;  3LLI A;  1YA7 O;  2G62 A;  3ABM C;  3KKB A;  3US6 A;  3ZG1 A;  4MW3 A;  4P6I C;  3EJN A;  5A69 A;  1S7Z A;  1PD0 A;  2NSG A;  4CDY A;  3BEH A;  4XLN F;  3AQC A;  1OCC C;  3G4Z A;  4CIP A;  3R2P A;  4XPY A;  4DBQ A;  2Y3B A;  1NBB A;  1V4A A;  1SZI A;  3FOO A;  3VAY A;  1Z23 A;  1ZU4 A;  2O9X A;  1NFN A;  3AG3 C;  3T6G B;  3E70 C;  3EGD A;  3QVY A;  3FXH A;  1VLT A;  3NYM A;  3M1C B;  2EPM X;  2GWW A;  3UMK A;  5KYU B;  2IXN A;  1EQ1 A;  1JOG A;  2E87 A;  1OW8 A;  1WTY A;  2UUI A;  4G7H F;  2W4B A;  4OIP F;  4JRZ A;  2M64 A;  1Q0G A;  3EH1 A;  3SEO A;  1N1C A;  1LIH A;  2YL7 A;  1AVO B;  2QLA A;  2MWQ A;  4A4A A;  4L6R A;  3KYJ A;  3L8J A;  3ZIB A;  4DXW A;  5AGF A;  4E0I A;  2R7Q A;  1TFO B;  1HW2 A;  4JCZ A;  3N0T A;  4IJJ A;  2Y39 A;  1VYK A;  2GAQ A;  2HMZ A;  3AG1 C;  3N2Z B;  4G78 A;  4QDL A;  5COF A;  4F4B A;  1ZW3 A;  3NKD A;  4JJG A;  4OIQ F;  3DE8 A;  1NLX A;  2CDQ A;  3FAJ A;  5DVW A;  1OKK A;  2RSE B;  4CS9 C;  1NU9 C;  4BJ5 A;  2Y3H A;  2WZG A;  1E86 A;  1VLS A;  2HS5 A;  2VC9 A;  3GM1 A;  1TR2 A;  3LNR A;  3S0X A;  2R7T A;  2ZXP A;  5B3S C;  3V5Z A;  1T6U A;  1SYQ A;  256B A;  3C8G B;  5JP7 A;  1DOV A;  2RD9 A;  2XL8 A;  3T6B A;  4CX9 A;  4ZLD A;  1R5I D;  3NMI A;  4JTD B;  1A7V A;  1E83 A;  3KYI A;  4WJ0 A;  5BQH A;  4KI2 A;  1TWH A;  5KYU A;  2JD3 A;  5T1D B;  4MVM A;  1RJ9 B;  1K05 A;  1T01 A;  1TWA A;  3DXJ F;  1QPU A;  2EIL C;  4JTA B;  3GWL A;  1BR2 A;  5F5F A;  1B68 A;  4JW1 A;  3DM5 A;  4CS8 A;  1G4U S;  1RKE B;  5K0I A;  4U5F E;  1UG7 A;  4IAO A;  2LD6 A;  3GOD A;  3JT1 A;  4BJ1 A;  1MND A;  4N6C A;  3EQL F;  2Y3G A;  5B1A C;  1H7I A;  4DBR A;  1YLM A;  3G50 A;  5FZT A;  1MNE A;  2H7B A;  4OD5 A;  1Q0F A;  4MTO A;  4MTF A;  1S05 A;  2OU6 A;  1M2V A;  3QZC A;  1A41 A;  3U5S A;  3UGP A;  4CS8 C;  3GWN A;  5L0D A;  2LP4 A;  2XLM A;  4JJF A;  2HV6 A;  4W8K A;  4CS7 A;  1Z63 A;  4GQH A;  2IBF A;  2PP4 A;  3GM2 A;  5F28 E;  3R7C A;  1KTM A;  2YWA A;  3C8G A;  4K0D A;  1WGW A;  2J45 A;  1U6H A;  5AC5 A;  2HFI A;  3C7J A;  3QW0 A;  2XLE A;  3NG1 A;  4KNV A;  2ASR A;  2D5R B;  3N24 A;  4O6M A;  1O87 A;  1A0B A;  4M63 A;  4JEA A;  4DJ9 A;  4EUK B;  3NKE A;  3W8H A;  3ZQY A;  4CBE A;  2ZD9 A;  1RJ9 A;  2Q7R A;  3U0C A;  2WVO A;  3CZ6 A;  1OCR C;  3FAP B;  4OIR F;  2VB6 A;  3MX3 A;  4JZA A;  1LS1 A;  2WVN A;  3LS1 A;  3Q6M A;  1M57 C;  1KU2 A;  2KNH A;  4U9D A;  2KC3 A;  4B6I A;  1RKE A;  1D1B A;  1WN0 A;  2DGJ A;  3IQT A;  4YJW A;  3RYL A;  1I4Y A;  4MVO A;  2P1A A;  2VH3 A;  3I5P A;  1NU7 D;  3KH2 A;  1FMV A;  3SP1 A;  4K7B A;  2M4E A;  1C02 A;  2JX0 A;  4RDA A;  5T3T A;  2BC5 A;  2YEV A;  2KJG A;  5E3A A;  3DWW A;  1OCZ C;  3TUL A;  2J8W A;  3U9M A;  4CSA C;  5BQG A;  5JLI A;  4PR9 A;  2WZL A;  1WWP A;  1IW7 F;  2YL3 A;  3W8I A;  4CDA A;  5L0I A;  2VAS A;  4XTK A;  1QLE C;  1XWJ A;  1OQC A;  3V7O A;  3ZVR A;  3CAX A;  2WB7 A;  2J7P D;  1A7D A;  2LSE A;  3EG9 B;  1YYJ A;  3BRJ A;  2ETS A;  3ZQV A;  2HJ3 A;  1HMO A;  5DS4 A;  1QSP A;  1XZQ A;  4EHP A;  2PF4 E;  4YT8 A;  1V55 C;  4AE4 B;  4I3M A;  3RH3 A;  3L8I A;  2IXO A;  4JEB A;  2ZXR A;  1CGN A;  2R7S A;  1HE1 A;  2NUP B;  2HZ8 A;  1LI7 A;  3AGT A;  3T9O A;  1GGQ A;  3Q7L A;  1ZU5 A;  4MQ9 F;  5HV9 A;  2LFD A;  4WAB A;  5KYY A;  3JSE O;  2J0X A;  3MBG A;  2YZS A;  3A9C A;  2QNL A;  3JRM O;  1WAT A;  2A69 F;  4FX5 A;  4AX2 A;  1VOM A;  2KQ9 A;  4YT2 A;  1TWG A;  2Q4F A;  2YKZ A;  5EK0 A;  4XEK A;  1Y6D A;  1YYX A;  3O55 A;  1H6G A;  1LE2 A;  2L6G A;  2YLG A;  3IQC A;  3M79 A;  3DM9 B;  1O5H A;  1D1C A;  3DAF A;  1Z6A A;  3JCU Q;  2NPU A;  3G4X A;  4EWC A;  3AJM A;  2FAP B;  2B0J A;  2AP3 A;  4MVR A;  4YT4 A;  5KYX B;  4J32 B;  1L7C A;  3H65 A;  2HMQ A;  1LE4 A;  2PBE A;  5D91 A;  5E33 A;  4YWQ A;  3LUT B;  5B1B C;  5L0J A;  2H8A A;  3AOU A;  1RCP A;  2C03 A;  5L0F A;  2X51 A;  4GYT A;  4AE4 A;  2H7O A;  5BUO A;  2KSF A;  2HV7 A;  1ZVZ A;  2D4U A;  4YK5 A;  3B0P A;  3SNH A;  1VMA A;  2NUP A;  4BJ6 A;  4CS9 A;  3AQB A;  3T4R A;  4E7Z A;  5JT4 A;  1BDJ B;  2KYH A;  2DI3 A;  2A0B A;  4QI0 A;  1IZM A;  5DQZ A;  3S28 A;  5JVE A;  1C17 M;  3UGO A;  3FDQ A;  1J8Y F;  1TWC A;  2AU5 A;  3M4C A;  4J7Y A;  4Q5S F;  1OKK D;  2I15 A;  1RXQ A;  1Z3I X;  1LS4 A;  5DS6 A;  3TQO A;  3UMH A;  3X1O A;  2Q00 A;  4JIO A;  4D4N A;  3JTL O;  4JE9 A;  2FGY A;  3NMK A;  3ZTZ A;  1F1M A;  3EHM A;  3IPM O;  2CNW A;  4BJ6 C;  3ZTM A;  3LAY A;  2R7V A;  2R03 A;  3IHU A;  3EH2 A;  1JAF A;  2OJE D;  3NRH A;  3OEO A;  3RIP A;  3M15 A;  5A6B A;  4I44 A;  2J9V A;  3HLZ A;  3MFN A;  4XEF A;  3HNJ A;  5EHH A;  5KYX A;  3H2V A;  1CPQ A;  2W4M A;  2LK4 A;  2YLD A;  1WOL A;  2XS8 A;  3ZWI A;  4MVQ A;  2BE5 F;  2CYD A;  2OG2 A;  3OWT A;  1D0X A;  3RVY A;  3WG7 C;  1YJG A;  3I4U A;  4FAP B;  4J7T A;  3EPV A;  4XEV A;  4G7O F;  4ZLC A;  3ECS A;  4NTF A;  2Y3D A;  1Z5Z A;  1M56 C;  2GFH A;  3OA1 A;  2J0W A;  3VRC A;  4BEJ A;  1GM5 A;  5E3C A;  5COM A;  2L6F A;  3RW0 A;  1M6T A;  1QKR A;  3JRT A;  2OJQ A;  4CSA A;  1V54 C;  3MYF A;  2IM8 A;  1U0B B;  1BR4 A;  1ORY A;  5E2Q A;  1ZHX A;  3SXY A;  4O7G A;  1T6Q A;  3GOR A;  2TMV P;  1ORJ A;  3VM6 A;  5FCL A;  2Y69 C;  1Q0D A;  4NTB A;  3NYL A;  3ABK C;  2HSB A;  1H9T A;  1G5Z A;  1PV3 A;  2XM4 A;  3EHN A;  3HJC A;  1T9K A;  1SMY F;  5L3Q A;  1LKX A;  3SXZ A;  3W2V A;  1JPN A;  4KC9 A;  1ORS C;  3K1I C;  3S29 A;  3C8G D;  3LS0 A;  2HJM A;  3S90 A;  4GEH A;  4H54 A;  2G3V A;  4P9F A;  3EGX B;  4E18 A;  4MVZ A;  2B0H A;  2OEX A;  2XLH A;  2R02 A;  4G0H A;  3CEX A;  4NCQ A;  5A6J A;  5KYN A;  3TOL A;  1EI7 A;  2PX3 A;  2EIM C;  4I1M A;  5L0G A;  1RMV A;  3ZC4 A;  2LIG A;  1ZHT A;  1ZYR F;  2L6H A;  5HSW A;  1YVI A;  1RKC A;  2X0C A;  2PX0 A;  1TFK B;  1NZE A;  4LLC A;  4AK9 A;  1ZW2 A;  1EA8 A;  3O6X A;  1I4Z A;  4NTA A;  1TKN A;  1LVK A;  1KNY A;  1NFO A;  2L7A A;  2OQM A;  2OEV A;  4NY3 A;  4RD9 A;  4RBN A;  2QTV A;  2PFD A;  3MLG A;  4PK4 A;  4CJO A;  2ZXO A;  2XLD A;  4MTG A;  4JVS A;  2QE9 A;  3L1M A;  4N06 A;  2PNO A;  4OD4 A;  3K66 A;  1VTM P;  2YHS A;  4NQF A;  2XXA B;  2P61 A;  3AG4 C;  4K1O A;  3W4Y A;  2R05 A;  4FES A;  2HUJ A;  4E17 A;  1FTS A;  3HNI A;  4AL0 A;  2NSF A;  1ZHZ A;  2EIN C;  2A1D D;  3M4B A;  4IAQ A;  3X2Q C;  2VCA A;  4U5E E;  3KMI A;  3RKO F;  5F5H A;  3C62 A;  5EGY A;  1HY5 A;  1G4W R;  1YZC A;  3JYH A;  2FFH A;  3LES A;  2HSQ A;  3U2M A;  1HE9 A;  1QZX A;  3EGX A;  3WHN A;  1OCO C;  3ASN C;  4EBK A;  3PDM P;  5JUA A;  1O3U A;  3RQF A;  1OR2 A;  1T5O A;  3RQE A;  4HFF B;  3HTK C;  1ST6 A;  3B0U X;  4BPM A;  4PJM A;  5L3V A;  1OW6 A;  2NUT B;  4LLE A;  3V5Y A;  2A68 F;  4Q4Z F;  3JZ0 A;  1K40 A;  1R4T A;  1HMD A;  2EPL X;  1Q0M A;  2P6V A;  4U5D E;  4HEA J;  2NG1 A;  3GAN A; 
#chains in the Genus database with same CATH homology
 5JT4 A;  4WGZ A;  2J9B A;  4D4X A;  1GQA A;  5JVE A;  1QPU A;  5JRA A;  3M4C A;  1LM3 B;  1YZA A;  4D4N A;  4JE9 A;  1QQ3 A;  3NMK A;  3ZTZ A;  5JS5 A;  4CJG A;  2XM0 A;  3IQ6 A;  4IB4 A;  2CCY A;  3ZTM A;  1JAF A;  2YL1 A;  3M15 A;  1S05 A;  3QVZ A;  3HNJ A;  1CPQ A;  2YLD A;  2XLM A;  3ZWI A;  3TOM A;  4JKV A;  3QW0 A;  2YLI A;  3VRC A;  2XLE A;  1M6T A;  4JEA A;  3ZQY A;  3QW1 A;  3FOP A;  1E84 A;  4CDV A;  1CPR A;  4U9D A;  4ER9 A;  2XM4 A;  3HNK A;  3HNL A;  3NMJ A;  2XLW A;  4U9E A;  3DE9 A;  4IAR A;  1APC A;  2BC5 A;  3C63 A;  2J8W A;  2XLV A;  2XLH A;  5B3I A;  5JLI A;  2YL3 A;  3TOL A;  4CDA A;  1BBH A;  2XLO A;  4N6H A;  4CDY A;  3IQ5 A;  1YYJ A;  3ZQV A;  1NBB A;  3FOO A;  4NC3 A;  4WGY A;  3QVY A;  4CIP A;  4JEB A;  1E85 A;  1CGN A;  4CJO A;  2XL6 A;  2XLD A;  3L1M A;  2YL7 A;  2QLA A;  1MQV A;  4L6R A;  3HNI A;  2YL0 A;  5AGF A;  3M4B A;  4IAQ A;  2YKZ A;  3C62 A;  1YYX A;  1YZC A;  4EIY A;  2YLG A;  3M79 A;  5JSL A;  4ULV A;  3DE8 A;  5JUA A;  1E86 A;  5JP7 A;  3U8P A;  256B A;  1EKY A;  1RCP A;  2XL8 A;  4CX9 A;  3NMI A;  4N4W A;  1CGO A;  1A7V A;  1E83 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...