1E84A

Cytochrome c' from alcaligenes xylosoxidans - reduced structure
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
126
structure length
126
Chain Sequence
b'EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
molecule tags Electron transport
publication title Unprecedented Proximal Binding of Nitric Oxide to Heme: Implications for Guanylate Cyclase
pubmed doi rcsb
total genus 49
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2000-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1e84A00
1YYJA 4CX9A 5JUAA 4IARA 1NBBA 2YL1A 1APCA 3DE9A 5JSLA 3TOMA 1YZCA 4CJOA 2XL6A 4N4WA 1CPQA 3M79A 4ULVA 2YLDA 1CPRA 5JRAA 5JS5A 1E83A 1YZAA 3IQ5A 2YLIA 4NC3A 4CIPA 1JAFA 1BBHA 2XL8A 4U9DA 1QQ3A 4JKVA 3HNKA 1CGOA 3VRCA 4IAQA 3ZWIA 4JEAA 3FOPA 2CCYA 1CGNA 2XLOA 1EKYA 4WGYA 2XLDA 2YL7A 256BA 2YL3A 3L1MA 5JLIA 3ZQVA 5JP7A 3ZTZA 4IB4A 3TOLA 4CDAA 4JEBA 3IQ6A 2QLAA 4JE9A 3HNLA 3QW0A 3C62A 3NMKA 1YYXA 2XLMA 3QVYA 4CJGA 5B3IA 3HNJA 5JT4A 1M6TA 2XLEA 4D4NA 5AGFA 1E84A 2J8WA 2YKZA 4CDYA 3QVZA 2BC5A 2XM4A 1RCPA 4N6HA 3M4CA 3C63A 1MQVA 3M15A 3QW1A 2YLGA 5JVEA 1S05A 4D4XA 2YL0A 4U9EA 3DE8A 2XLHA 1E85A 3FOOA 4EIYA 3NMJA 3HNIA 3ZTMA 4WGZA 2XLWA 1QPUA 4ER9A 1E86A 3M4BA 2XM0A 4L6RA 1LM3B 4CDVA 2J9BA 2XLVA 3NMIA 3U8PA 1GQAA 1A7VA 3ZQYA
chains in the Genus database with same CATH superfamily
2DYSC 4JVSA 4K7BA 3NRHA 3S90A 5A6JA 1K04A 1Q0GA 4IARA 2GDCA 3WG7C 1G4US 1ZYRF 2KNHA 3VYWA 2A0UA 3UGOA 1N1CA 2PFDA 4EBJA 3TOMA 2EILC 2XL6A 1MMAA 1TQGA 2P61A 3T6JA 3CQZA 3LJBA 3N24A 3MYFA 3O55A 1VLSA 2EIKC 3S9OA 4YT8A 3GWLA 3U5SA 2WB7A 4LDKA 1LPEA 5KYXA 3IQ5A 2YLIA 1F1MA 3QZCA 4IAOA 5L3QA 5D91A 3G50A 3MFNA 2GWWA 2Q9CA 4BJTA 2J9VA 2XL8A 4NTBA 2KJGA 5KYUB 4ZLDA 4JKVA 3HNKA 5L0JA 5A6AA 1NFNA 2GA0A 2ZXOA 3JSEO 2IXNA 2W9YA 2YEVA 1L7CA 3AG4C 4JEAA 4YJWA 3L0IA 2J7PD 4OINF 5A6BD 3OWTA 3T4RA 4FX5A 1H9TA 1EKYA 2DB4A 4YT5A 2O9XA 3SXYA 1LVKA 2NUPA 3X2QC 1BDJB 2IOQA 1ZVZA 3C18A 4C3BA 1LS1A 4DVYP 1LI5A 2GAQA 1Q0FA 3KL4A 3L1MA 3V7OA 3EH2A 3U8VA 5JLIA 5EK0A 1VK5A 2HZ8A 5DQZA 3NYMA 2AWYA 3IQ6A 3KYIA 4MS2A 4P6IC 4LERA 2RSEB 2X0CA 2KGOA 1PV3A 1RKEA 4KI2A 2L81A 4JJGA 2ETSA 2QUPA 3O10A 5E3CA 2Q4FA 3GEEA 3ASNC 3ZSUA 1ZU4A 3RKOF 3S84A 4HEAJ 4XEKA 1YJGA 1PCXA 5CIVA 1C02A 5FCLA 4WABA 2I8BA 2LCHA 3H2UA 3HKKA 5L0CA 2WL8A 4JJFA 4MVOA 5JT4A 2XLEA 4PR9A 1KTMA 5KYUA 2YVKA 3JSZA 3DAFA 4IJJA 2H7VC 2FGYA 3NKEA 1K05A 2CNWD 4BJ5A 4YT4A 4K1OA 5BUOA 3DMDA 2J8WA 4EHPA 2ZXPA 4OIQF 3U3BA 3K1HA 1Y6DA 4Z9HA 3DI5A 1OR2A 2AP3A 1NFOA 2L6FA 2VB6A 4P9TA 5E2QA 1J8MF 1GM5A 1MNDA 3M4CA 3R2PA 3RH3A 4Q7CA 1Z3IX 1G8XA 2A69F 2FAPB 2UUIA 3K1IA 3JCUQ 4MVMA 1O3UA 2Q00A 5COMA 3RYLA 2YLGA 1D1AA 2ZPAA 3N0TA 3HTKC 2EPKX 5CI9A 2IM8A 5AC5A 1CGME 4GEHA 3DE8A 1OKKD 4I1OB 2XLHA 2WVNA 1E85A 3S28A 1AUEA 1ORJA 3NDBB 1Q0DA 2Y3BA 2PBEA 3DZAA 4PJJA 3MBGA 3JYHA 1NZEA 3NMJA 4U5FE 1AVOB 3JRMO 5DS5A 2R7TA 4MTOA 3Q6MA 4O79A 3TJ5A 2XRHA 4MVZA 3T6GB 3CEXA 2YQYA 4XEFA 3QTHA 3V5YA 1Z7Qc 4YN0B 5DLJA 3J06A 2A1DD 2VCCA 4HFFB 1LE2A 3B71A 1Y4CA 3RF3A 1I4ZA 2HV7A 1R4TA 1M2VA 1H9GA 3GEIA 3I4UA 3U9JA 3UMKA 4E7ZA 1NLXA 5KYYB 3B0PA 4JCHA 4F4BA 1A7VA 1U89A 3ZQYA 2NUPB 5E33A 1NG1A 2G3KA 4JTAB 2VCAA 2CW0F 1K40A 3JRTA 5F5HA 1YDIA 3EFOB 5JUAA 1HMOA 4JTDB 3RQGA 2R25A 4BEMJ 1OR3A 3LEOA 2DGJA 3LNMB 1TFOB 2UUHA 3JT1A 1ZHXA 4XEVA 1YZCA 2YWAA 4OIRF 4ANJA 3F47A 3UGPA 1OCOC 2YLDA 2YRFA 5A6KA 3KMIA 4LACB 3HJCA 5B3SC 3G4XA 4IRUA 3EG9B 1LS4A 3PHF2 1WTYA 3NYJA 4CIPA 3K33A 3EQLF 1TFKB 3LNRA 1JAFA 3DKAA 1PD1A 4NQFA 2Y69C 4U9DA 3TD7A 4M63A 2L7AA 3K66A 1M2OA 4XPXA 5D92A 5F5FA 1LI7A 3AGUA 4J7TA 3AG2C 4IGGA 2NSFA 2TMVP 3GM3A 5EHHA 3RFYA 3SZRA 3JTLO 3EG9A 3T6BA 2R9RB 3ZG1A 4E7SA 2XXAB 2CDQA 3W8HA 1BR2A 1M56C 3WAQA 4WGYA 5L0GA 1UG7A 3EH1A 1EA8A 2EPMX 3DXJF 5B1AC 2A0BA 1V55C 4FWVA 1OCCC 3EZIA 1TKNA 4IB4A 3TOLA 3U0CA 1OCZC 2QLAA 1D1BA 2Q3TA 1NU7D 4FESA 3RVZA 1FAPB 3DD7A 2EINC 3FVYA 3UMIA 3L34A 5KYWB 1O87A 2Y39A 3QW0A 4LLCA 2OOCA 4U5CE 4A2NB 3C62A 2OQMA 4MNDA 5KYYA 2X51A 1JR8A 3ATPA 3V5ZA 2B0JA 3L8JA 3LLIA 3NMKA 4NTAA 1YYXA 3DWWA 3QVYA 3IEEA 1IW7F 4Z9IA 3EGXB 4BJ5C 3HNJA 3F46A 4AE4B 4CS7A 4ONSA 4C3DA 1DOVA 2HKVA 2J9WA 2XXAA 1W2WA 1IZMA 4BJ6C 2YKZA 4CDYA 1ZHWA 1I4YA 4HE8D 2XL4A 5L3VA 2OKUA 1VTMP 4MVRA 2BC5A 3IHUA 2W4BA 2XM4A 2Y3HA 4JRZA 3Q7LA 1D1CA 2YZSA 3GM2A 5EGYA 4UDVA 4W8PA 3FDQA 1V74B 4JCZA 2J9UA 3FAJA 2JPUA 3QW1A 5K0IA 3DM9B 3EHMA 3K6BA 1S05A 4D4XA 4K0DA 4NY3A 2YL0A 3FOOA 3QMKA 2ICWG 3ZDLA 2PX0A 3PCVA 4PJMA 3ZTMA 3HNIA 1V4AA 3ZIBA 4WGZA 2R7RA 1U6HA 4DRJB 2HFIA 3B9QA 4Z9JA 1Z6AA 2W45A 3I5QA 4EBKA 4H4KC 4ER9A 2JX0A 5COFA 2G3VA 3EZHA 1ZZPA 5IY5C 2XM0A 5L0IA 1Z63A 3K7DA 1SR2A 4YWQA 3PDMP 1OXKA 1WASA 1JMWA 4CDVA 2J9BA 2MWQA 2Y3DA 4J32B 3WHNA 4G0HA 4OD5A 3EPVA 4CSAA 3U8PA 3ASOC 2AWCA 4G7ZF 2WZLA 3NKDA 1ST6A 2P1AA 1EI7A 3ABMC 2EPNA 3U3FA 4PJLA 3PMRA 4CX9A 1FNTc 2ZD9A 4LDQA 4CS8C 1V54C 1FTSA 1T6IA 1QLEC 2HSBA 1APCA 4J30B 3LEVA 4R32A 5JSLA 3ABKC 2HV6A 4OIPF 3MYIA 1YARO 4C3EA 2EIJC 3M79A 3TJ6A 1CPRA 2JD3A 4MW8A 4EBBA 2HMQA 2R7SA 1SYQA 1VYKA 1YZAA 1R5ID 2P0NA 1OW8A 4WJ0A 4Q5SF 3EGDB 1BZ4A 1E2XA 1QSPA 1RJ9A 2J45A 4JW1A 4PJNA 5DS6A 3DAGA 2C04A 3AQCA 2W4MA 3BEHA 4KBLA 2NSGA 4LLEA 1Z23A 3RQEA 1T9KA 1SF8A 1FR0A 1QQ3A 1FFTC 2A6HF 1QKRA 3SEOA 4IAQA 3VRCA 1BR4A 3WODF 3ZWIA 4AE4A 4BJ6A 3UNGC 1XZQA 4NCQA 3V5XA 4FAPB 2CCYA 2H8AA 1CGNA 2IXMA 2VASA 3B29A 3G4ZA 1H6GA 2BL2A 3C8GB 4QI0A 3NG1A 2LP4A 2P7VA 4MTGA 1HW2A 1MMNA 2XLDA 4CIHA 1WWPA 1UFBA 1FMWA 3ECSA 256BA 3UMHA 2J7PA 3ZQVA 2C03A 2IXPA 4CDAA 3KKBA 4JEBA 4O6NA 1ZW2A 2B0HA 4EKWA 4C7OB 2R7XA 4ZLCA 1MMDA 4I1MA 4JTCB 1H7IA 3HNLA 1RMVA 4DRIB 1WN0A 2PF4E 3RVYA 2L9JA 3TULA 1G4WR 2WZFA 3MLGA 4I3MA 1OCRC 4O7GA 2CNWA 3U2LA 5T3WA 3VM6A 3W8IA 4AK9A 1TWCA 4CBEA 2ZXRA 4AL1A 1A7DA 1OQCA 5KYNA 2VCBA 2Y3GA 4JC7A 3W2WA 4DXWA 2D4UA 4DRHB 2KQ9A 1D0YA 4BG0A 4LDRA 1D0ZA 4E17A 1MNEA 4JIOA 1RKCA 1E84A 4MVUA 1NU9C 2LQGA 2A6EF 2Q9AA 4KC9A 1HE1A 3AG1C 1O5HA 3MX3A 3QVZA 4QI2A 1QZXA 1JPJA 4RBNA 2HMZA 5GPGB 5L0FA 2OJQA 3C63A 2L6GA 1AEPA 2IYLD 1LIHA 4BEJA 1OKKA 2XS8A 4G7HF 1GGQA 3AQBA 1VOMA 2WVQA 5KYWA 1EQ1A 1RJ9B 1SZIA 3O39A 4ULWA 2PNOA 3M1CB 4XPYA 3ZC4A 1T6QA 1C17M 4PK4A 3ABLC 3EJNA 1TWAA 4U9EA 2EPLX 3GWNA 5B1BC 4CS9A 2KYHA 2OEVA 3JZ0A 4U5GA 1L3PA 4E0IA 4XTKA 3LS0A 4EIYA 1GS9A 3I5PA 1LKXA 5HSWA 3GANA 1TWGA 3KH2A 3S27A 2XLWA 4RD9A 1QVXA 4Q4ZF 4RDAA 2M64A 4U5HA 2FFHA 4PACA 4C7OA 1ORYA 2QTVA 4W8KA 2V26A 1VB5A 3AJMA 3GODA 4GQHA 1VLTA 3O6XA 4PFPA 2OJED 5DVWA 3POVA 3L8IA 1YAUO 1LM3B 2AU5A 2R7QA 1RXQA 2XLVA 3NMIA 4G78A 4E18A 1U0BB 4O6MA 3LLKA 2NUTA 3TK0A 1JPNA 3W2VA 3H2VA 3GM1A 3LS1A 4U5BE 1HY5A 4YT2A 3Q6NA 1YYJA 3SXZA 5L0HA 4U5DE 3GEHA 5DQTA 4YL0A 3EGXA 1ZU5A 4XQ1A 1NBBA 2J0WA 2YL1A 3VF0A 2IXOA 3GORA 3DE9A 2G62A 2NUTB 2Q9BA 4CJOA 1FMVA 4MVSA 1I5NA 1CPQA 2ASRA 4N4WA 4NTFA 4ULVA 3U2MA 2R7OA 5BQHA 1A7EA 5JRAA 5JS5A 1YVIA 1E83A 3B0VC 1KNYA 4YK5A 4GYTA 1B68A 2IBFA 2LIGA 4YL1A 3K1IC 4NC3A 2J46A 2H7OA 4P9FA 2QY9A 5L0DA 1T5OA 3FHDA 1YA9A 3DJNB 1BBHA 1PD0A 4B6IA 4H54A 3E70C 1WGWA 2DI3A 4J7YA 2OG2A 2WZGA 4KNVA 3N2ZB 1CGOA 2H7BA 2GFHA 3BRJA 4YL3A 1OW7A 5CI8A 3C8GD 4AL0A 3X1OA 2CYDA 4DBQA 2NG1A 1Q0MA 2KW3C 2VH3A 2LSEA 3FOPA 3A9CA 3JYYA 5BQGA 2XLOA 3DM5A 3S29A 5DS4A 3LESA 3RW0A 1G5ZA 4DJ9A 1HW1A 3R7CA 5BQIA 3ITFA 4XLPF 4HFKB 2YL7A 3SYNA 1HMDA 4JZAA 1A41A 1XWJA 2YL3A 2P6VA 2PX3A 3OEOA 2D5RB 2E87A 5JP7A 2HSQA 3C8GA 3ZTZA 5A69A 2L6HA 4N6CA 1ORSC 2PP4A 3E9VA 2LFDA 1WATA 3AOUA 2Q7RA 1XZPA 5A6BA 1A0BA 4JE9A 1Z5ZA 2MYSA 1ZW3A 3A11A 5FZTA 4DVZA 4G7OF 1HE9A 3IPMO 3RIPA 4MVQA 4CS9C 1M2VB 1C03A 1Q0KA 1OXBA 1ZHYA 3KPHA 2CGEA 3US6A 3ZVRA 1LE4A 2BE5F 3AGTA 2R7UA 3CZ6A 1T6UA 2OCCC 3EGDA 2XLMA 4CJGA 1BR1A 2R02A 2LK4A 4N06A 4X0RA 3SXKA 3U9MA 5B3IA 2R7VA 2DYRC 1M6TA 3EHNA 1J8YF 2F22A 3CSKA 3UR3C 2Z15A 4D4NA 4MTFA 3OA1A 5AGFA 4BPMA 2M4EA 4QDLA 3RQFA 1ZHZA 1NSGB 3KYJA 2LD6A 4KNWA 3IQCA 1OW6A 3T9OA 1DOWA 3SXMA 1S7ZA 4MW3A 3FAPB 1SMYF 1JOGA 2R05A 3W4YA 1KU2A 5KYXB 3SNHA 1TWHA 1RCPA 2EIMC 2J0XA 4N6HA 4I44A 5TJ5E 5T1DB 4A4AA 1TR2A 2VC9A 3NYLA 5HV9A 2XS1A 3CAXA 1MQVA 3VAYA 2AVKA 2MHRA 1YA7O 1FFHA 4OD4A 4U5EE 2LFFA 2A68F 5T3TA 2HUJA 4EWCA 1WOLA 2KSFA 3M15A 1D0XA 1YLMA 1MMGA 1JRAA 2RD9A 2ZXWC 3FXHA 4AX2A 4DOZA 5JVEA 3EFOA 3Q7GA 4PFOA 4XLNF 2YHSA 5AC4A 2OU6A 3LAYA 4O6YA 3C7JA 1VYIA 1ZHTA 4BJ1A 2WVOA 4IWBA 4CS8A 4XWJA 3IQTA 4DBRA 3S0XA 1VMAA 2R03A 3C8ZA 2QNLA 3AG3C 4MQ9F 2R7WA 1QPUA 2KK1A 2I15A 3HLZA 4EUKB 1E86A 5F28E 3M4BA 2HJ3A 2KC3A 2NPUA 4CSAC 3B0UX 2QE9A 4L6RA 5COGA 4E0HA 2HJMA 4XPWA 3H65A 3TQOA 2HS5A 2V3CC 4OIOF 3SP1A 1GQAA 5E3AA 1M57C 1T01A 2EPOA 1RKEB 3DJUB 4JURI 3LUTB 3FMSA 2OEXA 2XSEA
chains in the Genus database with same CATH topology
1YYJA 4CX9A 5JUAA 4IARA 1NBBA 2YL1A 1APCA 3DE9A 5JSLA 3TOMA 1YZCA 4CJOA 2XL6A 4N4WA 1CPQA 3M79A 4ULVA 2YLDA 1CPRA 5JRAA 5JS5A 1E83A 1YZAA 3IQ5A 2YLIA 4NC3A 4CIPA 1JAFA 1BBHA 2XL8A 4U9DA 1QQ3A 4JKVA 3HNKA 1CGOA 3VRCA 4IAQA 3ZWIA 4JEAA 3FOPA 2CCYA 1CGNA 2XLOA 1EKYA 4WGYA 2XLDA 2YL7A 256BA 2YL3A 3L1MA 5JLIA 3ZQVA 5JP7A 3ZTZA 4IB4A 3TOLA 4CDAA 4JEBA 3IQ6A 2QLAA 4JE9A 3HNLA 3QW0A 3C62A 3NMKA 1YYXA 2XLMA 3QVYA 4CJGA 5B3IA 3HNJA 5JT4A 1M6TA 2XLEA 4D4NA 5AGFA 1E84A 2J8WA 2YKZA 4CDYA 3QVZA 2BC5A 2XM4A 1RCPA 4N6HA 3M4CA 3C63A 1MQVA 3M15A 3QW1A 2YLGA 5JVEA 1S05A 4D4XA 2YL0A 4U9EA 3DE8A 2XLHA 1E85A 3FOOA 4EIYA 3NMJA 3HNIA 3ZTMA 4WGZA 2XLWA 1QPUA 4ER9A 1E86A 3M4BA 2XM0A 4L6RA 1LM3B 4CDVA 2J9BA 2XLVA 3NMIA 3U8PA 1GQAA 1A7VA 3ZQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YYJ A;  4CX9 A;  5JUA A;  4IAR A;  1NBB A;  2YL1 A;  1APC A;  3DE9 A;  5JSL A;  3TOM A;  1YZC A;  4CJO A;  2XL6 A;  4N4W A;  1CPQ A;  3M79 A;  4ULV A;  2YLD A;  1CPR A;  5JRA A;  5JS5 A;  1E83 A;  1YZA A;  3IQ5 A;  2YLI A;  4NC3 A;  4CIP A;  1JAF A;  1BBH A;  2XL8 A;  4U9D A;  1QQ3 A;  4JKV A;  3HNK A;  1CGO A;  3VRC A;  4IAQ A;  3ZWI A;  4JEA A;  3FOP A;  2CCY A;  1CGN A;  2XLO A;  1EKY A;  4WGY A;  2XLD A;  2YL7 A;  256B A;  2YL3 A;  3L1M A;  5JLI A;  3ZQV A;  5JP7 A;  3ZTZ A;  4IB4 A;  3TOL A;  4CDA A;  4JEB A;  3IQ6 A;  2QLA A;  4JE9 A;  3HNL A;  3QW0 A;  3C62 A;  3NMK A;  1YYX A;  2XLM A;  3QVY A;  4CJG A;  5B3I A;  3HNJ A;  5JT4 A;  1M6T A;  2XLE A;  4D4N A;  5AGF A;  1E84 A;  2J8W A;  2YKZ A;  4CDY A;  3QVZ A;  2BC5 A;  2XM4 A;  1RCP A;  4N6H A;  3M4C A;  3C63 A;  1MQV A;  3M15 A;  3QW1 A;  2YLG A;  5JVE A;  1S05 A;  4D4X A;  2YL0 A;  4U9E A;  3DE8 A;  2XLH A;  1E85 A;  3FOO A;  4EIY A;  3NMJ A;  3HNI A;  3ZTM A;  4WGZ A;  2XLW A;  1QPU A;  4ER9 A;  1E86 A;  3M4B A;  2XM0 A;  4L6R A;  1LM3 B;  4CDV A;  2J9B A;  2XLV A;  3NMI A;  3U8P A;  1GQA A;  1A7V A;  3ZQY A; 
#chains in the Genus database with same CATH topology
 2DYS C;  4JVS A;  4K7B A;  3NRH A;  3S90 A;  5A6J A;  1K04 A;  1Q0G A;  4IAR A;  2GDC A;  3WG7 C;  1G4U S;  1ZYR F;  2KNH A;  3VYW A;  2A0U A;  3UGO A;  1N1C A;  2PFD A;  4EBJ A;  3TOM A;  2EIL C;  2XL6 A;  1MMA A;  1TQG A;  2P61 A;  3T6J A;  3CQZ A;  3LJB A;  3N24 A;  3MYF A;  3O55 A;  1VLS A;  2EIK C;  3S9O A;  4YT8 A;  3GWL A;  3U5S A;  2WB7 A;  4LDK A;  1LPE A;  5KYX A;  3IQ5 A;  2YLI A;  1F1M A;  3QZC A;  4IAO A;  5L3Q A;  5D91 A;  3G50 A;  3MFN A;  2GWW A;  2Q9C A;  4BJT A;  2J9V A;  2XL8 A;  4NTB A;  2KJG A;  5KYU B;  4ZLD A;  4JKV A;  3HNK A;  5L0J A;  5A6A A;  1NFN A;  2GA0 A;  2ZXO A;  3JSE O;  2IXN A;  2W9Y A;  2YEV A;  1L7C A;  3AG4 C;  4JEA A;  4YJW A;  3L0I A;  2J7P D;  4OIN F;  5A6B D;  3OWT A;  3T4R A;  4FX5 A;  1H9T A;  1EKY A;  2DB4 A;  4YT5 A;  2O9X A;  3SXY A;  1LVK A;  2NUP A;  3X2Q C;  1BDJ B;  2IOQ A;  1ZVZ A;  3C18 A;  4C3B A;  1LS1 A;  4DVY P;  1LI5 A;  2GAQ A;  1Q0F A;  3KL4 A;  3L1M A;  3V7O A;  3EH2 A;  3U8V A;  5JLI A;  5EK0 A;  1VK5 A;  2HZ8 A;  5DQZ A;  3NYM A;  2AWY A;  3IQ6 A;  3KYI A;  4MS2 A;  4P6I C;  4LER A;  2RSE B;  2X0C A;  2KGO A;  1PV3 A;  1RKE A;  4KI2 A;  2L81 A;  4JJG A;  2ETS A;  2QUP A;  3O10 A;  5E3C A;  2Q4F A;  3GEE A;  3ASN C;  3ZSU A;  1ZU4 A;  3RKO F;  3S84 A;  4HEA J;  4XEK A;  1YJG A;  1PCX A;  5CIV A;  1C02 A;  5FCL A;  4WAB A;  2I8B A;  2LCH A;  3H2U A;  3HKK A;  5L0C A;  2WL8 A;  4JJF A;  4MVO A;  5JT4 A;  2XLE A;  4PR9 A;  1KTM A;  5KYU A;  2YVK A;  3JSZ A;  3DAF A;  4IJJ A;  2H7V C;  2FGY A;  3NKE A;  1K05 A;  2CNW D;  4BJ5 A;  4YT4 A;  4K1O A;  5BUO A;  3DMD A;  2J8W A;  4EHP A;  2ZXP A;  4OIQ F;  3U3B A;  3K1H A;  1Y6D A;  4Z9H A;  3DI5 A;  1OR2 A;  2AP3 A;  1NFO A;  2L6F A;  2VB6 A;  4P9T A;  5E2Q A;  1J8M F;  1GM5 A;  1MND A;  3M4C A;  3R2P A;  3RH3 A;  4Q7C A;  1Z3I X;  1G8X A;  2A69 F;  2FAP B;  2UUI A;  3K1I A;  3JCU Q;  4MVM A;  1O3U A;  2Q00 A;  5COM A;  3RYL A;  2YLG A;  1D1A A;  2ZPA A;  3N0T A;  3HTK C;  2EPK X;  5CI9 A;  2IM8 A;  5AC5 A;  1CGM E;  4GEH A;  3DE8 A;  1OKK D;  4I1O B;  2XLH A;  2WVN A;  1E85 A;  3S28 A;  1AUE A;  1ORJ A;  3NDB B;  1Q0D A;  2Y3B A;  2PBE A;  3DZA A;  4PJJ A;  3MBG A;  3JYH A;  1NZE A;  3NMJ A;  4U5F E;  1AVO B;  3JRM O;  5DS5 A;  2R7T A;  4MTO A;  3Q6M A;  4O79 A;  3TJ5 A;  2XRH A;  4MVZ A;  3T6G B;  3CEX A;  2YQY A;  4XEF A;  3QTH A;  3V5Y A;  1Z7Q c;  4YN0 B;  5DLJ A;  3J06 A;  2A1D D;  2VCC A;  4HFF B;  1LE2 A;  3B71 A;  1Y4C A;  3RF3 A;  1I4Z A;  2HV7 A;  1R4T A;  1M2V A;  1H9G A;  3GEI A;  3I4U A;  3U9J A;  3UMK A;  4E7Z A;  1NLX A;  5KYY B;  3B0P A;  4JCH A;  4F4B A;  1A7V A;  1U89 A;  3ZQY A;  2NUP B;  5E33 A;  1NG1 A;  2G3K A;  4JTA B;  2VCA A;  2CW0 F;  1K40 A;  3JRT A;  5F5H A;  1YDI A;  3EFO B;  5JUA A;  1HMO A;  4JTD B;  3RQG A;  2R25 A;  4BEM J;  1OR3 A;  3LEO A;  2DGJ A;  3LNM B;  1TFO B;  2UUH A;  3JT1 A;  1ZHX A;  4XEV A;  1YZC A;  2YWA A;  4OIR F;  4ANJ A;  3F47 A;  3UGP A;  1OCO C;  2YLD A;  2YRF A;  5A6K A;  3KMI A;  4LAC B;  3HJC A;  5B3S C;  3G4X A;  4IRU A;  3EG9 B;  1LS4 A;  3PHF 2;  1WTY A;  3NYJ A;  4CIP A;  3K33 A;  3EQL F;  1TFK B;  3LNR A;  1JAF A;  3DKA A;  1PD1 A;  4NQF A;  2Y69 C;  4U9D A;  3TD7 A;  4M63 A;  2L7A A;  3K66 A;  1M2O A;  4XPX A;  5D92 A;  5F5F A;  1LI7 A;  3AGU A;  4J7T A;  3AG2 C;  4IGG A;  2NSF A;  2TMV P;  3GM3 A;  5EHH A;  3RFY A;  3SZR A;  3JTL O;  3EG9 A;  3T6B A;  2R9R B;  3ZG1 A;  4E7S A;  2XXA B;  2CDQ A;  3W8H A;  1BR2 A;  1M56 C;  3WAQ A;  4WGY A;  5L0G A;  1UG7 A;  3EH1 A;  1EA8 A;  2EPM X;  3DXJ F;  5B1A C;  2A0B A;  1V55 C;  4FWV A;  1OCC C;  3EZI A;  1TKN A;  4IB4 A;  3TOL A;  3U0C A;  1OCZ C;  2QLA A;  1D1B A;  2Q3T A;  1NU7 D;  4FES A;  3RVZ A;  1FAP B;  3DD7 A;  2EIN C;  3FVY A;  3UMI A;  3L34 A;  5KYW B;  1O87 A;  2Y39 A;  3QW0 A;  4LLC A;  2OOC A;  4U5C E;  4A2N B;  3C62 A;  2OQM A;  4MND A;  5KYY A;  2X51 A;  1JR8 A;  3ATP A;  3V5Z A;  2B0J A;  3L8J A;  3LLI A;  3NMK A;  4NTA A;  1YYX A;  3DWW A;  3QVY A;  3IEE A;  1IW7 F;  4Z9I A;  3EGX B;  4BJ5 C;  3HNJ A;  3F46 A;  4AE4 B;  4CS7 A;  4ONS A;  4C3D A;  1DOV A;  2HKV A;  2J9W A;  2XXA A;  1W2W A;  1IZM A;  4BJ6 C;  2YKZ A;  4CDY A;  1ZHW A;  1I4Y A;  4HE8 D;  2XL4 A;  5L3V A;  2OKU A;  1VTM P;  4MVR A;  2BC5 A;  3IHU A;  2W4B A;  2XM4 A;  2Y3H A;  4JRZ A;  3Q7L A;  1D1C A;  2YZS A;  3GM2 A;  5EGY A;  4UDV A;  4W8P A;  3FDQ A;  1V74 B;  4JCZ A;  2J9U A;  3FAJ A;  2JPU A;  3QW1 A;  5K0I A;  3DM9 B;  3EHM A;  3K6B A;  1S05 A;  4D4X A;  4K0D A;  4NY3 A;  2YL0 A;  3FOO A;  3QMK A;  2ICW G;  3ZDL A;  2PX0 A;  3PCV A;  4PJM A;  3ZTM A;  3HNI A;  1V4A A;  3ZIB A;  4WGZ A;  2R7R A;  1U6H A;  4DRJ B;  2HFI A;  3B9Q A;  4Z9J A;  1Z6A A;  2W45 A;  3I5Q A;  4EBK A;  4H4K C;  4ER9 A;  2JX0 A;  5COF A;  2G3V A;  3EZH A;  1ZZP A;  5IY5 C;  2XM0 A;  5L0I A;  1Z63 A;  3K7D A;  1SR2 A;  4YWQ A;  3PDM P;  1OXK A;  1WAS A;  1JMW A;  4CDV A;  2J9B A;  2MWQ A;  2Y3D A;  4J32 B;  3WHN A;  4G0H A;  4OD5 A;  3EPV A;  4CSA A;  3U8P A;  3ASO C;  2AWC A;  4G7Z F;  2WZL A;  3NKD A;  1ST6 A;  2P1A A;  1EI7 A;  3ABM C;  2EPN A;  3U3F A;  4PJL A;  3PMR A;  4CX9 A;  1FNT c;  2ZD9 A;  4LDQ A;  4CS8 C;  1V54 C;  1FTS A;  1T6I A;  1QLE C;  2HSB A;  1APC A;  4J30 B;  3LEV A;  4R32 A;  5JSL A;  3ABK C;  2HV6 A;  4OIP F;  3MYI A;  1YAR O;  4C3E A;  2EIJ C;  3M79 A;  3TJ6 A;  1CPR A;  2JD3 A;  4MW8 A;  4EBB A;  2HMQ A;  2R7S A;  1SYQ A;  1VYK A;  1YZA A;  1R5I D;  2P0N A;  1OW8 A;  4WJ0 A;  4Q5S F;  3EGD B;  1BZ4 A;  1E2X A;  1QSP A;  1RJ9 A;  2J45 A;  4JW1 A;  4PJN A;  5DS6 A;  3DAG A;  2C04 A;  3AQC A;  2W4M A;  3BEH A;  4KBL A;  2NSG A;  4LLE A;  1Z23 A;  3RQE A;  1T9K A;  1SF8 A;  1FR0 A;  1QQ3 A;  1FFT C;  2A6H F;  1QKR A;  3SEO A;  4IAQ A;  3VRC A;  1BR4 A;  3WOD F;  3ZWI A;  4AE4 A;  4BJ6 A;  3UNG C;  1XZQ A;  4NCQ A;  3V5X A;  4FAP B;  2CCY A;  2H8A A;  1CGN A;  2IXM A;  2VAS A;  3B29 A;  3G4Z A;  1H6G A;  2BL2 A;  3C8G B;  4QI0 A;  3NG1 A;  2LP4 A;  2P7V A;  4MTG A;  1HW2 A;  1MMN A;  2XLD A;  4CIH A;  1WWP A;  1UFB A;  1FMW A;  3ECS A;  256B A;  3UMH A;  2J7P A;  3ZQV A;  2C03 A;  2IXP A;  4CDA A;  3KKB A;  4JEB A;  4O6N A;  1ZW2 A;  2B0H A;  4EKW A;  4C7O B;  2R7X A;  4ZLC A;  1MMD A;  4I1M A;  4JTC B;  1H7I A;  3HNL A;  1RMV A;  4DRI B;  1WN0 A;  2PF4 E;  3RVY A;  2L9J A;  3TUL A;  1G4W R;  2WZF A;  3MLG A;  4I3M A;  1OCR C;  4O7G A;  2CNW A;  3U2L A;  5T3W A;  3VM6 A;  3W8I A;  4AK9 A;  1TWC A;  4CBE A;  2ZXR A;  4AL1 A;  1A7D A;  1OQC A;  5KYN A;  2VCB A;  2Y3G A;  4JC7 A;  3W2W A;  4DXW A;  2D4U A;  4DRH B;  2KQ9 A;  1D0Y A;  4BG0 A;  4LDR A;  1D0Z A;  4E17 A;  1MNE A;  4JIO A;  1RKC A;  1E84 A;  4MVU A;  1NU9 C;  2LQG A;  2A6E F;  2Q9A A;  4KC9 A;  1HE1 A;  3AG1 C;  1O5H A;  3MX3 A;  3QVZ A;  4QI2 A;  1QZX A;  1JPJ A;  4RBN A;  2HMZ A;  5GPG B;  5L0F A;  2OJQ A;  3C63 A;  2L6G A;  1AEP A;  2IYL D;  1LIH A;  4BEJ A;  1OKK A;  2XS8 A;  4G7H F;  1GGQ A;  3AQB A;  1VOM A;  2WVQ A;  5KYW A;  1EQ1 A;  1RJ9 B;  1SZI A;  3O39 A;  4ULW A;  2PNO A;  3M1C B;  4XPY A;  3ZC4 A;  1T6Q A;  1C17 M;  4PK4 A;  3ABL C;  3EJN A;  1TWA A;  4U9E A;  2EPL X;  3GWN A;  5B1B C;  4CS9 A;  2KYH A;  2OEV A;  3JZ0 A;  4U5G A;  1L3P A;  4E0I A;  4XTK A;  3LS0 A;  4EIY A;  1GS9 A;  3I5P A;  1LKX A;  5HSW A;  3GAN A;  1TWG A;  3KH2 A;  3S27 A;  2XLW A;  4RD9 A;  1QVX A;  4Q4Z F;  4RDA A;  2M64 A;  4U5H A;  2FFH A;  4PAC A;  4C7O A;  1ORY A;  2QTV A;  4W8K A;  2V26 A;  1VB5 A;  3AJM A;  3GOD A;  4GQH A;  1VLT A;  3O6X A;  4PFP A;  2OJE D;  5DVW A;  3POV A;  3L8I A;  1YAU O;  1LM3 B;  2AU5 A;  2R7Q A;  1RXQ A;  2XLV A;  3NMI A;  4G78 A;  4E18 A;  1U0B B;  4O6M A;  3LLK A;  2NUT A;  3TK0 A;  1JPN A;  3W2V A;  3H2V A;  3GM1 A;  3LS1 A;  4U5B E;  1HY5 A;  4YT2 A;  3Q6N A;  1YYJ A;  3SXZ A;  5L0H A;  4U5D E;  3GEH A;  5DQT A;  4YL0 A;  3EGX A;  1ZU5 A;  4XQ1 A;  1NBB A;  2J0W A;  2YL1 A;  3VF0 A;  2IXO A;  3GOR A;  3DE9 A;  2G62 A;  2NUT B;  2Q9B A;  4CJO A;  1FMV A;  4MVS A;  1I5N A;  1CPQ A;  2ASR A;  4N4W A;  4NTF A;  4ULV A;  3U2M A;  2R7O A;  5BQH A;  1A7E A;  5JRA A;  5JS5 A;  1YVI A;  1E83 A;  3B0V C;  1KNY A;  4YK5 A;  4GYT A;  1B68 A;  2IBF A;  2LIG A;  4YL1 A;  3K1I C;  4NC3 A;  2J46 A;  2H7O A;  4P9F A;  2QY9 A;  5L0D A;  1T5O A;  3FHD A;  1YA9 A;  3DJN B;  1BBH A;  1PD0 A;  4B6I A;  4H54 A;  3E70 C;  1WGW A;  2DI3 A;  4J7Y A;  2OG2 A;  2WZG A;  4KNV A;  3N2Z B;  1CGO A;  2H7B A;  2GFH A;  3BRJ A;  4YL3 A;  1OW7 A;  5CI8 A;  3C8G D;  4AL0 A;  3X1O A;  2CYD A;  4DBQ A;  2NG1 A;  1Q0M A;  2KW3 C;  2VH3 A;  2LSE A;  3FOP A;  3A9C A;  3JYY A;  5BQG A;  2XLO A;  3DM5 A;  3S29 A;  5DS4 A;  3LES A;  3RW0 A;  1G5Z A;  4DJ9 A;  1HW1 A;  3R7C A;  5BQI A;  3ITF A;  4XLP F;  4HFK B;  2YL7 A;  3SYN A;  1HMD A;  4JZA A;  1A41 A;  1XWJ A;  2YL3 A;  2P6V A;  2PX3 A;  3OEO A;  2D5R B;  2E87 A;  5JP7 A;  2HSQ A;  3C8G A;  3ZTZ A;  5A69 A;  2L6H A;  4N6C A;  1ORS C;  2PP4 A;  3E9V A;  2LFD A;  1WAT A;  3AOU A;  2Q7R A;  1XZP A;  5A6B A;  1A0B A;  4JE9 A;  1Z5Z A;  2MYS A;  1ZW3 A;  3A11 A;  5FZT A;  4DVZ A;  4G7O F;  1HE9 A;  3IPM O;  3RIP A;  4MVQ A;  4CS9 C;  1M2V B;  1C03 A;  1Q0K A;  1OXB A;  1ZHY A;  3KPH A;  2CGE A;  3US6 A;  3ZVR A;  1LE4 A;  2BE5 F;  3AGT A;  2R7U A;  3CZ6 A;  1T6U A;  2OCC C;  3EGD A;  2XLM A;  4CJG A;  1BR1 A;  2R02 A;  2LK4 A;  4N06 A;  4X0R A;  3SXK A;  3U9M A;  5B3I A;  2R7V A;  2DYR C;  1M6T A;  3EHN A;  1J8Y F;  2F22 A;  3CSK A;  3UR3 C;  2Z15 A;  4D4N A;  4MTF A;  3OA1 A;  5AGF A;  4BPM A;  2M4E A;  4QDL A;  3RQF A;  1ZHZ A;  1NSG B;  3KYJ A;  2LD6 A;  4KNW A;  3IQC A;  1OW6 A;  3T9O A;  1DOW A;  3SXM A;  1S7Z A;  4MW3 A;  3FAP B;  1SMY F;  1JOG A;  2R05 A;  3W4Y A;  1KU2 A;  5KYX B;  3SNH A;  1TWH A;  1RCP A;  2EIM C;  2J0X A;  4N6H A;  4I44 A;  5TJ5 E;  5T1D B;  4A4A A;  1TR2 A;  2VC9 A;  3NYL A;  5HV9 A;  2XS1 A;  3CAX A;  1MQV A;  3VAY A;  2AVK A;  2MHR A;  1YA7 O;  1FFH A;  4OD4 A;  4U5E E;  2LFF A;  2A68 F;  5T3T A;  2HUJ A;  4EWC A;  1WOL A;  2KSF A;  3M15 A;  1D0X A;  1YLM A;  1MMG A;  1JRA A;  2RD9 A;  2ZXW C;  3FXH A;  4AX2 A;  4DOZ A;  5JVE A;  3EFO A;  3Q7G A;  4PFO A;  4XLN F;  2YHS A;  5AC4 A;  2OU6 A;  3LAY A;  4O6Y A;  3C7J A;  1VYI A;  1ZHT A;  4BJ1 A;  2WVO A;  4IWB A;  4CS8 A;  4XWJ A;  3IQT A;  4DBR A;  3S0X A;  1VMA A;  2R03 A;  3C8Z A;  2QNL A;  3AG3 C;  4MQ9 F;  2R7W A;  1QPU A;  2KK1 A;  2I15 A;  3HLZ A;  4EUK B;  1E86 A;  5F28 E;  3M4B A;  2HJ3 A;  2KC3 A;  2NPU A;  4CSA C;  3B0U X;  2QE9 A;  4L6R A;  5COG A;  4E0H A;  2HJM A;  4XPW A;  3H65 A;  3TQO A;  2HS5 A;  2V3C C;  4OIO F;  3SP1 A;  1GQA A;  5E3A A;  1M57 C;  1T01 A;  2EPO A;  1RKE B;  3DJU B;  4JUR I;  3LUT B;  3FMS A;  2OEX A;  2XSE A; 
#chains in the Genus database with same CATH homology
 1YYJ A;  4CX9 A;  5JUA A;  4IAR A;  1NBB A;  2YL1 A;  1APC A;  3DE9 A;  5JSL A;  3TOM A;  1YZC A;  4CJO A;  2XL6 A;  4N4W A;  1CPQ A;  3M79 A;  4ULV A;  2YLD A;  1CPR A;  5JRA A;  5JS5 A;  1E83 A;  1YZA A;  3IQ5 A;  2YLI A;  4NC3 A;  4CIP A;  1JAF A;  1BBH A;  2XL8 A;  4U9D A;  1QQ3 A;  4JKV A;  3HNK A;  1CGO A;  3VRC A;  4IAQ A;  3ZWI A;  4JEA A;  3FOP A;  2CCY A;  1CGN A;  2XLO A;  1EKY A;  4WGY A;  2XLD A;  2YL7 A;  256B A;  2YL3 A;  3L1M A;  5JLI A;  3ZQV A;  5JP7 A;  3ZTZ A;  4IB4 A;  3TOL A;  4CDA A;  4JEB A;  3IQ6 A;  2QLA A;  4JE9 A;  3HNL A;  3QW0 A;  3C62 A;  3NMK A;  1YYX A;  2XLM A;  3QVY A;  4CJG A;  5B3I A;  3HNJ A;  5JT4 A;  1M6T A;  2XLE A;  4D4N A;  5AGF A;  1E84 A;  2J8W A;  2YKZ A;  4CDY A;  3QVZ A;  2BC5 A;  2XM4 A;  1RCP A;  4N6H A;  3M4C A;  3C63 A;  1MQV A;  3M15 A;  3QW1 A;  2YLG A;  5JVE A;  1S05 A;  4D4X A;  2YL0 A;  4U9E A;  3DE8 A;  2XLH A;  1E85 A;  3FOO A;  4EIY A;  3NMJ A;  3HNI A;  3ZTM A;  4WGZ A;  2XLW A;  1QPU A;  4ER9 A;  1E86 A;  3M4B A;  2XM0 A;  4L6R A;  1LM3 B;  4CDV A;  2J9B A;  2XLV A;  3NMI A;  3U8P A;  1GQA A;  1A7V A;  3ZQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...