1E84A

Cytochrome c' from alcaligenes xylosoxidans - reduced structure
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unprecedented Proximal Binding of Nitric Oxide to Heme: Implications for Guanylate Cyclase
pubmed doi rcsb
molecule tags Electron transport
molecule keywords CYTOCHROME C'
total genus 49
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2000-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1e84A00
3NMIA 3NMJA 4NC3A 1E85A 2XLWA 256BA 2YL7A 3L1MA 3DE8A 5JUAA 5JT4A 1S05A 2XLMA 3M79A 2XLVA 4D4XA 2QLAA 4JKVA 3HNKA 1E83A 4U9EA 1YZAA 3C62A 3ZTZA 3IQ5A 5JVEA 2YLIA 4JEBA 3FOPA 4N6HA 3ZWIA 2YLGA 2YL0A 2XLHA 2XLEA 3ZTMA 4ER9A 1BBHA 1M6TA 3C63A 4CJOA 1YYJA 1JAFA 3M15A 1YYXA 5JS5A 3TOLA 1QQ3A 4WGZA 3DE9A 1A7VA 4CJGA 3M4BA 4JE9A 1APCA 2YKZA 1NBBA 3FOOA 1RCPA 3HNIA 3TOMA 2XM0A 4ULVA 4CDAA 1E84A 4CDYA 1CPQA 4U9DA 4CDVA 1LM3B 2XLOA 1EKYA 2XL6A 1YZCA 4IARA 1CGNA 2XM4A 3U8PA 3QW1A 2XL8A 4CX9A 5AGFA 3ZQVA 2CCYA 3NMKA 2XLDA 1CPRA 2YL3A 3M4CA 2J9BA 5JSLA 2YL1A 3ZQYA 4IAQA 2J8WA 3QW0A 5B3IA 4N4WA 1QPUA 1GQAA 5JP7A 2YLDA 1MQVA 3QVZA 5JLIA 4D4NA 4CIPA 4IB4A 3HNLA 1CGOA 3QVYA 3HNJA 5JRAA 4JEAA 3IQ6A 4L6RA 1E86A 3VRCA 4EIYA 4WGYA 2BC5A
chains in the Genus database with same CATH superfamily
3NMIA 2Y3DA 3PMRA 1KU2A 3EG9B 4MTFA 2IXPA 4AK9A 5E3CA 1OW8A 2WL8A 2M64A 2Q7RA 4FAPB 1ZHWA 3L1MA 4MVMA 2ZPAA 2QUPA 2DB4A 1YLMA 3ABLC 3CQZA 5JT4A 2KSFA 1PV3A 3FXHA 4JURI 3SNHA 3T6BA 3M79A 1D1BA 4YL1A 5BQIA 5F5FA 1T6QA 2H7OA 4D4XA 1GM5A 1B68A 1EA8A 3EZIA 3KPHA 1NZEA 3C62A 1PD0A 3IQ5A 5DVWA 1LI7A 2IBFA 3LNRA 3MX3A 3Q7LA 1VMAA 4DBQA 2XXAA 2EPLX 5JVEA 2NG1A 5T3TA 4C3EA 5L0FA 3FOPA 4N6HA 4PJJA 4XQ1A 1OCZC 3EFOB 2HSQA 3BRJA 1NFNA 2XLHA 5A6KA 2LIGA 4U5BE 1OCRC 5KYYA 3ZG1A 1T9KA 1OQCA 1ZU5A 2VCCA 5BQHA 1L7CA 2OG2A 5K0IA 2P6VA 4HE8D 3V5ZA 3U3BA 4DOZA 1OKKD 3W8HA 3M15A 3GWLA 2DYRC 1ZVZA 4LACB 3GEIA 3GM1A 4G78A 2XRHA 4WGZA 3TOLA 1A7VA 2L7AA 3S90A 1V4AA 4BJTA 2UUIA 2IM8A 3NKEA 1T6UA 2J0WA 3V5YA 2H7VC 2PX3A 1IZMA 4Q4ZF 1YARO 3GANA 2YKZA 1I4YA 3DD7A 4MNDA 3S28A 1NBBA 4NCQA 4AL1A 3T6JA 4A4AA 4EKWA 3K1IC 1RMVA 3HNIA 1LVKA 5KYWA 2XM0A 4N6CA 1TFOB 2OJQA 3KYIA 3L34A 1HE9A 1OW7A 3LAYA 2L6HA 3PHF2 2EILC 4P9TA 1SZIA 1RKCA 2R7SA 2CNWD 1C03A 2E87A 1LM3B 1TFKB 4MVZA 3FAJA 2R7RA 5AC4A 2NPUA 4U5EE 4CSAC 3C7JA 2WVOA 4KNVA 5DQZA 4BJ6A 1JPJA 1KNYA 4DVYP 3EGDA 4IARA 4XPXA 4CDYA 3VM6A 3H65A 4PACA 1R4TA 1D0ZA 1D0XA 4IJJA 4PJLA 3RFYA 3A9CA 2R03A 3N24A 3N0TA 2MYSA 3U9MA 2H7BA 3MBGA 5FCLA 4CX9A 1YAUO 3KYJA 4I1OB 1OW6A 2G3VA 4JZAA 5HV9A 4U5GA 2CCYA 3VAYA 1PCXA 1OXBA 3LLKA 4FWVA 1CPRA 5GPGB 2XL4A 3JYHA 2YEVA 4KNWA 4P9FA 3E9VA 3SXKA 3GODA 2LSEA 1N1CA 3H2VA 4ULWA 1IW7F 1A0BA 3CEXA 1Q0DA 4NTBA 4NY3A 3S9OA 3FDQA 2P7VA 1HE1A 2PFDA 3W2VA 1A7DA 1G5ZA 1K40A 1YDIA 2PP4A 4BEJA 3W2WA 4EHPA 3V7OA 4YT8A 4IB4A 3JYYA 2A6EF 4WJ0A 2NUPA 4EBKA 4C7OA 4MW3A 3ZIBA 3IQ6A 2EIKC 2VH3A 2H8AA 3FMSA 1A41A 4K1OA 5L3VA 1E86A 4UDVA 2NUTA 2IOQA 2C04A 2XS8A 2ETSA 3EH1A 1S7ZA 3G4ZA 3OWTA 1OR2A 4GQHA 3RIPA 3O10A 4MS2A 3UMHA 1Y6DA 2HZ8A 1QSPA 4NC3A 3RH3A 5AC5A 3FVYA 1WGWA 1ZU4A 2L6FA 3R2PA 2J9WA 1JR8A 1WOLA 1S05A 4G0HA 4JTDB 2XLMA 2GWWA 3UMIA 2V3CC 2QTVA 3JSZA 3N2ZB 2W9YA 2VASA 4JKVA 2LK4A 3LUTB 5DLJA 3AG2C 5KYNA 1RXQA 1E83A 1HMDA 1LPEA 3ZTZA 4RDAA 3HTKC 3RW0A 3C8ZA 1FFHA 4K0DA 2AU5A 4H54A 2W4BA 1VTMP 1MMAA 1KTMA 3IHUA 5KYUA 2EPMX 2W45A 4QDLA 3SZRA 3EHMA 3W4YA 3ZTMA 4ER9A 3E70C 3V5XA 4JRZA 4B6IA 1QLEC 2NUPB 1M6TA 1M2VB 2YVKA 2ZXRA 3C63A 4C3BA 4C7OB 2EIMC 1SR2A 4HFKB 4IAOA 2PF4E 2YRFA 2EPNA 1U6HA 1YYXA 2PNOA 2KNHA 3RQEA 4YWQA 1OCCC 2OQMA 2R7QA 1AEPA 2CDQA 4EWCA 3JRMO 3QZCA 4O6NA 5B1BC 2WVQA 5E2QA 2FFHA 1I4ZA 5D91A 2IXNA 3NYJA 1TQGA 2AWCA 5COMA 4J7YA 4LLCA 2DI3A 1GS9A 3JZ0A 3TD7A 1RJ9B 5EK0A 1Z6AA 2QNLA 2VCBA 5TJ5E 3UR3C 3LESA 4CDAA 3KH2A 1LE4A 5EGYA 1SYQA 3EZHA 3GEEA 5EHHA 3LNMB 4N06A 3CZ6A 1VB5A 1LS1A 2A1DD 1EKYA 2XL6A 3M1CB 4DXWA 3QMKA 3AG1C 3ZSUA 5T3WA 3EGXB 2Q00A 4K7BA 1U89A 3DJUB 1G4US 2P61A 3DAGA 4YN0B 2A0BA 3B9QA 4E7ZA 3DKAA 4I3MA 3TJ5A 3KKBA 3GORA 5L0GA 5L0IA 1T6IA 5KYUB 1K05A 2XL8A 3DMDA 1MNDA 2PX0A 2NSFA 3F47A 3H2UA 2HUJA 3MYFA 2P0NA 4DRIB 4BJ5A 3UGOA 2XS1A 3NKDA 2XLDA 3SYNA 2Q9BA 4JW1A 3R7CA 4YT4A 2XXAB 2ASRA 3O39A 2NSGA 4EUKB 3RKOF 3I5PA 3M4CA 5DS6A 4FESA 2J9BA 1TWCA 1YVIA 1ZHTA 2G62A 1BR2A 1G4WR 5B3IA 4X0RA 1FAPB 2HJ3A 2CGEA 3X1OA 4GEHA 3U2LA 2HSBA 1W2WA 4W8PA 5COFA 4XLNF 4D4NA 3ABMC 4HEAJ 3I4UA 4O6MA 1DOWA 3NG1A 2AP3A 5JRAA 2OKUA 2R7VA 3SXZA 3QTHA 2L6GA 3POVA 3B71A 1JRAA 4MTGA 3VRCA 4J32B 4E0HA 4OIOF 3U8VA 2J9VA 2L81A 2UUHA 5KYXB 1JMWA 1BR4A 4JCZA 1NU9C 3J06A 4CS9A 4IRUA 1HW1A 4BEMJ 3SXYA 1E85A 256BA 4MW8A 4DVZA 3RQGA 3DE8A 4JJFA 1MMNA 1I5NA 1XWJA 3AJMA 4XPYA 1OKKA 2ZXPA 1LI5A 2YQYA 3JTLO 3S27A 3T9OA 4JC7A 4CS8A 4J7TA 1FMVA 2XSEA 3RYLA 1XZPA 2HV7A 1H7IA 3S84A 2QE9A 4XEKA 2R7XA 4DBRA 4OINF 1FMWA 2WZFA 2QLAA 3JRTA 1Q0MA 3WODF 2J7PA 2Q4FA 3AGUA 3HNKA 4Q5SF 3JCUQ 2X0CA 1FTSA 4H4KC 4U9EA 4BJ1A 1UFBA 1VLTA 2ZXOA 4I1MA 4OD5A 2EIJC 1L3PA 3ZDLA 2IYLD 3HLZA 3U2MA 5FZTA 1JOGA 3EJNA 3EH2A 3RVZA 4JEBA 3ASOC 3RVYA 2P1AA 2A6HF 1M2OA 2LFFA 2OU6A 1O3UA 1ZYRF 3US6A 2XLEA 2Q3TA 1V54C 2KYHA 3NYMA 4CIHA 1OCOC 2J45A 1BBHA 1RKEA 2MWQA 5B3SC 3L8JA 3UGPA 1FR0A 2J46A 2FAPB 2OEVA 2YZSA 1JAFA 3Q7GA 3WHNA 1H9TA 3NYLA 1SMYF 3LEVA 5CI8A 2Q9AA 2EINC 4PJMA 1D0YA 3DAFA 4M63A 3TJ6A 1QQ3A 5JS5A 4RD9A 3S0XA 3DE9A 4OD4A 1YA9A 2KQ9A 2QY9A 4Z9JA 2R9RB 4AE4B 4DRHB 2WVNA 3M4BA 4ANJA 1TR2A 2HMQA 3BEHA 1TWGA 3C8GD 4JE9A 4O79A 1TWHA 5E3AA 1VYIA 1APCA 4IWBA 3SP1A 3U5SA 3DM9B 3FOOA 5T1DB 5BQGA 4FX5A 2ICWG 4A2NB 3MLGA 4F4BA 3NDBB 1ORJA 4ULVA 3S29A 2HV6A 2J0XA 3EQLF 2R7TA 4I44A 4MVOA 1WASA 4PK4A 3AG4C 4NTAA 1E84A 3WG7C 5F5HA 1HW2A 4U9DA 1BDJB 3HKKA 5L3QA 4CDVA 1H9GA 5COGA 3EPVA 1E2XA 4Z9IA 4CS9C 2J9UA 1J8YF 3EG9A 3GM3A 3K7DA 3UNGC 5A6JA 3ABKC 2ZXWC 2C03A 1ZW3A 1CGNA 3GM2A 3VYWA 2LCHA 3A11A 3PCVA 1DOVA 2XM4A 4KC9A 3U8PA 2HMZA 4CS8C 2B0JA 3TK0A 1BR1A 2GDCA 4QI0A 3F46A 4IGGA 1LE2A 5AGFA 3ITFA 5B1AC 3ZQVA 5BUOA 5CIVA 1M2VA 3W8IA 2I8BA 2PBEA 3IQTA 1EI7A 3LJBA 5L0CA 2YL3A 1WN0A 2R7UA 2AWYA 3Q6MA 1ST6A 3SEOA 3T4RA 1FFTC 3U3FA 3JSEO 4U5CE 1QKRA 3AQCA 2GAQA 4E18A 2CNWA 3QW0A 1JPNA 3LS0A 2KW3C 1SF8A 4N4WA 3Q6NA 5JP7A 4G7HF 3EFOA 1O5HA 1ZHXA 2YHSA 1F1MA 4E0IA 2FGYA 1MQVA 3UMKA 4LERA 3RF3A 2YWAA 4O7GA 4XEFA 3B29A 4MTOA 3HNLA 1CGOA 2DYSC 1RJ9A 3QVYA 1XZQA 2ZD9A 4JEAA 1GGQA 5HSWA 3KMIA 1VK5A 1C17M 4L6RA 3DM5A 1VLSA 2AVKA 2DGJA 2KK1A 2OEXA 2VB6A 1M56C 5CI9A 4XWJA 2WZGA 1V55C 2I15A 4WGYA 4Z9HA 4EIYA 3X2QC 3B0VC 4OIQF 4BJ6C 3C8GB 3G4XA 4DJ9A 1LIHA 3NMJA 2CYDA 3EGXA 3LLIA 1Z7Qc 2XLWA 1VYKA 1WWPA 4MVSA 2Y39A 2YL7A 4GYTA 3IQCA 4JCHA 4BG0A 1D1CA 5JUAA 2KC3A 4BJ5C 3CAXA 2D4UA 5IY5C 5KYWB 3PDMP 4JIOA 4G7OF 4KBLA 2M4EA 4NQFA 3K1HA 3L8IA 4XLPF 2XLVA 3ZC4A 1PD1A 2A0UA 2GFHA 1UG7A 2R02A 2WZLA 4XPWA 4LDQA 2OCCC 1ZHYA 5L0HA 3CSKA 1O87A 4LDRA 4JVSA 1YZAA 3NRHA 1J8MF 1Z5ZA 4EBBA 1ORYA 4MVUA 3EGDB 1D1AA 2L9JA 5L0JA 3DWWA 3L0IA 1ZW2A 2YLIA 1HMOA 4R32A 4CSAA 4YL0A 2A69F 4BPMA 3ZWIA 2EPKX 2YLGA 5E33A 2OOCA 2YL0A 4YT5A 4CBEA 2R25A 2R7OA 5DS4A 2CW0F 3DJNB 3KL4A 3O55A 4U5HA 1NLXA 3T6GB 4QI2A 5A6BA 1TWAA 1V74B 2Y3GA 2G3KA 4W8KA 3WAQA 4CJOA 1YYJA 1QZXA 2F22A 1M57C 3AGTA 3ASNC 4LDKA 2KJGA 1Z23A 1WTYA 3K66A 3VF0A 2R7WA 2HJMA 4HFFB 4MVRA 2W4MA 5KYXA 2B0HA 1NFOA 4AX2A 4O6YA 1Z63A 4AL0A 1ORSC 4CJGA 3C8GA 1NU7D 1Z3IX 3DXJF 4G7ZF 1EQ1A 4Q7CA 1HY5A 4E7SA 3GWNA 2LD6A 1H6GA 1R5ID 1WATA 5A6AA 1NG1A 1T5OA 4PFPA 2VCAA 2O9XA 3K1IA 4U5FE 3JT1A 1YA7O 1RCPA 2JPUA 4ONSA 3TOMA 2WB7A 4YJWA 2J7PD 4XEVA 4P6IC 4YT2A 1BZ4A 2LP4A 1YJGA 3K33A 3SXMA 2EPOA 2IXMA 2NUTB 1Q0FA 2HS5A 2JD3A 2RSEB 2V26A 3GEHA 1CPQA 3K6BA 3I5QA 4MQ9F 4YL3A 5A69A 2XLOA 1T01A 4JTCB 3MFNA 4NTFA 5L0DA 5F28E 4WABA 4C3DA 1ZHZA 1YZCA 2MHRA 2Q9CA 3FHDA 1QVXA 2Y3HA 2GA0A 3OEOA 3LEOA 2Y3BA 2D5RB 2HKVA 2Y69C 3EHNA 5A6BD 2LFDA 2KGOA 1Q0KA 2OJED 3OA1A 3QW1A 4U5DE 4CS7A 4ZLCA 3AQBA 2R05A 4PR9A 1RKEB 2Z15A 4JTAB 5D92A 1VOMA 1K04A 3NMKA 2RD9A 3G50A 1TKNA 4LLEA 1NSGB 2A68F 2BL2A 3B0PA 4EBJA 4ZLDA 2LQGA 4PFOA 4MVQA 3RQFA 5DQTA 4OIRF 3ATPA 1OXKA 2IXOA 4KI2A 3IEEA 5JSLA 1MMGA 2BE5F 1A7EA 3DZAA 1AVOB 2JX0A 2YL1A 4XTKA 3LS1A 4AE4A 4PJNA 3AG3C 3ZQYA 4IAQA 2HFIA 2J8WA 4JJGA 4DRJB 4OIPF 2TMVP 1QPUA 1GQAA 1Y4CA 1FNTc 2VC9A 1MNEA 1AUEA 3C18A 3ZVRA 1LKXA 2YLDA 1C02A 3IPMO 3QVZA 5JLIA 1Q0GA 3AOUA 4J30B 4CIPA 1OR3A 3TQOA 5KYYB 3B0UX 1MMDA 3HNJA 1G8XA 1ZZPA 4YK5A 1CGME 3U0CA 3MYIA 3TULA 3FAPB 4E17A 3HJCA 5DS5A 2X51A 1U0BB 3DI5A 3ECSA 3O6XA 4RBNA 3U9JA 1LS4A 2BC5A
chains in the Genus database with same CATH topology
3NMIA 3NMJA 4NC3A 1E85A 2XLWA 256BA 2YL7A 3L1MA 3DE8A 5JUAA 5JT4A 1S05A 2XLMA 3M79A 2XLVA 4D4XA 2QLAA 4JKVA 3HNKA 1E83A 4U9EA 1YZAA 3C62A 3ZTZA 3IQ5A 5JVEA 2YLIA 4JEBA 3FOPA 4N6HA 3ZWIA 2YLGA 2YL0A 2XLHA 2XLEA 3ZTMA 4ER9A 1BBHA 1M6TA 3C63A 4CJOA 1YYJA 1JAFA 3M15A 1YYXA 5JS5A 3TOLA 1QQ3A 4WGZA 3DE9A 1A7VA 4CJGA 3M4BA 4JE9A 1APCA 2YKZA 1NBBA 3FOOA 1RCPA 3HNIA 3TOMA 2XM0A 4ULVA 4CDAA 1E84A 4CDYA 1CPQA 4U9DA 4CDVA 1LM3B 2XLOA 1EKYA 2XL6A 1YZCA 4IARA 1CGNA 2XM4A 3U8PA 3QW1A 2XL8A 4CX9A 5AGFA 3ZQVA 2CCYA 3NMKA 2XLDA 1CPRA 2YL3A 3M4CA 2J9BA 5JSLA 2YL1A 3ZQYA 4IAQA 2J8WA 3QW0A 5B3IA 4N4WA 1QPUA 1GQAA 5JP7A 2YLDA 1MQVA 3QVZA 5JLIA 4D4NA 4CIPA 4IB4A 3HNLA 1CGOA 3QVYA 3HNJA 5JRAA 4JEAA 3IQ6A 4L6RA 1E86A 3VRCA 4EIYA 4WGYA 2BC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NMI A;  3NMJ A;  4NC3 A;  1E85 A;  2XLW A;  256B A;  2YL7 A;  3L1M A;  3DE8 A;  5JUA A;  5JT4 A;  1S05 A;  2XLM A;  3M79 A;  2XLV A;  4D4X A;  2QLA A;  4JKV A;  3HNK A;  1E83 A;  4U9E A;  1YZA A;  3C62 A;  3ZTZ A;  3IQ5 A;  5JVE A;  2YLI A;  4JEB A;  3FOP A;  4N6H A;  3ZWI A;  2YLG A;  2YL0 A;  2XLH A;  2XLE A;  3ZTM A;  4ER9 A;  1BBH A;  1M6T A;  3C63 A;  4CJO A;  1YYJ A;  1JAF A;  3M15 A;  1YYX A;  5JS5 A;  3TOL A;  1QQ3 A;  4WGZ A;  3DE9 A;  1A7V A;  4CJG A;  3M4B A;  4JE9 A;  1APC A;  2YKZ A;  1NBB A;  3FOO A;  1RCP A;  3HNI A;  3TOM A;  2XM0 A;  4ULV A;  4CDA A;  1E84 A;  4CDY A;  1CPQ A;  4U9D A;  4CDV A;  1LM3 B;  2XLO A;  1EKY A;  2XL6 A;  1YZC A;  4IAR A;  1CGN A;  2XM4 A;  3U8P A;  3QW1 A;  2XL8 A;  4CX9 A;  5AGF A;  3ZQV A;  2CCY A;  3NMK A;  2XLD A;  1CPR A;  2YL3 A;  3M4C A;  2J9B A;  5JSL A;  2YL1 A;  3ZQY A;  4IAQ A;  2J8W A;  3QW0 A;  5B3I A;  4N4W A;  1QPU A;  1GQA A;  5JP7 A;  2YLD A;  1MQV A;  3QVZ A;  5JLI A;  4D4N A;  4CIP A;  4IB4 A;  3HNL A;  1CGO A;  3QVY A;  3HNJ A;  5JRA A;  4JEA A;  3IQ6 A;  4L6R A;  1E86 A;  3VRC A;  4EIY A;  4WGY A;  2BC5 A; 
#chains in the Genus database with same CATH topology
 3NMI A;  2Y3D A;  3PMR A;  1KU2 A;  3EG9 B;  4MTF A;  2IXP A;  4AK9 A;  5E3C A;  1OW8 A;  2WL8 A;  2M64 A;  2Q7R A;  4FAP B;  1ZHW A;  3L1M A;  4MVM A;  2ZPA A;  2QUP A;  2DB4 A;  1YLM A;  3ABL C;  3CQZ A;  5JT4 A;  2KSF A;  1PV3 A;  3FXH A;  4JUR I;  3SNH A;  3T6B A;  3M79 A;  1D1B A;  4YL1 A;  5BQI A;  5F5F A;  1T6Q A;  2H7O A;  4D4X A;  1GM5 A;  1B68 A;  1EA8 A;  3EZI A;  3KPH A;  1NZE A;  3C62 A;  1PD0 A;  3IQ5 A;  5DVW A;  1LI7 A;  2IBF A;  3LNR A;  3MX3 A;  3Q7L A;  1VMA A;  4DBQ A;  2XXA A;  2EPL X;  5JVE A;  2NG1 A;  5T3T A;  4C3E A;  5L0F A;  3FOP A;  4N6H A;  4PJJ A;  4XQ1 A;  1OCZ C;  3EFO B;  2HSQ A;  3BRJ A;  1NFN A;  2XLH A;  5A6K A;  2LIG A;  4U5B E;  1OCR C;  5KYY A;  3ZG1 A;  1T9K A;  1OQC A;  1ZU5 A;  2VCC A;  5BQH A;  1L7C A;  2OG2 A;  5K0I A;  2P6V A;  4HE8 D;  3V5Z A;  3U3B A;  4DOZ A;  1OKK D;  3W8H A;  3M15 A;  3GWL A;  2DYR C;  1ZVZ A;  4LAC B;  3GEI A;  3GM1 A;  4G78 A;  2XRH A;  4WGZ A;  3TOL A;  1A7V A;  2L7A A;  3S90 A;  1V4A A;  4BJT A;  2UUI A;  2IM8 A;  3NKE A;  1T6U A;  2J0W A;  3V5Y A;  2H7V C;  2PX3 A;  1IZM A;  4Q4Z F;  1YAR O;  3GAN A;  2YKZ A;  1I4Y A;  3DD7 A;  4MND A;  3S28 A;  1NBB A;  4NCQ A;  4AL1 A;  3T6J A;  4A4A A;  4EKW A;  3K1I C;  1RMV A;  3HNI A;  1LVK A;  5KYW A;  2XM0 A;  4N6C A;  1TFO B;  2OJQ A;  3KYI A;  3L34 A;  1HE9 A;  1OW7 A;  3LAY A;  2L6H A;  3PHF 2;  2EIL C;  4P9T A;  1SZI A;  1RKC A;  2R7S A;  2CNW D;  1C03 A;  2E87 A;  1LM3 B;  1TFK B;  4MVZ A;  3FAJ A;  2R7R A;  5AC4 A;  2NPU A;  4U5E E;  4CSA C;  3C7J A;  2WVO A;  4KNV A;  5DQZ A;  4BJ6 A;  1JPJ A;  1KNY A;  4DVY P;  3EGD A;  4IAR A;  4XPX A;  4CDY A;  3VM6 A;  3H65 A;  4PAC A;  1R4T A;  1D0Z A;  1D0X A;  4IJJ A;  4PJL A;  3RFY A;  3A9C A;  2R03 A;  3N24 A;  3N0T A;  2MYS A;  3U9M A;  2H7B A;  3MBG A;  5FCL A;  4CX9 A;  1YAU O;  3KYJ A;  4I1O B;  1OW6 A;  2G3V A;  4JZA A;  5HV9 A;  4U5G A;  2CCY A;  3VAY A;  1PCX A;  1OXB A;  3LLK A;  4FWV A;  1CPR A;  5GPG B;  2XL4 A;  3JYH A;  2YEV A;  4KNW A;  4P9F A;  3E9V A;  3SXK A;  3GOD A;  2LSE A;  1N1C A;  3H2V A;  4ULW A;  1IW7 F;  1A0B A;  3CEX A;  1Q0D A;  4NTB A;  4NY3 A;  3S9O A;  3FDQ A;  2P7V A;  1HE1 A;  2PFD A;  3W2V A;  1A7D A;  1G5Z A;  1K40 A;  1YDI A;  2PP4 A;  4BEJ A;  3W2W A;  4EHP A;  3V7O A;  4YT8 A;  4IB4 A;  3JYY A;  2A6E F;  4WJ0 A;  2NUP A;  4EBK A;  4C7O A;  4MW3 A;  3ZIB A;  3IQ6 A;  2EIK C;  2VH3 A;  2H8A A;  3FMS A;  1A41 A;  4K1O A;  5L3V A;  1E86 A;  4UDV A;  2NUT A;  2IOQ A;  2C04 A;  2XS8 A;  2ETS A;  3EH1 A;  1S7Z A;  3G4Z A;  3OWT A;  1OR2 A;  4GQH A;  3RIP A;  3O10 A;  4MS2 A;  3UMH A;  1Y6D A;  2HZ8 A;  1QSP A;  4NC3 A;  3RH3 A;  5AC5 A;  3FVY A;  1WGW A;  1ZU4 A;  2L6F A;  3R2P A;  2J9W A;  1JR8 A;  1WOL A;  1S05 A;  4G0H A;  4JTD B;  2XLM A;  2GWW A;  3UMI A;  2V3C C;  2QTV A;  3JSZ A;  3N2Z B;  2W9Y A;  2VAS A;  4JKV A;  2LK4 A;  3LUT B;  5DLJ A;  3AG2 C;  5KYN A;  1RXQ A;  1E83 A;  1HMD A;  1LPE A;  3ZTZ A;  4RDA A;  3HTK C;  3RW0 A;  3C8Z A;  1FFH A;  4K0D A;  2AU5 A;  4H54 A;  2W4B A;  1VTM P;  1MMA A;  1KTM A;  3IHU A;  5KYU A;  2EPM X;  2W45 A;  4QDL A;  3SZR A;  3EHM A;  3W4Y A;  3ZTM A;  4ER9 A;  3E70 C;  3V5X A;  4JRZ A;  4B6I A;  1QLE C;  2NUP B;  1M6T A;  1M2V B;  2YVK A;  2ZXR A;  3C63 A;  4C3B A;  4C7O B;  2EIM C;  1SR2 A;  4HFK B;  4IAO A;  2PF4 E;  2YRF A;  2EPN A;  1U6H A;  1YYX A;  2PNO A;  2KNH A;  3RQE A;  4YWQ A;  1OCC C;  2OQM A;  2R7Q A;  1AEP A;  2CDQ A;  4EWC A;  3JRM O;  3QZC A;  4O6N A;  5B1B C;  2WVQ A;  5E2Q A;  2FFH A;  1I4Z A;  5D91 A;  2IXN A;  3NYJ A;  1TQG A;  2AWC A;  5COM A;  4J7Y A;  4LLC A;  2DI3 A;  1GS9 A;  3JZ0 A;  3TD7 A;  1RJ9 B;  5EK0 A;  1Z6A A;  2QNL A;  2VCB A;  5TJ5 E;  3UR3 C;  3LES A;  4CDA A;  3KH2 A;  1LE4 A;  5EGY A;  1SYQ A;  3EZH A;  3GEE A;  5EHH A;  3LNM B;  4N06 A;  3CZ6 A;  1VB5 A;  1LS1 A;  2A1D D;  1EKY A;  2XL6 A;  3M1C B;  4DXW A;  3QMK A;  3AG1 C;  3ZSU A;  5T3W A;  3EGX B;  2Q00 A;  4K7B A;  1U89 A;  3DJU B;  1G4U S;  2P61 A;  3DAG A;  4YN0 B;  2A0B A;  3B9Q A;  4E7Z A;  3DKA A;  4I3M A;  3TJ5 A;  3KKB A;  3GOR A;  5L0G A;  5L0I A;  1T6I A;  5KYU B;  1K05 A;  2XL8 A;  3DMD A;  1MND A;  2PX0 A;  2NSF A;  3F47 A;  3H2U A;  2HUJ A;  3MYF A;  2P0N A;  4DRI B;  4BJ5 A;  3UGO A;  2XS1 A;  3NKD A;  2XLD A;  3SYN A;  2Q9B A;  4JW1 A;  3R7C A;  4YT4 A;  2XXA B;  2ASR A;  3O39 A;  2NSG A;  4EUK B;  3RKO F;  3I5P A;  3M4C A;  5DS6 A;  4FES A;  2J9B A;  1TWC A;  1YVI A;  1ZHT A;  2G62 A;  1BR2 A;  1G4W R;  5B3I A;  4X0R A;  1FAP B;  2HJ3 A;  2CGE A;  3X1O A;  4GEH A;  3U2L A;  2HSB A;  1W2W A;  4W8P A;  5COF A;  4XLN F;  4D4N A;  3ABM C;  4HEA J;  3I4U A;  4O6M A;  1DOW A;  3NG1 A;  2AP3 A;  5JRA A;  2OKU A;  2R7V A;  3SXZ A;  3QTH A;  2L6G A;  3POV A;  3B71 A;  1JRA A;  4MTG A;  3VRC A;  4J32 B;  4E0H A;  4OIO F;  3U8V A;  2J9V A;  2L81 A;  2UUH A;  5KYX B;  1JMW A;  1BR4 A;  4JCZ A;  1NU9 C;  3J06 A;  4CS9 A;  4IRU A;  1HW1 A;  4BEM J;  3SXY A;  1E85 A;  256B A;  4MW8 A;  4DVZ A;  3RQG A;  3DE8 A;  4JJF A;  1MMN A;  1I5N A;  1XWJ A;  3AJM A;  4XPY A;  1OKK A;  2ZXP A;  1LI5 A;  2YQY A;  3JTL O;  3S27 A;  3T9O A;  4JC7 A;  4CS8 A;  4J7T A;  1FMV A;  2XSE A;  3RYL A;  1XZP A;  2HV7 A;  1H7I A;  3S84 A;  2QE9 A;  4XEK A;  2R7X A;  4DBR A;  4OIN F;  1FMW A;  2WZF A;  2QLA A;  3JRT A;  1Q0M A;  3WOD F;  2J7P A;  2Q4F A;  3AGU A;  3HNK A;  4Q5S F;  3JCU Q;  2X0C A;  1FTS A;  4H4K C;  4U9E A;  4BJ1 A;  1UFB A;  1VLT A;  2ZXO A;  4I1M A;  4OD5 A;  2EIJ C;  1L3P A;  3ZDL A;  2IYL D;  3HLZ A;  3U2M A;  5FZT A;  1JOG A;  3EJN A;  3EH2 A;  3RVZ A;  4JEB A;  3ASO C;  3RVY A;  2P1A A;  2A6H F;  1M2O A;  2LFF A;  2OU6 A;  1O3U A;  1ZYR F;  3US6 A;  2XLE A;  2Q3T A;  1V54 C;  2KYH A;  3NYM A;  4CIH A;  1OCO C;  2J45 A;  1BBH A;  1RKE A;  2MWQ A;  5B3S C;  3L8J A;  3UGP A;  1FR0 A;  2J46 A;  2FAP B;  2OEV A;  2YZS A;  1JAF A;  3Q7G A;  3WHN A;  1H9T A;  3NYL A;  1SMY F;  3LEV A;  5CI8 A;  2Q9A A;  2EIN C;  4PJM A;  1D0Y A;  3DAF A;  4M63 A;  3TJ6 A;  1QQ3 A;  5JS5 A;  4RD9 A;  3S0X A;  3DE9 A;  4OD4 A;  1YA9 A;  2KQ9 A;  2QY9 A;  4Z9J A;  2R9R B;  4AE4 B;  4DRH B;  2WVN A;  3M4B A;  4ANJ A;  1TR2 A;  2HMQ A;  3BEH A;  1TWG A;  3C8G D;  4JE9 A;  4O79 A;  1TWH A;  5E3A A;  1VYI A;  1APC A;  4IWB A;  3SP1 A;  3U5S A;  3DM9 B;  3FOO A;  5T1D B;  5BQG A;  4FX5 A;  2ICW G;  4A2N B;  3MLG A;  4F4B A;  3NDB B;  1ORJ A;  4ULV A;  3S29 A;  2HV6 A;  2J0X A;  3EQL F;  2R7T A;  4I44 A;  4MVO A;  1WAS A;  4PK4 A;  3AG4 C;  4NTA A;  1E84 A;  3WG7 C;  5F5H A;  1HW2 A;  4U9D A;  1BDJ B;  3HKK A;  5L3Q A;  4CDV A;  1H9G A;  5COG A;  3EPV A;  1E2X A;  4Z9I A;  4CS9 C;  2J9U A;  1J8Y F;  3EG9 A;  3GM3 A;  3K7D A;  3UNG C;  5A6J A;  3ABK C;  2ZXW C;  2C03 A;  1ZW3 A;  1CGN A;  3GM2 A;  3VYW A;  2LCH A;  3A11 A;  3PCV A;  1DOV A;  2XM4 A;  4KC9 A;  3U8P A;  2HMZ A;  4CS8 C;  2B0J A;  3TK0 A;  1BR1 A;  2GDC A;  4QI0 A;  3F46 A;  4IGG A;  1LE2 A;  5AGF A;  3ITF A;  5B1A C;  3ZQV A;  5BUO A;  5CIV A;  1M2V A;  3W8I A;  2I8B A;  2PBE A;  3IQT A;  1EI7 A;  3LJB A;  5L0C A;  2YL3 A;  1WN0 A;  2R7U A;  2AWY A;  3Q6M A;  1ST6 A;  3SEO A;  3T4R A;  1FFT C;  3U3F A;  3JSE O;  4U5C E;  1QKR A;  3AQC A;  2GAQ A;  4E18 A;  2CNW A;  3QW0 A;  1JPN A;  3LS0 A;  2KW3 C;  1SF8 A;  4N4W A;  3Q6N A;  5JP7 A;  4G7H F;  3EFO A;  1O5H A;  1ZHX A;  2YHS A;  1F1M A;  4E0I A;  2FGY A;  1MQV A;  3UMK A;  4LER A;  3RF3 A;  2YWA A;  4O7G A;  4XEF A;  3B29 A;  4MTO A;  3HNL A;  1CGO A;  2DYS C;  1RJ9 A;  3QVY A;  1XZQ A;  2ZD9 A;  4JEA A;  1GGQ A;  5HSW A;  3KMI A;  1VK5 A;  1C17 M;  4L6R A;  3DM5 A;  1VLS A;  2AVK A;  2DGJ A;  2KK1 A;  2OEX A;  2VB6 A;  1M56 C;  5CI9 A;  4XWJ A;  2WZG A;  1V55 C;  2I15 A;  4WGY A;  4Z9H A;  4EIY A;  3X2Q C;  3B0V C;  4OIQ F;  4BJ6 C;  3C8G B;  3G4X A;  4DJ9 A;  1LIH A;  3NMJ A;  2CYD A;  3EGX A;  3LLI A;  1Z7Q c;  2XLW A;  1VYK A;  1WWP A;  4MVS A;  2Y39 A;  2YL7 A;  4GYT A;  3IQC A;  4JCH A;  4BG0 A;  1D1C A;  5JUA A;  2KC3 A;  4BJ5 C;  3CAX A;  2D4U A;  5IY5 C;  5KYW B;  3PDM P;  4JIO A;  4G7O F;  4KBL A;  2M4E A;  4NQF A;  3K1H A;  3L8I A;  4XLP F;  2XLV A;  3ZC4 A;  1PD1 A;  2A0U A;  2GFH A;  1UG7 A;  2R02 A;  2WZL A;  4XPW A;  4LDQ A;  2OCC C;  1ZHY A;  5L0H A;  3CSK A;  1O87 A;  4LDR A;  4JVS A;  1YZA A;  3NRH A;  1J8M F;  1Z5Z A;  4EBB A;  1ORY A;  4MVU A;  3EGD B;  1D1A A;  2L9J A;  5L0J A;  3DWW A;  3L0I A;  1ZW2 A;  2YLI A;  1HMO A;  4R32 A;  4CSA A;  4YL0 A;  2A69 F;  4BPM A;  3ZWI A;  2EPK X;  2YLG A;  5E33 A;  2OOC A;  2YL0 A;  4YT5 A;  4CBE A;  2R25 A;  2R7O A;  5DS4 A;  2CW0 F;  3DJN B;  3KL4 A;  3O55 A;  4U5H A;  1NLX A;  3T6G B;  4QI2 A;  5A6B A;  1TWA A;  1V74 B;  2Y3G A;  2G3K A;  4W8K A;  3WAQ A;  4CJO A;  1YYJ A;  1QZX A;  2F22 A;  1M57 C;  3AGT A;  3ASN C;  4LDK A;  2KJG A;  1Z23 A;  1WTY A;  3K66 A;  3VF0 A;  2R7W A;  2HJM A;  4HFF B;  4MVR A;  2W4M A;  5KYX A;  2B0H A;  1NFO A;  4AX2 A;  4O6Y A;  1Z63 A;  4AL0 A;  1ORS C;  4CJG A;  3C8G A;  1NU7 D;  1Z3I X;  3DXJ F;  4G7Z F;  1EQ1 A;  4Q7C A;  1HY5 A;  4E7S A;  3GWN A;  2LD6 A;  1H6G A;  1R5I D;  1WAT A;  5A6A A;  1NG1 A;  1T5O A;  4PFP A;  2VCA A;  2O9X A;  3K1I A;  4U5F E;  3JT1 A;  1YA7 O;  1RCP A;  2JPU A;  4ONS A;  3TOM A;  2WB7 A;  4YJW A;  2J7P D;  4XEV A;  4P6I C;  4YT2 A;  1BZ4 A;  2LP4 A;  1YJG A;  3K33 A;  3SXM A;  2EPO A;  2IXM A;  2NUT B;  1Q0F A;  2HS5 A;  2JD3 A;  2RSE B;  2V26 A;  3GEH A;  1CPQ A;  3K6B A;  3I5Q A;  4MQ9 F;  4YL3 A;  5A69 A;  2XLO A;  1T01 A;  4JTC B;  3MFN A;  4NTF A;  5L0D A;  5F28 E;  4WAB A;  4C3D A;  1ZHZ A;  1YZC A;  2MHR A;  2Q9C A;  3FHD A;  1QVX A;  2Y3H A;  2GA0 A;  3OEO A;  3LEO A;  2Y3B A;  2D5R B;  2HKV A;  2Y69 C;  3EHN A;  5A6B D;  2LFD A;  2KGO A;  1Q0K A;  2OJE D;  3OA1 A;  3QW1 A;  4U5D E;  4CS7 A;  4ZLC A;  3AQB A;  2R05 A;  4PR9 A;  1RKE B;  2Z15 A;  4JTA B;  5D92 A;  1VOM A;  1K04 A;  3NMK A;  2RD9 A;  3G50 A;  1TKN A;  4LLE A;  1NSG B;  2A68 F;  2BL2 A;  3B0P A;  4EBJ A;  4ZLD A;  2LQG A;  4PFO A;  4MVQ A;  3RQF A;  5DQT A;  4OIR F;  3ATP A;  1OXK A;  2IXO A;  4KI2 A;  3IEE A;  5JSL A;  1MMG A;  2BE5 F;  1A7E A;  3DZA A;  1AVO B;  2JX0 A;  2YL1 A;  4XTK A;  3LS1 A;  4AE4 A;  4PJN A;  3AG3 C;  3ZQY A;  4IAQ A;  2HFI A;  2J8W A;  4JJG A;  4DRJ B;  4OIP F;  2TMV P;  1QPU A;  1GQA A;  1Y4C A;  1FNT c;  2VC9 A;  1MNE A;  1AUE A;  3C18 A;  3ZVR A;  1LKX A;  2YLD A;  1C02 A;  3IPM O;  3QVZ A;  5JLI A;  1Q0G A;  3AOU A;  4J30 B;  4CIP A;  1OR3 A;  3TQO A;  5KYY B;  3B0U X;  1MMD A;  3HNJ A;  1G8X A;  1ZZP A;  4YK5 A;  1CGM E;  3U0C A;  3MYI A;  3TUL A;  3FAP B;  4E17 A;  3HJC A;  5DS5 A;  2X51 A;  1U0B B;  3DI5 A;  3ECS A;  3O6X A;  4RBN A;  3U9J A;  1LS4 A;  2BC5 A; 
#chains in the Genus database with same CATH homology
 3NMI A;  3NMJ A;  4NC3 A;  1E85 A;  2XLW A;  256B A;  2YL7 A;  3L1M A;  3DE8 A;  5JUA A;  5JT4 A;  1S05 A;  2XLM A;  3M79 A;  2XLV A;  4D4X A;  2QLA A;  4JKV A;  3HNK A;  1E83 A;  4U9E A;  1YZA A;  3C62 A;  3ZTZ A;  3IQ5 A;  5JVE A;  2YLI A;  4JEB A;  3FOP A;  4N6H A;  3ZWI A;  2YLG A;  2YL0 A;  2XLH A;  2XLE A;  3ZTM A;  4ER9 A;  1BBH A;  1M6T A;  3C63 A;  4CJO A;  1YYJ A;  1JAF A;  3M15 A;  1YYX A;  5JS5 A;  3TOL A;  1QQ3 A;  4WGZ A;  3DE9 A;  1A7V A;  4CJG A;  3M4B A;  4JE9 A;  1APC A;  2YKZ A;  1NBB A;  3FOO A;  1RCP A;  3HNI A;  3TOM A;  2XM0 A;  4ULV A;  4CDA A;  1E84 A;  4CDY A;  1CPQ A;  4U9D A;  4CDV A;  1LM3 B;  2XLO A;  1EKY A;  2XL6 A;  1YZC A;  4IAR A;  1CGN A;  2XM4 A;  3U8P A;  3QW1 A;  2XL8 A;  4CX9 A;  5AGF A;  3ZQV A;  2CCY A;  3NMK A;  2XLD A;  1CPR A;  2YL3 A;  3M4C A;  2J9B A;  5JSL A;  2YL1 A;  3ZQY A;  4IAQ A;  2J8W A;  3QW0 A;  5B3I A;  4N4W A;  1QPU A;  1GQA A;  5JP7 A;  2YLD A;  1MQV A;  3QVZ A;  5JLI A;  4D4N A;  4CIP A;  4IB4 A;  3HNL A;  1CGO A;  3QVY A;  3HNJ A;  5JRA A;  4JEA A;  3IQ6 A;  4L6R A;  1E86 A;  3VRC A;  4EIY A;  4WGY A;  2BC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...