1E85A

Cytochrome c' from alcaligenes xylosoxidans - reduced structure with no bound to proximal side of heme
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
125
structure length
125
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Unprecedented Proximal Binding of Nitric Oxide to Heme: Implications for Guanylate Cyclase.
pubmed doi rcsb
molecule tags Electron transport
total genus 49
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2000-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1e85A00
1S05A 4ER9A 2XLVA 1A7VA 4CIPA 3ZQVA 3M4BA 1QPUA 3FOPA 3HNKA 3QVYA 3NMJA 3C62A 4IAQA 3DE8A 1E83A 3QW1A 2J9BA 2XLOA 5JSLA 4JEBA 5JP7A 2XLMA 2YL0A 3ZQYA 2XLHA 3ZTMA 3ZWIA 2BC5A 5JLIA 1E85A 1CGOA 2YL3A 2QLAA 3M15A 1YZCA 1NBBA 4N4WA 5JVEA 3TOLA 3QW0A 4WGYA 2CCYA 2YL7A 3M79A 1YZAA 3NMIA 3TOMA 2XL8A 4WGZA 1CGNA 2YKZA 1YYXA 2YLDA 3U8PA 5JS5A 3IQ6A 3L1MA 5B3IA 2XLEA 2J8WA 3QVZA 3NMKA 1E84A 1YYJA 4CDVA 3HNLA 1APCA 2XLWA 3DE9A 4CDAA 4CJOA 1CPQA 1GQAA 4ULVA 1EKYA 2XL6A 4L6RA 256BA 4D4XA 4NC3A 5JT4A 1JAFA 1M6TA 1BBHA 1RCPA 3C63A 4CJGA 4N6HA 3HNJA 4IB4A 5AGFA 2XM4A 5JRAA 5JUAA 4EIYA 4U9EA 4JEAA 3HNIA 2XM0A 3VRCA 4CX9A 2YLIA 3M4CA 2XLDA 3FOOA 3IQ5A 4U9DA 4IARA 1E86A 1MQVA 1CPRA 4JE9A 1LM3B 4D4NA 2YL1A 4JKVA 4CDYA 1QQ3A 2YLGA 3ZTZA
chains in the Genus database with same CATH superfamily
2CYDA 2J0WA 4CS8A 1NFNA 2OJED 2L81A 5A6JA 1ZHXA 3KYIA 4U5CE 2V3CC 1OW6A 1L3PA 1YJGA 4GYTA 4MVMA 1TWAA 2I8BA 2VC9A 2XSEA 2AU5A 3BEHA 4U5DE 1QPUA 2EIMC 4RDAA 3IQTA 3CZ6A 4G7HF 4DOZA 3OEOA 4PJJA 2R7OA 4YL1A 1ST6A 3LEVA 1VMAA 4IAQA 5HV9A 2W4MA 4LDQA 2HZ8A 1MMNA 2J9BA 2XLOA 2JD3A 2L6HA 3L0IA 4EHPA 1BZ4A 4JCZA 3ZTMA 4J7YA 2XS8A 3NYJA 1Z7Qc 3RQEA 5JLIA 1NZEA 2MWQA 2YL3A 2OEXA 3IEEA 1FNTc 3GWLA 5K0IA 3UGOA 4MVOA 4XPYA 2R05A 5L0DA 2D5RB 1V4AA 4N4WA 4PFOA 4X0RA 1GGQA 5F28E 5JVEA 3TULA 1D1BA 1T6IA 3GM2A 1HE9A 2HMZA 1Y6DA 3NDBB 4XQ1A 3LJBA 2J46A 2J0XA 4KC9A 2EILC 5A6BD 3MLGA 3DZAA 2XL8A 2CNWA 1LS4A 5D91A 1QVXA 3W2WA 3J06A 1CGNA 2WL8A 2YKZA 1LE4A 2YVKA 3PCVA 1YYXA 3V5XA 1YDIA 4E18A 2KNHA 5L0FA 3B0UX 2YLDA 2AVKA 4IWBA 2RSEB 4XTKA 3U8PA 4A4AA 3IQ6A 1GM5A 2XLEA 2TMVP 3U2MA 4CS9A 3NMKA 2WZFA 1ORJA 4YWQA 2GWWA 3FMSA 5GPGB 1YYJA 1JMWA 4O6YA 3U5SA 2A6HF 2KK1A 3W8IA 4BG0A 4C3DA 4CDVA 1B68A 2D4UA 2OJQA 4FESA 1ZZPA 2B0HA 1OKKA 2ETSA 3A9CA 4CDAA 1CPQA 2HUJA 3EG9A 1V54C 4K1OA 2EPLX 1PD1A 1RKCA 2L6GA 4JJFA 4P9TA 1LIHA 4ULVA 4UDVA 3TD7A 5DQZA 1WN0A 3FVYA 1K05A 1IZMA 3WODF 3UMKA 3ZIBA 1WTYA 1V55C 1TR2A 2FFHA 3VYWA 4JTDB 2ICWG 3Q6MA 3UNGC 4LDKA 4NC3A 3SYNA 2DYRC 2E87A 3EGDA 5KYNA 4XLNF 1G4WR 3WG7C 3RW0A 2W9YA 2H8AA 3C63A 1R5ID 1ZHWA 2HSBA 2KSFA 1HE1A 4LACB 3HTKC 3SXMA 4CJGA 5FCLA 4G7OF 3HNJA 3U8VA 4E7ZA 5L3QA 2Y3DA 1E2XA 3K1IC 1QKRA 3U9JA 3T6BA 4HE8D 3SXYA 4MTGA 2WZLA 3NKDA 1TWCA 2NSFA 3G4ZA 4EKWA 3GEHA 1Q0MA 1NU7D 2M64A 2R03A 4WJ0A 1FAPB 1W2WA 4M63A 4DJ9A 1C03A 3RF3A 2A6EF 5KYYA 2V26A 1D0XA 2XLDA 3FOOA 4DRHB 3UR3C 4PR9A 1Q0GA 2LFDA 2NUTA 3IQ5A 5BQIA 4NTAA 5L0GA 1Z23A 3N24A 4MW3A 1T5OA 1SMYF 1D1AA 2J7PA 2YRFA 3DD7A 3I4UA 5EGYA 1U0BB 3ZG1A 4WABA 4C3EA 2IOQA 2WVNA 3ECSA 2VCCA 1TQGA 1ORSC 4CS9C 4DVZA 4PACA 4U5BE 3EGDB 1LS1A 2IBFA 3H2UA 1ZW3A 4BPMA 3G4XA 4YT8A 4U5EE 2FAPB 2Q9BA 1S05A 4DRIB 2LD6A 3AGTA 3BRJA 3NYMA 2C03A 3RKOF 5A6AA 1PD0A 1G4US 2VH3A 4YL0A 2AWCA 3R7CA 2DGJA 3CQZA 4Q5SF 1Q0FA 4CS7A 5A69A 3DMDA 3GORA 3FOPA 3HNKA 3S29A 1H9GA 1U6HA 3ZSUA 3FAPB 4OD5A 3T9OA 1RKEA 3NRHA 3QW1A 3EZIA 2OU6A 2R7UA 1FMVA 4JEBA 5JP7A 3DJNB 1OCOC 1NLXA 2NUTB 1JPNA 2KYHA 3ZQYA 1G8XA 3RQGA 1YARO 1LVKA 2CW0F 1OCCC 1TKNA 2W4BA 5T3TA 2MHRA 4BJ5C 4Q4ZF 4JTCB 2XL4A 3GWNA 3W4YA 3K6BA 1VOMA 4NQFA 4EWCA 1ZU4A 1JR8A 1NBBA 2C04A 2LP4A 2EINC 3B0VC 4IAOA 2HSQA 4WGYA 3X2QC 1DOWA 4IGGA 1YAUO 1T9KA 1FFTC 2HJ3A 2M4EA 1J8YF 1NSGB 2EPNA 1TFOB 3EZHA 3JYHA 4JW1A 4O6NA 2OQMA 5F5FA 3NMIA 3TOMA 2WZGA 3MYFA 4HEAJ 1L7CA 1N1CA 3JSZA 2Q00A 1KNYA 2Q4FA 2ZXPA 3IHUA 2Y69C 1ZHZA 1RJ9B 3LEOA 5JS5A 3ABKC 2VCAA 4FAPB 3L1MA 5B3IA 3PMRA 3QVZA 4JRZA 5DLJA 1RKEB 4LERA 2OKUA 2ZPAA 2Q9CA 1YVIA 3AG1C 3JRMO 4MNDA 4NY3A 4AE4B 1RXQA 1OR3A 2HMQA 1Z3IX 4MQ9F 2YZSA 1T6UA 1H7IA 3IQCA 1APCA 1UFBA 4N6CA 1O87A 3G50A 3C8GD 4MVSA 4PJLA 1AUEA 1GQAA 2F22A 1S7ZA 4XPWA 4BJ6C 1VTMP 5B1BC 4AL0A 3F46A 4H4KC 3LLKA 3DXJF 4RBNA 2P1AA 3QTHA 5IY5C 2VB6A 2HS5A 2R7SA 4EUKB 3O10A 3B29A 3JZ0A 3EFOA 4QDLA 1NG1A 4MS2A 5FZTA 1FFHA 4Z9JA 1Q0DA 5COMA 1I4ZA 3LNMB 2A68F 1LI5A 3AG4C 1D0YA 1BR1A 3JTLO 3Q6NA 1HY5A 2AP3A 1G5ZA 2XXAB 3JSEO 4A2NB 3DAGA 2R7QA 4IB4A 2XM4A 3AOUA 5E2QA 1FR0A 4NCQA 3AJMA 4XLPF 3S0XA 4G78A 4CS8C 4YT5A 2A1DD 5JUAA 2HFIA 4FWVA 4HFFB 4QI0A 4EIYA 4QI2A 2GDCA 3U3FA 1PV3A 3HNIA 1Y4CA 2OCCC 4CX9A 2ZXRA 2IM8A 3M4CA 3W8HA 4XEKA 1JRAA 1K04A 1I5NA 3FXHA 1ZHTA 2KJGA 2Q9AA 1A0BA 2OOCA 2R25A 4Z9IA 1E86A 1ZW2A 1ORYA 5L3VA 3HKKA 1I4YA 1C17M 5KYXB 4LLEA 4OD4A 3EFOB 1A41A 1OCRC 4JKVA 4MW8A 4XEVA 1QQ3A 4JC7A 3ZC4A 1OCZC 2J9VA 2YLGA 4I1OB 1D0ZA 4EBJA 2LQGA 4OIPF 5A6KA 3T4RA 4Q7CA 4F4BA 1TWHA 3AG2C 3DWWA 2QTVA 1OW8A 4NTBA 1OQCA 4XWJA 4AK9A 3DM5A 1U89A 2ZD9A 2Y3BA 4ER9A 2P6VA 1A7VA 2XLVA 3N0TA 4CIPA 3AQBA 5E33A 1CGME 2KW3C 5COGA 3POVA 3I5QA 2OG2A 1A7EA 2XS1A 3QVYA 3NMJA 1VLTA 2YEVA 4XEFA 3C62A 3W2VA 3DI5A 3KH2A 2NUPB 1YLMA 2H7OA 2PP4A 5JSLA 3RH3A 2HJMA 5L0HA 2PF4E 4CBEA 2YL0A 4JCHA 3ASOC 2J9UA 5DS6A 1M57C 2KGOA 3H2VA 3ZVRA 2XLHA 5BUOA 2Y3GA 1Z63A 3ZWIA 3U0CA 4KBLA 5DVWA 2QLAA 3ZDLA 3DM9B 3R2PA 3LAYA 3K66A 3M15A 4PJNA 3S9OA 4MTFA 4BEMJ 1YA9A 4DVYP 1YZCA 3EGXB 3FHDA 3TOLA 5F5HA 5DS5A 1OKKD 4Z9HA 2CCYA 2EPKX 2Q7RA 3JYYA 4U5FE 2H7VC 2DB4A 1ZU5A 1QLEC 3WAQA 2IYLD 1RJ9A 1HW2A 3LS1A 4WGZA 3ABMC 2FGYA 3C18A 1ZYRF 3GODA 2X0CA 3U9MA 5DS4A 5KYUB 4C7OA 3AGUA 4YN0B 1H6GA 4O6MA 3GM3A 3V7OA 1FTSA 4AE4A 3HLZA 4AL1A 2L7AA 1VK5A 1SYQA 5B3SC 1VYIA 1XZPA 1A7DA 1MMAA 3ASNC 4J32B 5L0IA 1ZVZA 4P6IC 5CIVA 3HNLA 3GANA 3SXZA 1HMOA 1T01A 5KYWB 1XZQA 1LI7A 4ONSA 2QE9A 3B9QA 2YHSA 2PX0A 3L34A 5AC4A 4E0HA 3NYLA 2B0JA 4MVUA 2EPMX 2EPOA 5CI9A 3NKEA 1QSPA 2NSGA 3SNHA 4R32A 1EKYA 3VM6A 3TK0A 3LNRA 3DKAA 1D1CA 1ZHYA 4J30B 5A6BA 3HJCA 1KTMA 2WB7A 1SZIA 1WASA 2LSEA 3WHNA 3V5ZA 2OEVA 2Z15A 4JJGA 1VLSA 4BJTA 2YWAA 4MVQA 1WOLA 2VCBA 1M2VA 4D4XA 1J8MF 4YT2A 2A69F 4E17A 3K7DA 3FDQA 2R7VA 2XXAA 2J7PD 4C7OB 3GEIA 1M6TA 4CSAA 3DJUB 2L9JA 3K1HA 1TFKB 1RCPA 3MFNA 4YT4A 2A0BA 1LPEA 1LKXA 2VASA 4DBRA 2H7BA 2ASRA 1O5HA 4IJJA 1MNEA 2WVOA 3JCUQ 3OA1A 3EH2A 3X1OA 1RMVA 4C3BA 4AX2A 3LUTB 2LCHA 1T6QA 4MVZA 4RD9A 3LS0A 4I44A 4JEAA 1WWPA 3C8GB 2IXOA 3SEOA 3EHMA 2G3VA 1YA7O 2EIJC 3MYIA 3IPMO 4U5GA 2XM0A 4K7BA 3S90A 4KNVA 4PK4A 5BQGA 2GA0A 5KYXA 2QNLA 4O79A 5T3WA 4U9DA 4IARA 3RQFA 2R7WA 1Q0KA 1MQVA 1MNDA 2PX3A 1CPRA 3OWTA 3EQLF 3PDMP 4I1MA 4JE9A 1M2VB 2YL1A 4NTFA 2MYSA 2Y39A 3RVZA 3US6A 2UUHA 3E9VA 1F1MA 3K1IA 3S28A 1AEPA 3SXKA 3UMIA 3ZTZA 5BQHA 1OW7A 3VF0A 2IXMA 1C02A 1HMDA 1SR2A 1GS9A 1E85A 3TQOA 2Q3TA 1UG7A 1K40A 3LESA 3QZCA 5AC5A 3CSKA 2A0UA 2JX0A 3ZQVA 3M4BA 2Y3HA 2R7XA 2R7RA 2ZXWC 2NUPA 3GEEA 5EHHA 2EIKC 3GM1A 1XWJA 3EHNA 3ATPA 3SP1A 3DE8A 2QY9A 3VAYA 1E83A 5L0JA 1JOGA 5COFA 2BE5F 3TJ6A 4OIQF 2JPUA 1EQ1A 3EPVA 2XLMA 3L8JA 4H54A 2PNOA 3KYJA 4YK5A 4CSAC 3A11A 3SZRA 2G3KA 1VYKA 2BC5A 1MMDA 3ITFA 1CGOA 2LK4A 3T6JA 4LLCA 4EBBA 3EGXA 1MMGA 2L6FA 2LIGA 3JRTA 1R4TA 4I3MA 5TJ5E 4YL3A 4ANJA 3KMIA 3QW0A 4E0IA 1OR2A 1Z5ZA 3PHF2 2YL7A 4B6IA 1DOVA 1BR4A 2XRHA 5T1DB 3RVYA 3M79A 3U3BA 1YZAA 2R7TA 4OINF 3NG1A 4K0DA 5KYUA 2PFDA 2HV7A 2G62A 4XPXA 3MBGA 1NFOA 4DBQA 4PJMA 4E7SA 2W45A 3TJ5A 1EI7A 2CNWD 2P7VA 1QZXA 2DI3A 4IRUA 5D92A 2NPUA 4U5HA 3S27A 2P61A 2J8WA 1OXKA 1LE2A 2HV6A 4OIOF 1BDJB 1M2OA 2R02A 2J9WA 4MVRA 1E84A 4JTAB 5KYWA 4BJ5A 5DQTA 1O3UA 2GAQA 3K33A 3KPHA 3S84A 4PFPA 1TWGA 4JURI 4J7TA 4CIHA 2WVQA 1OXBA 2XLWA 3DE9A 3O39A 3DAFA 3L8IA 2BL2A 4CJOA 3MX3A 1NU9C 4KNWA 4ZLCA 4GEHA 2LFFA 3CAXA 1M56C 4MTOA 2I15A 4DXWA 3EG9B 4HFKB 2XL6A 4ULWA 4L6RA 1VB5A 256BA 3N2ZB 3KL4A 3AQCA 3RYLA 3B71A 5B1AC 5L0CA 3O55A 3B0PA 1PCXA 3LLIA 5EK0A 4JZAA 1WATA 3KKBA 5JT4A 4BEJA 1JAFA 4ZLDA 1WGWA 3O6XA 4P9FA 4KI2A 2NG1A 5E3AA 4EBKA 1BBHA 2CGEA 2IXNA 4N6HA 4YJWA 3UMHA 3F47A 1FMWA 1KU2A 5AGFA 2CDQA 4O7GA 1H9TA 2J45A 1BR2A 3E70C 1SF8A 1V74B 5JRAA 3JT1A 2QUPA 4GQHA 5E3CA 3C8GA 3QMKA 4LDRA 3Q7GA 5HSWA 2RD9A 4BJ6A 5CI8A 3FAJA 2HKVA 2GFHA 4U9EA 4W8KA 4DRJB 2P0NA 4W8PA 3RFYA 3VRCA 1HW1A 2YLIA 3RIPA 4FX5A 2KC3A 2X51A 3EJNA 3EH1A 3UGPA 3H65A 2KQ9A 3C8ZA 2DYSC 5KYYB 1Z6AA 1IW7F 2AWYA 2IXPA 3CEXA 4N06A 3Q7LA 2O9XA 4G0HA 1AVOB 1EA8A 4JVSA 3V5YA 1JPJA 2R9RB 2YQYA 3I5PA 3C7JA 2ZXOA 1LM3B 4OIRF 3U2LA 4D4NA 3M1CB 2PBEA 3T6GB 4JIOA 4BJ1A 4CDYA 3AG3C 2UUIA 4G7ZF 3ABLC
chains in the Genus database with same CATH topology
1S05A 4ER9A 2XLVA 1A7VA 4CIPA 3ZQVA 3M4BA 1QPUA 3FOPA 3HNKA 3QVYA 3NMJA 3C62A 4IAQA 3DE8A 1E83A 3QW1A 2J9BA 2XLOA 5JSLA 4JEBA 5JP7A 2XLMA 2YL0A 3ZQYA 2XLHA 3ZTMA 3ZWIA 2BC5A 5JLIA 1E85A 1CGOA 2YL3A 2QLAA 3M15A 1YZCA 1NBBA 4N4WA 5JVEA 3TOLA 3QW0A 4WGYA 2CCYA 2YL7A 3M79A 1YZAA 3NMIA 3TOMA 2XL8A 4WGZA 1CGNA 2YKZA 1YYXA 2YLDA 3U8PA 5JS5A 3IQ6A 3L1MA 5B3IA 2XLEA 2J8WA 3QVZA 3NMKA 1E84A 1YYJA 4CDVA 3HNLA 1APCA 2XLWA 3DE9A 4CDAA 4CJOA 1CPQA 1GQAA 4ULVA 1EKYA 2XL6A 4L6RA 256BA 4D4XA 4NC3A 5JT4A 1JAFA 1M6TA 1BBHA 1RCPA 3C63A 4CJGA 4N6HA 3HNJA 4IB4A 5AGFA 2XM4A 5JRAA 5JUAA 4EIYA 4U9EA 4JEAA 3HNIA 2XM0A 3VRCA 4CX9A 2YLIA 3M4CA 2XLDA 3FOOA 3IQ5A 4U9DA 4IARA 1E86A 1MQVA 1CPRA 4JE9A 1LM3B 4D4NA 2YL1A 4JKVA 4CDYA 1QQ3A 2YLGA 3ZTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S05 A;  4ER9 A;  2XLV A;  1A7V A;  4CIP A;  3ZQV A;  3M4B A;  1QPU A;  3FOP A;  3HNK A;  3QVY A;  3NMJ A;  3C62 A;  4IAQ A;  3DE8 A;  1E83 A;  3QW1 A;  2J9B A;  2XLO A;  5JSL A;  4JEB A;  5JP7 A;  2XLM A;  2YL0 A;  3ZQY A;  2XLH A;  3ZTM A;  3ZWI A;  2BC5 A;  5JLI A;  1E85 A;  1CGO A;  2YL3 A;  2QLA A;  3M15 A;  1YZC A;  1NBB A;  4N4W A;  5JVE A;  3TOL A;  3QW0 A;  4WGY A;  2CCY A;  2YL7 A;  3M79 A;  1YZA A;  3NMI A;  3TOM A;  2XL8 A;  4WGZ A;  1CGN A;  2YKZ A;  1YYX A;  2YLD A;  3U8P A;  5JS5 A;  3IQ6 A;  3L1M A;  5B3I A;  2XLE A;  2J8W A;  3QVZ A;  3NMK A;  1E84 A;  1YYJ A;  4CDV A;  3HNL A;  1APC A;  2XLW A;  3DE9 A;  4CDA A;  4CJO A;  1CPQ A;  1GQA A;  4ULV A;  1EKY A;  2XL6 A;  4L6R A;  256B A;  4D4X A;  4NC3 A;  5JT4 A;  1JAF A;  1M6T A;  1BBH A;  1RCP A;  3C63 A;  4CJG A;  4N6H A;  3HNJ A;  4IB4 A;  5AGF A;  2XM4 A;  5JRA A;  5JUA A;  4EIY A;  4U9E A;  4JEA A;  3HNI A;  2XM0 A;  3VRC A;  4CX9 A;  2YLI A;  3M4C A;  2XLD A;  3FOO A;  3IQ5 A;  4U9D A;  4IAR A;  1E86 A;  1MQV A;  1CPR A;  4JE9 A;  1LM3 B;  4D4N A;  2YL1 A;  4JKV A;  4CDY A;  1QQ3 A;  2YLG A;  3ZTZ A; 
#chains in the Genus database with same CATH topology
 2CYD A;  2J0W A;  4CS8 A;  1NFN A;  2OJE D;  2L81 A;  5A6J A;  1ZHX A;  3KYI A;  4U5C E;  2V3C C;  1OW6 A;  1L3P A;  1YJG A;  4GYT A;  4MVM A;  1TWA A;  2I8B A;  2VC9 A;  2XSE A;  2AU5 A;  3BEH A;  4U5D E;  1QPU A;  2EIM C;  4RDA A;  3IQT A;  3CZ6 A;  4G7H F;  4DOZ A;  3OEO A;  4PJJ A;  2R7O A;  4YL1 A;  1ST6 A;  3LEV A;  1VMA A;  4IAQ A;  5HV9 A;  2W4M A;  4LDQ A;  2HZ8 A;  1MMN A;  2J9B A;  2XLO A;  2JD3 A;  2L6H A;  3L0I A;  4EHP A;  1BZ4 A;  4JCZ A;  3ZTM A;  4J7Y A;  2XS8 A;  3NYJ A;  1Z7Q c;  3RQE A;  5JLI A;  1NZE A;  2MWQ A;  2YL3 A;  2OEX A;  3IEE A;  1FNT c;  3GWL A;  5K0I A;  3UGO A;  4MVO A;  4XPY A;  2R05 A;  5L0D A;  2D5R B;  1V4A A;  4N4W A;  4PFO A;  4X0R A;  1GGQ A;  5F28 E;  5JVE A;  3TUL A;  1D1B A;  1T6I A;  3GM2 A;  1HE9 A;  2HMZ A;  1Y6D A;  3NDB B;  4XQ1 A;  3LJB A;  2J46 A;  2J0X A;  4KC9 A;  2EIL C;  5A6B D;  3MLG A;  3DZA A;  2XL8 A;  2CNW A;  1LS4 A;  5D91 A;  1QVX A;  3W2W A;  3J06 A;  1CGN A;  2WL8 A;  2YKZ A;  1LE4 A;  2YVK A;  3PCV A;  1YYX A;  3V5X A;  1YDI A;  4E18 A;  2KNH A;  5L0F A;  3B0U X;  2YLD A;  2AVK A;  4IWB A;  2RSE B;  4XTK A;  3U8P A;  4A4A A;  3IQ6 A;  1GM5 A;  2XLE A;  2TMV P;  3U2M A;  4CS9 A;  3NMK A;  2WZF A;  1ORJ A;  4YWQ A;  2GWW A;  3FMS A;  5GPG B;  1YYJ A;  1JMW A;  4O6Y A;  3U5S A;  2A6H F;  2KK1 A;  3W8I A;  4BG0 A;  4C3D A;  4CDV A;  1B68 A;  2D4U A;  2OJQ A;  4FES A;  1ZZP A;  2B0H A;  1OKK A;  2ETS A;  3A9C A;  4CDA A;  1CPQ A;  2HUJ A;  3EG9 A;  1V54 C;  4K1O A;  2EPL X;  1PD1 A;  1RKC A;  2L6G A;  4JJF A;  4P9T A;  1LIH A;  4ULV A;  4UDV A;  3TD7 A;  5DQZ A;  1WN0 A;  3FVY A;  1K05 A;  1IZM A;  3WOD F;  3UMK A;  3ZIB A;  1WTY A;  1V55 C;  1TR2 A;  2FFH A;  3VYW A;  4JTD B;  2ICW G;  3Q6M A;  3UNG C;  4LDK A;  4NC3 A;  3SYN A;  2DYR C;  2E87 A;  3EGD A;  5KYN A;  4XLN F;  1G4W R;  3WG7 C;  3RW0 A;  2W9Y A;  2H8A A;  3C63 A;  1R5I D;  1ZHW A;  2HSB A;  2KSF A;  1HE1 A;  4LAC B;  3HTK C;  3SXM A;  4CJG A;  5FCL A;  4G7O F;  3HNJ A;  3U8V A;  4E7Z A;  5L3Q A;  2Y3D A;  1E2X A;  3K1I C;  1QKR A;  3U9J A;  3T6B A;  4HE8 D;  3SXY A;  4MTG A;  2WZL A;  3NKD A;  1TWC A;  2NSF A;  3G4Z A;  4EKW A;  3GEH A;  1Q0M A;  1NU7 D;  2M64 A;  2R03 A;  4WJ0 A;  1FAP B;  1W2W A;  4M63 A;  4DJ9 A;  1C03 A;  3RF3 A;  2A6E F;  5KYY A;  2V26 A;  1D0X A;  2XLD A;  3FOO A;  4DRH B;  3UR3 C;  4PR9 A;  1Q0G A;  2LFD A;  2NUT A;  3IQ5 A;  5BQI A;  4NTA A;  5L0G A;  1Z23 A;  3N24 A;  4MW3 A;  1T5O A;  1SMY F;  1D1A A;  2J7P A;  2YRF A;  3DD7 A;  3I4U A;  5EGY A;  1U0B B;  3ZG1 A;  4WAB A;  4C3E A;  2IOQ A;  2WVN A;  3ECS A;  2VCC A;  1TQG A;  1ORS C;  4CS9 C;  4DVZ A;  4PAC A;  4U5B E;  3EGD B;  1LS1 A;  2IBF A;  3H2U A;  1ZW3 A;  4BPM A;  3G4X A;  4YT8 A;  4U5E E;  2FAP B;  2Q9B A;  1S05 A;  4DRI B;  2LD6 A;  3AGT A;  3BRJ A;  3NYM A;  2C03 A;  3RKO F;  5A6A A;  1PD0 A;  1G4U S;  2VH3 A;  4YL0 A;  2AWC A;  3R7C A;  2DGJ A;  3CQZ A;  4Q5S F;  1Q0F A;  4CS7 A;  5A69 A;  3DMD A;  3GOR A;  3FOP A;  3HNK A;  3S29 A;  1H9G A;  1U6H A;  3ZSU A;  3FAP B;  4OD5 A;  3T9O A;  1RKE A;  3NRH A;  3QW1 A;  3EZI A;  2OU6 A;  2R7U A;  1FMV A;  4JEB A;  5JP7 A;  3DJN B;  1OCO C;  1NLX A;  2NUT B;  1JPN A;  2KYH A;  3ZQY A;  1G8X A;  3RQG A;  1YAR O;  1LVK A;  2CW0 F;  1OCC C;  1TKN A;  2W4B A;  5T3T A;  2MHR A;  4BJ5 C;  4Q4Z F;  4JTC B;  2XL4 A;  3GWN A;  3W4Y A;  3K6B A;  1VOM A;  4NQF A;  4EWC A;  1ZU4 A;  1JR8 A;  1NBB A;  2C04 A;  2LP4 A;  2EIN C;  3B0V C;  4IAO A;  2HSQ A;  4WGY A;  3X2Q C;  1DOW A;  4IGG A;  1YAU O;  1T9K A;  1FFT C;  2HJ3 A;  2M4E A;  1J8Y F;  1NSG B;  2EPN A;  1TFO B;  3EZH A;  3JYH A;  4JW1 A;  4O6N A;  2OQM A;  5F5F A;  3NMI A;  3TOM A;  2WZG A;  3MYF A;  4HEA J;  1L7C A;  1N1C A;  3JSZ A;  2Q00 A;  1KNY A;  2Q4F A;  2ZXP A;  3IHU A;  2Y69 C;  1ZHZ A;  1RJ9 B;  3LEO A;  5JS5 A;  3ABK C;  2VCA A;  4FAP B;  3L1M A;  5B3I A;  3PMR A;  3QVZ A;  4JRZ A;  5DLJ A;  1RKE B;  4LER A;  2OKU A;  2ZPA A;  2Q9C A;  1YVI A;  3AG1 C;  3JRM O;  4MND A;  4NY3 A;  4AE4 B;  1RXQ A;  1OR3 A;  2HMQ A;  1Z3I X;  4MQ9 F;  2YZS A;  1T6U A;  1H7I A;  3IQC A;  1APC A;  1UFB A;  4N6C A;  1O87 A;  3G50 A;  3C8G D;  4MVS A;  4PJL A;  1AUE A;  1GQA A;  2F22 A;  1S7Z A;  4XPW A;  4BJ6 C;  1VTM P;  5B1B C;  4AL0 A;  3F46 A;  4H4K C;  3LLK A;  3DXJ F;  4RBN A;  2P1A A;  3QTH A;  5IY5 C;  2VB6 A;  2HS5 A;  2R7S A;  4EUK B;  3O10 A;  3B29 A;  3JZ0 A;  3EFO A;  4QDL A;  1NG1 A;  4MS2 A;  5FZT A;  1FFH A;  4Z9J A;  1Q0D A;  5COM A;  1I4Z A;  3LNM B;  2A68 F;  1LI5 A;  3AG4 C;  1D0Y A;  1BR1 A;  3JTL O;  3Q6N A;  1HY5 A;  2AP3 A;  1G5Z A;  2XXA B;  3JSE O;  4A2N B;  3DAG A;  2R7Q A;  4IB4 A;  2XM4 A;  3AOU A;  5E2Q A;  1FR0 A;  4NCQ A;  3AJM A;  4XLP F;  3S0X A;  4G78 A;  4CS8 C;  4YT5 A;  2A1D D;  5JUA A;  2HFI A;  4FWV A;  4HFF B;  4QI0 A;  4EIY A;  4QI2 A;  2GDC A;  3U3F A;  1PV3 A;  3HNI A;  1Y4C A;  2OCC C;  4CX9 A;  2ZXR A;  2IM8 A;  3M4C A;  3W8H A;  4XEK A;  1JRA A;  1K04 A;  1I5N A;  3FXH A;  1ZHT A;  2KJG A;  2Q9A A;  1A0B A;  2OOC A;  2R25 A;  4Z9I A;  1E86 A;  1ZW2 A;  1ORY A;  5L3V A;  3HKK A;  1I4Y A;  1C17 M;  5KYX B;  4LLE A;  4OD4 A;  3EFO B;  1A41 A;  1OCR C;  4JKV A;  4MW8 A;  4XEV A;  1QQ3 A;  4JC7 A;  3ZC4 A;  1OCZ C;  2J9V A;  2YLG A;  4I1O B;  1D0Z A;  4EBJ A;  2LQG A;  4OIP F;  5A6K A;  3T4R A;  4Q7C A;  4F4B A;  1TWH A;  3AG2 C;  3DWW A;  2QTV A;  1OW8 A;  4NTB A;  1OQC A;  4XWJ A;  4AK9 A;  3DM5 A;  1U89 A;  2ZD9 A;  2Y3B A;  4ER9 A;  2P6V A;  1A7V A;  2XLV A;  3N0T A;  4CIP A;  3AQB A;  5E33 A;  1CGM E;  2KW3 C;  5COG A;  3POV A;  3I5Q A;  2OG2 A;  1A7E A;  2XS1 A;  3QVY A;  3NMJ A;  1VLT A;  2YEV A;  4XEF A;  3C62 A;  3W2V A;  3DI5 A;  3KH2 A;  2NUP B;  1YLM A;  2H7O A;  2PP4 A;  5JSL A;  3RH3 A;  2HJM A;  5L0H A;  2PF4 E;  4CBE A;  2YL0 A;  4JCH A;  3ASO C;  2J9U A;  5DS6 A;  1M57 C;  2KGO A;  3H2V A;  3ZVR A;  2XLH A;  5BUO A;  2Y3G A;  1Z63 A;  3ZWI A;  3U0C A;  4KBL A;  5DVW A;  2QLA A;  3ZDL A;  3DM9 B;  3R2P A;  3LAY A;  3K66 A;  3M15 A;  4PJN A;  3S9O A;  4MTF A;  4BEM J;  1YA9 A;  4DVY P;  1YZC A;  3EGX B;  3FHD A;  3TOL A;  5F5H A;  5DS5 A;  1OKK D;  4Z9H A;  2CCY A;  2EPK X;  2Q7R A;  3JYY A;  4U5F E;  2H7V C;  2DB4 A;  1ZU5 A;  1QLE C;  3WAQ A;  2IYL D;  1RJ9 A;  1HW2 A;  3LS1 A;  4WGZ A;  3ABM C;  2FGY A;  3C18 A;  1ZYR F;  3GOD A;  2X0C A;  3U9M A;  5DS4 A;  5KYU B;  4C7O A;  3AGU A;  4YN0 B;  1H6G A;  4O6M A;  3GM3 A;  3V7O A;  1FTS A;  4AE4 A;  3HLZ A;  4AL1 A;  2L7A A;  1VK5 A;  1SYQ A;  5B3S C;  1VYI A;  1XZP A;  1A7D A;  1MMA A;  3ASN C;  4J32 B;  5L0I A;  1ZVZ A;  4P6I C;  5CIV A;  3HNL A;  3GAN A;  3SXZ A;  1HMO A;  1T01 A;  5KYW B;  1XZQ A;  1LI7 A;  4ONS A;  2QE9 A;  3B9Q A;  2YHS A;  2PX0 A;  3L34 A;  5AC4 A;  4E0H A;  3NYL A;  2B0J A;  4MVU A;  2EPM X;  2EPO A;  5CI9 A;  3NKE A;  1QSP A;  2NSG A;  3SNH A;  4R32 A;  1EKY A;  3VM6 A;  3TK0 A;  3LNR A;  3DKA A;  1D1C A;  1ZHY A;  4J30 B;  5A6B A;  3HJC A;  1KTM A;  2WB7 A;  1SZI A;  1WAS A;  2LSE A;  3WHN A;  3V5Z A;  2OEV A;  2Z15 A;  4JJG A;  1VLS A;  4BJT A;  2YWA A;  4MVQ A;  1WOL A;  2VCB A;  1M2V A;  4D4X A;  1J8M F;  4YT2 A;  2A69 F;  4E17 A;  3K7D A;  3FDQ A;  2R7V A;  2XXA A;  2J7P D;  4C7O B;  3GEI A;  1M6T A;  4CSA A;  3DJU B;  2L9J A;  3K1H A;  1TFK B;  1RCP A;  3MFN A;  4YT4 A;  2A0B A;  1LPE A;  1LKX A;  2VAS A;  4DBR A;  2H7B A;  2ASR A;  1O5H A;  4IJJ A;  1MNE A;  2WVO A;  3JCU Q;  3OA1 A;  3EH2 A;  3X1O A;  1RMV A;  4C3B A;  4AX2 A;  3LUT B;  2LCH A;  1T6Q A;  4MVZ A;  4RD9 A;  3LS0 A;  4I44 A;  4JEA A;  1WWP A;  3C8G B;  2IXO A;  3SEO A;  3EHM A;  2G3V A;  1YA7 O;  2EIJ C;  3MYI A;  3IPM O;  4U5G A;  2XM0 A;  4K7B A;  3S90 A;  4KNV A;  4PK4 A;  5BQG A;  2GA0 A;  5KYX A;  2QNL A;  4O79 A;  5T3W A;  4U9D A;  4IAR A;  3RQF A;  2R7W A;  1Q0K A;  1MQV A;  1MND A;  2PX3 A;  1CPR A;  3OWT A;  3EQL F;  3PDM P;  4I1M A;  4JE9 A;  1M2V B;  2YL1 A;  4NTF A;  2MYS A;  2Y39 A;  3RVZ A;  3US6 A;  2UUH A;  3E9V A;  1F1M A;  3K1I A;  3S28 A;  1AEP A;  3SXK A;  3UMI A;  3ZTZ A;  5BQH A;  1OW7 A;  3VF0 A;  2IXM A;  1C02 A;  1HMD A;  1SR2 A;  1GS9 A;  1E85 A;  3TQO A;  2Q3T A;  1UG7 A;  1K40 A;  3LES A;  3QZC A;  5AC5 A;  3CSK A;  2A0U A;  2JX0 A;  3ZQV A;  3M4B A;  2Y3H A;  2R7X A;  2R7R A;  2ZXW C;  2NUP A;  3GEE A;  5EHH A;  2EIK C;  3GM1 A;  1XWJ A;  3EHN A;  3ATP A;  3SP1 A;  3DE8 A;  2QY9 A;  3VAY A;  1E83 A;  5L0J A;  1JOG A;  5COF A;  2BE5 F;  3TJ6 A;  4OIQ F;  2JPU A;  1EQ1 A;  3EPV A;  2XLM A;  3L8J A;  4H54 A;  2PNO A;  3KYJ A;  4YK5 A;  4CSA C;  3A11 A;  3SZR A;  2G3K A;  1VYK A;  2BC5 A;  1MMD A;  3ITF A;  1CGO A;  2LK4 A;  3T6J A;  4LLC A;  4EBB A;  3EGX A;  1MMG A;  2L6F A;  2LIG A;  3JRT A;  1R4T A;  4I3M A;  5TJ5 E;  4YL3 A;  4ANJ A;  3KMI A;  3QW0 A;  4E0I A;  1OR2 A;  1Z5Z A;  3PHF 2;  2YL7 A;  4B6I A;  1DOV A;  1BR4 A;  2XRH A;  5T1D B;  3RVY A;  3M79 A;  3U3B A;  1YZA A;  2R7T A;  4OIN F;  3NG1 A;  4K0D A;  5KYU A;  2PFD A;  2HV7 A;  2G62 A;  4XPX A;  3MBG A;  1NFO A;  4DBQ A;  4PJM A;  4E7S A;  2W45 A;  3TJ5 A;  1EI7 A;  2CNW D;  2P7V A;  1QZX A;  2DI3 A;  4IRU A;  5D92 A;  2NPU A;  4U5H A;  3S27 A;  2P61 A;  2J8W A;  1OXK A;  1LE2 A;  2HV6 A;  4OIO F;  1BDJ B;  1M2O A;  2R02 A;  2J9W A;  4MVR A;  1E84 A;  4JTA B;  5KYW A;  4BJ5 A;  5DQT A;  1O3U A;  2GAQ A;  3K33 A;  3KPH A;  3S84 A;  4PFP A;  1TWG A;  4JUR I;  4J7T A;  4CIH A;  2WVQ A;  1OXB A;  2XLW A;  3DE9 A;  3O39 A;  3DAF A;  3L8I A;  2BL2 A;  4CJO A;  3MX3 A;  1NU9 C;  4KNW A;  4ZLC A;  4GEH A;  2LFF A;  3CAX A;  1M56 C;  4MTO A;  2I15 A;  4DXW A;  3EG9 B;  4HFK B;  2XL6 A;  4ULW A;  4L6R A;  1VB5 A;  256B A;  3N2Z B;  3KL4 A;  3AQC A;  3RYL A;  3B71 A;  5B1A C;  5L0C A;  3O55 A;  3B0P A;  1PCX A;  3LLI A;  5EK0 A;  4JZA A;  1WAT A;  3KKB A;  5JT4 A;  4BEJ A;  1JAF A;  4ZLD A;  1WGW A;  3O6X A;  4P9F A;  4KI2 A;  2NG1 A;  5E3A A;  4EBK A;  1BBH A;  2CGE A;  2IXN A;  4N6H A;  4YJW A;  3UMH A;  3F47 A;  1FMW A;  1KU2 A;  5AGF A;  2CDQ A;  4O7G A;  1H9T A;  2J45 A;  1BR2 A;  3E70 C;  1SF8 A;  1V74 B;  5JRA A;  3JT1 A;  2QUP A;  4GQH A;  5E3C A;  3C8G A;  3QMK A;  4LDR A;  3Q7G A;  5HSW A;  2RD9 A;  4BJ6 A;  5CI8 A;  3FAJ A;  2HKV A;  2GFH A;  4U9E A;  4W8K A;  4DRJ B;  2P0N A;  4W8P A;  3RFY A;  3VRC A;  1HW1 A;  2YLI A;  3RIP A;  4FX5 A;  2KC3 A;  2X51 A;  3EJN A;  3EH1 A;  3UGP A;  3H65 A;  2KQ9 A;  3C8Z A;  2DYS C;  5KYY B;  1Z6A A;  1IW7 F;  2AWY A;  2IXP A;  3CEX A;  4N06 A;  3Q7L A;  2O9X A;  4G0H A;  1AVO B;  1EA8 A;  4JVS A;  3V5Y A;  1JPJ A;  2R9R B;  2YQY A;  3I5P A;  3C7J A;  2ZXO A;  1LM3 B;  4OIR F;  3U2L A;  4D4N A;  3M1C B;  2PBE A;  3T6G B;  4JIO A;  4BJ1 A;  4CDY A;  3AG3 C;  2UUI A;  4G7Z F;  3ABL C; 
#chains in the Genus database with same CATH homology
 1S05 A;  4ER9 A;  2XLV A;  1A7V A;  4CIP A;  3ZQV A;  3M4B A;  1QPU A;  3FOP A;  3HNK A;  3QVY A;  3NMJ A;  3C62 A;  4IAQ A;  3DE8 A;  1E83 A;  3QW1 A;  2J9B A;  2XLO A;  5JSL A;  4JEB A;  5JP7 A;  2XLM A;  2YL0 A;  3ZQY A;  2XLH A;  3ZTM A;  3ZWI A;  2BC5 A;  5JLI A;  1E85 A;  1CGO A;  2YL3 A;  2QLA A;  3M15 A;  1YZC A;  1NBB A;  4N4W A;  5JVE A;  3TOL A;  3QW0 A;  4WGY A;  2CCY A;  2YL7 A;  3M79 A;  1YZA A;  3NMI A;  3TOM A;  2XL8 A;  4WGZ A;  1CGN A;  2YKZ A;  1YYX A;  2YLD A;  3U8P A;  5JS5 A;  3IQ6 A;  3L1M A;  5B3I A;  2XLE A;  2J8W A;  3QVZ A;  3NMK A;  1E84 A;  1YYJ A;  4CDV A;  3HNL A;  1APC A;  2XLW A;  3DE9 A;  4CDA A;  4CJO A;  1CPQ A;  1GQA A;  4ULV A;  1EKY A;  2XL6 A;  4L6R A;  256B A;  4D4X A;  4NC3 A;  5JT4 A;  1JAF A;  1M6T A;  1BBH A;  1RCP A;  3C63 A;  4CJG A;  4N6H A;  3HNJ A;  4IB4 A;  5AGF A;  2XM4 A;  5JRA A;  5JUA A;  4EIY A;  4U9E A;  4JEA A;  3HNI A;  2XM0 A;  3VRC A;  4CX9 A;  2YLI A;  3M4C A;  2XLD A;  3FOO A;  3IQ5 A;  4U9D A;  4IAR A;  1E86 A;  1MQV A;  1CPR A;  4JE9 A;  1LM3 B;  4D4N A;  2YL1 A;  4JKV A;  4CDY A;  1QQ3 A;  2YLG A;  3ZTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...