1E85A

Cytochrome c' from alcaligenes xylosoxidans - reduced structure with no bound to proximal side of heme
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
125
structure length
125
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Unprecedented Proximal Binding of Nitric Oxide to Heme: Implications for Guanylate Cyclase.
pubmed doi rcsb
molecule tags Electron transport
total genus 49
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2000-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1e85A00
3HNLA 4CX9A 1JAFA 1BBHA 5JP7A 1EKYA 1APCA 2XLVA 4JE9A 3C63A 1QQ3A 3HNJA 2XLOA 1YZAA 1YYXA 4CJOA 1YZCA 2CCYA 5AGFA 2XL8A 3IQ6A 4JEAA 1E84A 2YL7A 4ER9A 3ZQYA 3ZWIA 3NMKA 2YLIA 3TOLA 4CDAA 4JEBA 3DE9A 4U9EA 4IAQA 4N4WA 4CJGA 2YLGA 3DE8A 4IARA 5JT4A 4D4XA 1NBBA 3QVZA 3FOOA 3ZTZA 3HNIA 4CDYA 4IB4A 5B3IA 2XM0A 2XLWA 1QPUA 3QW1A 1YYJA 2QLAA 2J9BA 3IQ5A 3U8PA 1CGNA 4CIPA 3FOPA 3C62A 3TOMA 3ZTMA 4WGZA 2J8WA 5JS5A 1E86A 4D4NA 3QW0A 2XL6A 2BC5A 1CPRA 5JVEA 2YL1A 4EIYA 4L6RA 4WGYA 5JRAA 1A7VA 3M79A 3NMJA 1GQAA 3M4CA 1E83A 2XLEA 2XLDA 1E85A 3ZQVA 1MQVA 2YLDA 4N6HA 3VRCA 2YL0A 2XLMA 3M4BA 1S05A 1CPQA 3L1MA 4NC3A 256BA 1M6TA 4U9DA 4CDVA 5JSLA 2YKZA 2XLHA 5JLIA 5JUAA 4JKVA 1RCPA 2XM4A 3QVYA 2YL3A 3M15A 1CGOA 1LM3B 4ULVA 3HNKA 3NMIA
chains in the Genus database with same CATH superfamily
1BR1A 3DAGA 2WVNA 4MVZA 1TKNA 3HNLA 3VM6A 3AG1C 2C04A 1RXQA 3K33A 4BJ6A 3JSEO 2XS1A 2L7AA 1BBHA 2EPLX 2P7VA 1XZQA 1KNYA 1WTYA 3Q7GA 3AGUA 2XLVA 4JE9A 4E0HA 2WVOA 2HMQA 2D5RB 2XSEA 3L8JA 4AK9A 1Z63A 1QQ3A 3KYIA 4XTKA 2A0UA 1QVXA 3DXJF 4J7YA 4KBLA 2HZ8A 5A6BD 2TMVP 3JRTA 2Q9BA 5AGFA 1TFKB 3AJMA 3S84A 4PFPA 3PDMP 4P9FA 3B0PA 3DI5A 3Q7LA 4DBRA 4H4KC 3T9OA 2DYSC 3IPMO 1YA9A 1FTSA 1KU2A 1E2XA 3NMKA 2YLIA 4CS9A 4E0IA 4CDAA 1J8YF 3LS1A 4JEBA 1QZXA 2EPNA 2Q4FA 4OIRF 3K1IC 1U0BB 2W4BA 5JT4A 2P61A 1GM5A 1M2OA 1ZHWA 3EG9A 5EHHA 3KH2A 2UUHA 1O87A 3TD7A 1NBBA 3F47A 3FOOA 2J0WA 3ZTZA 4FAPB 1VOMA 1K05A 2W45A 1K40A 1NSGB 1ZHTA 4K7BA 2H7VC 4C3EA 1VLSA 2DYRC 2AP3A 3BRJA 3NYLA 1ZHXA 4XPXA 5TJ5E 1Z23A 4IJJA 1YYJA 2OEXA 2PX3A 2NPUA 5F28E 2J46A 1CGNA 3LEVA 1R4TA 2Q3TA 1MMGA 1AEPA 3B9QA 3FOPA 2WB7A 3JZ0A 2FGYA 3O6XA 4XEKA 2HS5A 1OXKA 2Y3DA 3E70C 2VCBA 4N6CA 2A0BA 3TOMA 1Q0DA 1LI7A 2A6EF 2AWCA 4JJGA 3EFOB 4JJFA 1MMAA 1MMNA 5CI9A 4D4NA 3QW0A 4AX2A 3RKOF 3LNRA 1YAUO 3I4UA 4FESA 4K1OA 5L0CA 2R7SA 3EHMA 1NLXA 4HFFB 3C18A 3WHNA 1B68A 5JVEA 4EIYA 2JD3A 1G5ZA 4JTCB 3S9OA 1A0BA 1OW8A 3WAQA 4Z9JA 1HMOA 3G4ZA 1HY5A 1MMDA 2L9JA 4GYTA 4MNDA 4XEVA 3VF0A 2RSEB 3GANA 3JYHA 4JW1A 2UUIA 3GM3A 2R03A 3IQCA 1T01A 3AG4C 3W8HA 3M4CA 3JYYA 4YN0B 4DBQA 5HV9A 1HW2A 5FCLA 2OCCC 4DVYP 2I8BA 1JPJA 2EPMX 4U5EE 3LESA 2KK1A 3SNHA 4XLPF 1U89A 4C7OB 2OJED 4K0DA 2AVKA 3U3FA 4CS9C 2YLDA 1WASA 3ASNC 2JX0A 5L0DA 2LIGA 4BJ5C 2HUJA 2R05A 3EFOA 2ZXWC 2BL2A 3LAYA 1CPQA 4JZAA 1NZEA 1SMYF 3MFNA 3UMKA 3VAYA 1NG1A 2C03A 1DOVA 4KC9A 4U9DA 5CI8A 5B1BC 2YVKA 4MVQA 1T6UA 5L0GA 4I44A 2Q7RA 2G62A 3TJ6A 5JSLA 3EJNA 4C3BA 2PP4A 5JLIA 5JUAA 3O10A 3QVYA 4JRZA 4RD9A 2CDQA 3KL4A 4O6YA 4H54A 2ICWG 1ZVZA 1CGOA 3IEEA 3AQBA 2AWYA 1GS9A 2NUPB 2YWAA 3NMIA 3K1IA 2EIJC 3SZRA 4BJTA 4CX9A 3KPHA 2HV7A 5T3WA 4C7OA 2LFDA 1ZU5A 3W4YA 1JAFA 2Q00A 3AGTA 4IRUA 5KYUB 4XPWA 4O7GA 1WWPA 4PACA 1SZIA 1Q0MA 2LSEA 1APCA 2PF4E 2PFDA 3HTKC 4MW3A 3U3BA 4MW8A 4JVSA 3T4RA 4PJNA 1TWGA 2YRFA 1NU7D 2J0XA 1LVKA 2XLOA 2QY9A 3JRMO 4BEJA 1O5HA 1MNDA 3H2VA 1YYXA 2LCHA 5B3SC 3NG1A 2CNWA 1LKXA 2IXNA 3JTLO 5K0IA 4YT4A 4YK5A 2HKVA 5L0JA 1L3PA 2YL7A 3C8GB 4J32B 4E7ZA 3ZQYA 3ASOC 4R32A 1N1CA 3TOLA 2L6HA 5BQGA 4QI2A 5F5HA 4OD5A 2FAPB 2Q9CA 2VCAA 1D1CA 1Y6DA 1UG7A 3DE9A 2EIKC 3SXKA 4OIOF 2F22A 2NUPA 1FMWA 1OQCA 2Y3GA 4G7HF 3UGOA 2QNLA 3QVZA 5DVWA 3X2QC 3JT1A 4CDYA 1SR2A 3FXHA 2NUTB 5E2QA 1C17M 1BZ4A 5KYUA 3RW0A 4BPMA 2R7RA 4YT8A 1QPUA 3QW1A 1G4WR 1ZYRF 4PJMA 5A69A 2EPKX 4JTDB 2QLAA 2YQYA 2J9BA 1OR2A 3K6BA 3U8PA 4CIPA 4DOZA 2IXMA 1ORYA 1FFTC 4NTBA 3HKKA 4XWJA 4OINF 4BEMJ 4CS8A 4RDAA 1VLTA 4LLEA 1BR4A 3CEXA 3J06A 3V5XA 1TQGA 1V74B 2ZXPA 2QUPA 3KMIA 4NQFA 5E3CA 3LUTB 3ZTMA 2EILC 2B0HA 2OQMA 3C8ZA 2R25A 4EWCA 2J8WA 2LP4A 3NYJA 3QMKA 2O9XA 3C8GA 3CQZA 3LNMB 2Y3BA 3PMRA 3Q6NA 4YL1A 4BJ5A 3N0TA 4JC7A 1D1AA 4EUKB 3IHUA 3FAJA 3GEHA 1IW7F 4MVRA 4JCZA 2MYSA 4JIOA 1CPRA 4LDQA 3S27A 2W4MA 3R7CA 3OWTA 2YL1A 2CYDA 4W8KA 3DD7A 5HSWA 4CJOA 2EIMC 4WGYA 3U9JA 4QDLA 1JRAA 1BR2A 4G0HA 4O6MA 3H65A 3RQEA 5AC4A 2NUTA 4AL0A 2XRHA 3SEOA 3OA1A 3QZCA 4IWBA 3U2LA 4J30B 2R7XA 4XPYA 1W2WA 1I4YA 3DAFA 1E83A 4Q4ZF 3ITFA 1EA8A 3T6GB 1O3UA 5D92A 2XLDA 4O79A 1E85A 3V7OA 2HV6A 1EI7A 1ST6A 4JCHA 2Y69C 4N6HA 5KYXB 1D1BA 2YL0A 1T6QA 2KC3A 5COMA 4I1MA 3B0VC 1H9GA 1S05A 3K66A 2HMZA 2P6VA 1IZMA 2J9VA 1OKKA 1T9KA 1WN0A 2P0NA 3MBGA 4DRJB 2LK4A 3EQLF 1PD1A 4OD4A 1TFOB 2E87A 3GM2A 3GODA 4LDRA 1OW7A 2R9RB 1LPEA 1C03A 1ZU4A 2XL4A 3H2UA 2YKZA 2QTVA 2VH3A 2J7PA 1RCPA 2Z15A 4JKVA 2NG1A 5GPGB 4G7OF 1VK5A 4E17A 3SXYA 2KNHA 4CS8C 1ZZPA 1D0XA 2HSBA 3CSKA 3T6BA 4BG0A 1VTMP 2VB6A 5L0HA 3UGPA 3U2MA 3UMIA 5B1AC 3RF3A 3W2WA 3EHNA 3ZVRA 4G7ZF 2R7UA 3ZC4A 4UDVA 2A68F 3LJBA 2R7TA 1PCXA 2M64A 4JTAB 1ZW2A 2PNOA 3O55A 1Y4CA 5FZTA 2PBEA 2HFIA 1EKYA 4NTAA 4P6IC 4ZLCA 2A69F 3OEOA 5KYXA 2HJMA 2JPUA 4PJJA 4CSAA 3SYNA 2L6GA 3ATPA 4HEAJ 2J45A 3V5ZA 2NSGA 2R02A 3V5YA 3S28A 1L7CA 1JMWA 1LI5A 1YZCA 1D0YA 2A1DD 2W9YA 1NFOA 2OJQA 2XL8A 2CGEA 4XLNF 4JEAA 2QE9A 4ER9A 4EBKA 3BEHA 4MVOA 1Z3IX 1OXBA 3ZWIA 2KJGA 4YJWA 2LD6A 4U9EA 2GDCA 4IAQA 4J7TA 4CJGA 2YLGA 5KYYB 1YJGA 2P1AA 4D4XA 1H7IA 2KYHA 5A6KA 1XZPA 1FAPB 1SYQA 1DOWA 4CIHA 2VC9A 4KNWA 4I3MA 4U5BE 4DRIB 4IB4A 5KYWB 3DKAA 3DJNB 2XM0A 2IM8A 2XLWA 2OG2A 3FVYA 3R2PA 3U0CA 1V55C 1M57C 5IY5C 1YDIA 4A2NB 5A6AA 3IQTA 4Z9IA 1J8MF 4KNVA 3C7JA 3S0XA 3DZAA 2KQ9A 1A7EA 1WGWA 1Z6AA 2I15A 4GQHA 1CGME 4YWQA 4JURI 3JSZA 1HE1A 4XEFA 3PHF2 1YLMA 1WATA 2NSFA 5A6BA 3EH1A 2IXPA 2J9UA 1QSPA 2LFFA 4B6IA 1PD0A 1R5ID 1SF8A 2VASA 3NKDA 5BQHA 5KYNA 4PK4A 3VYWA 3UNGC 1LE4A 2KGOA 4I1OB 5KYYA 2V3CC 1UFBA 3M1CB 2H7BA 5L0IA 1Q0FA 1YVIA 2YEVA 4CSAC 1OW6A 2Q9AA 1FR0A 1RKCA 1BDJB 2WZGA 1AVOB 4YT2A 3ZG1A 5JRAA 5KYWA 2A6HF 3DMDA 1Q0KA 1TWHA 2V26A 1OCZC 2DGJA 3N2ZB 1ZHYA 3ZDLA 1G8XA 3A11A 3EPVA 3S90A 3NYMA 1A41A 3ABMC 3NRHA 3MYIA 4FX5A 3TJ5A 4GEHA 3SP1A 4IAOA 3RYLA 3F46A 3GWNA 4KI2A 3ZQVA 4X0RA 3VRCA 4C3DA 1Q0GA 4DVZA 4MVSA 1H6GA 3B29A 1LE2A 2CW0F 2ASRA 3LEOA 4MVMA 4EBBA 2CNWD 4MTOA 2MWQA 4G78A 3W8IA 3EZHA 3L1MA 4NC3A 256BA 5DQZA 1S7ZA 1M6TA 4U5GA 1NU9C 3RVYA 4CBEA 4U5DE 4DXWA 4AL1A 2GA0A 5DS4A 5DS5A 4MTFA 5T1DB 5T3TA 4ULWA 1HMDA 2XLHA 2MHRA 1WOLA 3T6JA 3K7DA 1V54C 4Z9HA 5L0FA 4NTFA 2WL8A 2EINC 2WVQA 1D0ZA 3DWWA 3UMHA 1FNTc 1LM3B 4RBNA 3MX3A 1JR8A 1LIHA 3HNKA 4ULVA 1H9TA 4U5FE 2G3VA 4MTGA 3U5SA 2R7VA 2RD9A 3L0IA 4WABA 2OKUA 2GAQA 4U5HA 2OOCA 3EH2A 2BE5F 4MVUA 4PFOA 3NDBB 5DS6A 4LDKA 2Y39A 3EGDB 1ZHZA 2X0CA 4E18A 3RQGA 5JP7A 3RFYA 4CS7A 5DLJA 1T5OA 4YL3A 3AOUA 5A6JA 3B71A 1F1MA 3C63A 3HNJA 3RVZA 3S29A 5E3AA 3ABLC 1RMVA 4Q5SF 2Y3HA 3DM5A 2D4UA 1OCCC 1QKRA 1YZAA 3C8GD 3G4XA 4HE8D 3UR3C 1TWAA 4QI0A 2DB4A 2H8AA 4OIQF 2CCYA 5BQIA 2XXAB 4EKWA 4M63A 4O6NA 3DM9B 3IQ6A 1M2VB 1E84A 2M4EA 1NFNA 1VB5A 1EQ1A 2YZSA 4YT5A 1HE9A 2IBFA 2FFHA 2HJ3A 4OIPF 4PR9A 5D91A 1GGQA 4AE4B 4EBJA 2PX0A 1OR3A 4N4WA 3CAXA 1AUEA 2HSQA 3DE8A 4IARA 3CZ6A 1TWCA 4MQ9F 4Q7CA 4YL0A 4BJ6C 3ZSUA 3A9CA 1RKEB 4A4AA 4DRHB 3I5QA 2AU5A 3KYJA 3RIPA 1MNEA 1ORJA 3HNIA 3US6A 1I4ZA 4ANJA 4LACB 5B3IA 3EGDA 4EHPA 3FDQA 1FFHA 1A7DA 3U9MA 2DI3A 2H7OA 2ZXRA 3KKBA 4WJ0A 2EPOA 3I5PA 3IQ5A 5E33A 3TULA 3L8IA 1C02A 2R7QA 4BJ1A 2G3KA 1ZW3A 3TQOA 3C62A 4N06A 2XXAA 5DQTA 2ZXOA 4DJ9A 4ZLDA 1OKKD 3EGXB 3O39A 2YHSA 3E9VA 4PJLA 4WGZA 3B0UX 2KSFA 1M2VA 5JS5A 1E86A 4F4BA 1YA7O 4MS2A 4NY3A 3PCVA 3FMSA 4ONSA 3RH3A 3WG7C 2L81A 2OEVA 2XL6A 4E7SA 2J7PD 2BC5A 3U8VA 4AE4A 4U5CE 1RJ9B 2IYLD 1G4US 1JOGA 1YARO 1LS1A 1LS4A 5L3QA 1OCRC 1VYKA 3JCUQ 4L6RA 1RKEA 2ZPAA 3RQFA 3EZIA 3GM1A 2OU6A 2KW3C 3SXZA 3X1OA 2L6FA 5AC5A 1VMAA 3Q6MA 1A7VA 3M79A 3NMJA 3TK0A 1PV3A 3LS0A 1K04A 1GQAA 1M56C 3WODF 1HW1A 4LLCA 2R7WA 3ZIBA 1I5NA 1T6IA 3ECSA 5L3VA 2GWWA 2XLEA 3MLGA 3HLZA 1V4AA 3FAPB 1JPNA 1XWJA 2X51A 1VYIA 1MQVA 2GFHA 3NKEA 2ETSA 2ZD9A 3N24A 1Z5ZA 5F5FA 3EGXA 5BUOA 2XLMA 3M4BA 4LERA 1Z7Qc 1U6HA 3LLIA 3GWLA 4XQ1A 3GEIA 5EK0A 3AG2C 2WZLA 3LLKA 4P9TA 3W2VA 1KTMA 2XS8A 4CDVA 3FHDA 3AQCA 5EGYA 3K1HA 3GEEA 5COGA 1RJ9A 4IGGA 5COFA 3AG3C 1ORSC 3SXMA 2XM4A 4HFKB 2VCCA 2YL3A 3M15A 2LQGA 2J9WA 3MYFA 2IXOA 3QTHA 4FWVA 2B0JA 3DJUB 4NCQA 4W8PA 3POVA 1FMVA 2R7OA 2WZFA 5CIVA 3ABKC 1OCOC 2IOQA 1TR2A 1QLEC 3G50A 3EG9B 3GORA 3HJCA 3L34A
chains in the Genus database with same CATH topology
3HNLA 4CX9A 1JAFA 1BBHA 5JP7A 1EKYA 1APCA 2XLVA 4JE9A 3C63A 1QQ3A 3HNJA 2XLOA 1YZAA 1YYXA 4CJOA 1YZCA 2CCYA 5AGFA 2XL8A 3IQ6A 4JEAA 1E84A 2YL7A 4ER9A 3ZQYA 3ZWIA 3NMKA 2YLIA 3TOLA 4CDAA 4JEBA 3DE9A 4U9EA 4IAQA 4N4WA 4CJGA 2YLGA 3DE8A 4IARA 5JT4A 4D4XA 1NBBA 3QVZA 3FOOA 3ZTZA 3HNIA 4CDYA 4IB4A 5B3IA 2XM0A 2XLWA 1QPUA 3QW1A 1YYJA 2QLAA 2J9BA 3IQ5A 3U8PA 1CGNA 4CIPA 3FOPA 3C62A 3TOMA 3ZTMA 4WGZA 2J8WA 5JS5A 1E86A 4D4NA 3QW0A 2XL6A 2BC5A 1CPRA 5JVEA 2YL1A 4EIYA 4L6RA 4WGYA 5JRAA 1A7VA 3M79A 3NMJA 1GQAA 3M4CA 1E83A 2XLEA 2XLDA 1E85A 3ZQVA 1MQVA 2YLDA 4N6HA 3VRCA 2YL0A 2XLMA 3M4BA 1S05A 1CPQA 3L1MA 4NC3A 256BA 1M6TA 4U9DA 4CDVA 5JSLA 2YKZA 2XLHA 5JLIA 5JUAA 4JKVA 1RCPA 2XM4A 3QVYA 2YL3A 3M15A 1CGOA 1LM3B 4ULVA 3HNKA 3NMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HNL A;  4CX9 A;  1JAF A;  1BBH A;  5JP7 A;  1EKY A;  1APC A;  2XLV A;  4JE9 A;  3C63 A;  1QQ3 A;  3HNJ A;  2XLO A;  1YZA A;  1YYX A;  4CJO A;  1YZC A;  2CCY A;  5AGF A;  2XL8 A;  3IQ6 A;  4JEA A;  1E84 A;  2YL7 A;  4ER9 A;  3ZQY A;  3ZWI A;  3NMK A;  2YLI A;  3TOL A;  4CDA A;  4JEB A;  3DE9 A;  4U9E A;  4IAQ A;  4N4W A;  4CJG A;  2YLG A;  3DE8 A;  4IAR A;  5JT4 A;  4D4X A;  1NBB A;  3QVZ A;  3FOO A;  3ZTZ A;  3HNI A;  4CDY A;  4IB4 A;  5B3I A;  2XM0 A;  2XLW A;  1QPU A;  3QW1 A;  1YYJ A;  2QLA A;  2J9B A;  3IQ5 A;  3U8P A;  1CGN A;  4CIP A;  3FOP A;  3C62 A;  3TOM A;  3ZTM A;  4WGZ A;  2J8W A;  5JS5 A;  1E86 A;  4D4N A;  3QW0 A;  2XL6 A;  2BC5 A;  1CPR A;  5JVE A;  2YL1 A;  4EIY A;  4L6R A;  4WGY A;  5JRA A;  1A7V A;  3M79 A;  3NMJ A;  1GQA A;  3M4C A;  1E83 A;  2XLE A;  2XLD A;  1E85 A;  3ZQV A;  1MQV A;  2YLD A;  4N6H A;  3VRC A;  2YL0 A;  2XLM A;  3M4B A;  1S05 A;  1CPQ A;  3L1M A;  4NC3 A;  256B A;  1M6T A;  4U9D A;  4CDV A;  5JSL A;  2YKZ A;  2XLH A;  5JLI A;  5JUA A;  4JKV A;  1RCP A;  2XM4 A;  3QVY A;  2YL3 A;  3M15 A;  1CGO A;  1LM3 B;  4ULV A;  3HNK A;  3NMI A; 
#chains in the Genus database with same CATH topology
 1BR1 A;  3DAG A;  2WVN A;  4MVZ A;  1TKN A;  3HNL A;  3VM6 A;  3AG1 C;  2C04 A;  1RXQ A;  3K33 A;  4BJ6 A;  3JSE O;  2XS1 A;  2L7A A;  1BBH A;  2EPL X;  2P7V A;  1XZQ A;  1KNY A;  1WTY A;  3Q7G A;  3AGU A;  2XLV A;  4JE9 A;  4E0H A;  2WVO A;  2HMQ A;  2D5R B;  2XSE A;  3L8J A;  4AK9 A;  1Z63 A;  1QQ3 A;  3KYI A;  4XTK A;  2A0U A;  1QVX A;  3DXJ F;  4J7Y A;  4KBL A;  2HZ8 A;  5A6B D;  2TMV P;  3JRT A;  2Q9B A;  5AGF A;  1TFK B;  3AJM A;  3S84 A;  4PFP A;  3PDM P;  4P9F A;  3B0P A;  3DI5 A;  3Q7L A;  4DBR A;  4H4K C;  3T9O A;  2DYS C;  3IPM O;  1YA9 A;  1FTS A;  1KU2 A;  1E2X A;  3NMK A;  2YLI A;  4CS9 A;  4E0I A;  4CDA A;  1J8Y F;  3LS1 A;  4JEB A;  1QZX A;  2EPN A;  2Q4F A;  4OIR F;  3K1I C;  1U0B B;  2W4B A;  5JT4 A;  2P61 A;  1GM5 A;  1M2O A;  1ZHW A;  3EG9 A;  5EHH A;  3KH2 A;  2UUH A;  1O87 A;  3TD7 A;  1NBB A;  3F47 A;  3FOO A;  2J0W A;  3ZTZ A;  4FAP B;  1VOM A;  1K05 A;  2W45 A;  1K40 A;  1NSG B;  1ZHT A;  4K7B A;  2H7V C;  4C3E A;  1VLS A;  2DYR C;  2AP3 A;  3BRJ A;  3NYL A;  1ZHX A;  4XPX A;  5TJ5 E;  1Z23 A;  4IJJ A;  1YYJ A;  2OEX A;  2PX3 A;  2NPU A;  5F28 E;  2J46 A;  1CGN A;  3LEV A;  1R4T A;  2Q3T A;  1MMG A;  1AEP A;  3B9Q A;  3FOP A;  2WB7 A;  3JZ0 A;  2FGY A;  3O6X A;  4XEK A;  2HS5 A;  1OXK A;  2Y3D A;  3E70 C;  2VCB A;  4N6C A;  2A0B A;  3TOM A;  1Q0D A;  1LI7 A;  2A6E F;  2AWC A;  4JJG A;  3EFO B;  4JJF A;  1MMA A;  1MMN A;  5CI9 A;  4D4N A;  3QW0 A;  4AX2 A;  3RKO F;  3LNR A;  1YAU O;  3I4U A;  4FES A;  4K1O A;  5L0C A;  2R7S A;  3EHM A;  1NLX A;  4HFF B;  3C18 A;  3WHN A;  1B68 A;  5JVE A;  4EIY A;  2JD3 A;  1G5Z A;  4JTC B;  3S9O A;  1A0B A;  1OW8 A;  3WAQ A;  4Z9J A;  1HMO A;  3G4Z A;  1HY5 A;  1MMD A;  2L9J A;  4GYT A;  4MND A;  4XEV A;  3VF0 A;  2RSE B;  3GAN A;  3JYH A;  4JW1 A;  2UUI A;  3GM3 A;  2R03 A;  3IQC A;  1T01 A;  3AG4 C;  3W8H A;  3M4C A;  3JYY A;  4YN0 B;  4DBQ A;  5HV9 A;  1HW2 A;  5FCL A;  2OCC C;  4DVY P;  2I8B A;  1JPJ A;  2EPM X;  4U5E E;  3LES A;  2KK1 A;  3SNH A;  4XLP F;  1U89 A;  4C7O B;  2OJE D;  4K0D A;  2AVK A;  3U3F A;  4CS9 C;  2YLD A;  1WAS A;  3ASN C;  2JX0 A;  5L0D A;  2LIG A;  4BJ5 C;  2HUJ A;  2R05 A;  3EFO A;  2ZXW C;  2BL2 A;  3LAY A;  1CPQ A;  4JZA A;  1NZE A;  1SMY F;  3MFN A;  3UMK A;  3VAY A;  1NG1 A;  2C03 A;  1DOV A;  4KC9 A;  4U9D A;  5CI8 A;  5B1B C;  2YVK A;  4MVQ A;  1T6U A;  5L0G A;  4I44 A;  2Q7R A;  2G62 A;  3TJ6 A;  5JSL A;  3EJN A;  4C3B A;  2PP4 A;  5JLI A;  5JUA A;  3O10 A;  3QVY A;  4JRZ A;  4RD9 A;  2CDQ A;  3KL4 A;  4O6Y A;  4H54 A;  2ICW G;  1ZVZ A;  1CGO A;  3IEE A;  3AQB A;  2AWY A;  1GS9 A;  2NUP B;  2YWA A;  3NMI A;  3K1I A;  2EIJ C;  3SZR A;  4BJT A;  4CX9 A;  3KPH A;  2HV7 A;  5T3W A;  4C7O A;  2LFD A;  1ZU5 A;  3W4Y A;  1JAF A;  2Q00 A;  3AGT A;  4IRU A;  5KYU B;  4XPW A;  4O7G A;  1WWP A;  4PAC A;  1SZI A;  1Q0M A;  2LSE A;  1APC A;  2PF4 E;  2PFD A;  3HTK C;  4MW3 A;  3U3B A;  4MW8 A;  4JVS A;  3T4R A;  4PJN A;  1TWG A;  2YRF A;  1NU7 D;  2J0X A;  1LVK A;  2XLO A;  2QY9 A;  3JRM O;  4BEJ A;  1O5H A;  1MND A;  3H2V A;  1YYX A;  2LCH A;  5B3S C;  3NG1 A;  2CNW A;  1LKX A;  2IXN A;  3JTL O;  5K0I A;  4YT4 A;  4YK5 A;  2HKV A;  5L0J A;  1L3P A;  2YL7 A;  3C8G B;  4J32 B;  4E7Z A;  3ZQY A;  3ASO C;  4R32 A;  1N1C A;  3TOL A;  2L6H A;  5BQG A;  4QI2 A;  5F5H A;  4OD5 A;  2FAP B;  2Q9C A;  2VCA A;  1D1C A;  1Y6D A;  1UG7 A;  3DE9 A;  2EIK C;  3SXK A;  4OIO F;  2F22 A;  2NUP A;  1FMW A;  1OQC A;  2Y3G A;  4G7H F;  3UGO A;  2QNL A;  3QVZ A;  5DVW A;  3X2Q C;  3JT1 A;  4CDY A;  1SR2 A;  3FXH A;  2NUT B;  5E2Q A;  1C17 M;  1BZ4 A;  5KYU A;  3RW0 A;  4BPM A;  2R7R A;  4YT8 A;  1QPU A;  3QW1 A;  1G4W R;  1ZYR F;  4PJM A;  5A69 A;  2EPK X;  4JTD B;  2QLA A;  2YQY A;  2J9B A;  1OR2 A;  3K6B A;  3U8P A;  4CIP A;  4DOZ A;  2IXM A;  1ORY A;  1FFT C;  4NTB A;  3HKK A;  4XWJ A;  4OIN F;  4BEM J;  4CS8 A;  4RDA A;  1VLT A;  4LLE A;  1BR4 A;  3CEX A;  3J06 A;  3V5X A;  1TQG A;  1V74 B;  2ZXP A;  2QUP A;  3KMI A;  4NQF A;  5E3C A;  3LUT B;  3ZTM A;  2EIL C;  2B0H A;  2OQM A;  3C8Z A;  2R25 A;  4EWC A;  2J8W A;  2LP4 A;  3NYJ A;  3QMK A;  2O9X A;  3C8G A;  3CQZ A;  3LNM B;  2Y3B A;  3PMR A;  3Q6N A;  4YL1 A;  4BJ5 A;  3N0T A;  4JC7 A;  1D1A A;  4EUK B;  3IHU A;  3FAJ A;  3GEH A;  1IW7 F;  4MVR A;  4JCZ A;  2MYS A;  4JIO A;  1CPR A;  4LDQ A;  3S27 A;  2W4M A;  3R7C A;  3OWT A;  2YL1 A;  2CYD A;  4W8K A;  3DD7 A;  5HSW A;  4CJO A;  2EIM C;  4WGY A;  3U9J A;  4QDL A;  1JRA A;  1BR2 A;  4G0H A;  4O6M A;  3H65 A;  3RQE A;  5AC4 A;  2NUT A;  4AL0 A;  2XRH A;  3SEO A;  3OA1 A;  3QZC A;  4IWB A;  3U2L A;  4J30 B;  2R7X A;  4XPY A;  1W2W A;  1I4Y A;  3DAF A;  1E83 A;  4Q4Z F;  3ITF A;  1EA8 A;  3T6G B;  1O3U A;  5D92 A;  2XLD A;  4O79 A;  1E85 A;  3V7O A;  2HV6 A;  1EI7 A;  1ST6 A;  4JCH A;  2Y69 C;  4N6H A;  5KYX B;  1D1B A;  2YL0 A;  1T6Q A;  2KC3 A;  5COM A;  4I1M A;  3B0V C;  1H9G A;  1S05 A;  3K66 A;  2HMZ A;  2P6V A;  1IZM A;  2J9V A;  1OKK A;  1T9K A;  1WN0 A;  2P0N A;  3MBG A;  4DRJ B;  2LK4 A;  3EQL F;  1PD1 A;  4OD4 A;  1TFO B;  2E87 A;  3GM2 A;  3GOD A;  4LDR A;  1OW7 A;  2R9R B;  1LPE A;  1C03 A;  1ZU4 A;  2XL4 A;  3H2U A;  2YKZ A;  2QTV A;  2VH3 A;  2J7P A;  1RCP A;  2Z15 A;  4JKV A;  2NG1 A;  5GPG B;  4G7O F;  1VK5 A;  4E17 A;  3SXY A;  2KNH A;  4CS8 C;  1ZZP A;  1D0X A;  2HSB A;  3CSK A;  3T6B A;  4BG0 A;  1VTM P;  2VB6 A;  5L0H A;  3UGP A;  3U2M A;  3UMI A;  5B1A C;  3RF3 A;  3W2W A;  3EHN A;  3ZVR A;  4G7Z F;  2R7U A;  3ZC4 A;  4UDV A;  2A68 F;  3LJB A;  2R7T A;  1PCX A;  2M64 A;  4JTA B;  1ZW2 A;  2PNO A;  3O55 A;  1Y4C A;  5FZT A;  2PBE A;  2HFI A;  1EKY A;  4NTA A;  4P6I C;  4ZLC A;  2A69 F;  3OEO A;  5KYX A;  2HJM A;  2JPU A;  4PJJ A;  4CSA A;  3SYN A;  2L6G A;  3ATP A;  4HEA J;  2J45 A;  3V5Z A;  2NSG A;  2R02 A;  3V5Y A;  3S28 A;  1L7C A;  1JMW A;  1LI5 A;  1YZC A;  1D0Y A;  2A1D D;  2W9Y A;  1NFO A;  2OJQ A;  2XL8 A;  2CGE A;  4XLN F;  4JEA A;  2QE9 A;  4ER9 A;  4EBK A;  3BEH A;  4MVO A;  1Z3I X;  1OXB A;  3ZWI A;  2KJG A;  4YJW A;  2LD6 A;  4U9E A;  2GDC A;  4IAQ A;  4J7T A;  4CJG A;  2YLG A;  5KYY B;  1YJG A;  2P1A A;  4D4X A;  1H7I A;  2KYH A;  5A6K A;  1XZP A;  1FAP B;  1SYQ A;  1DOW A;  4CIH A;  2VC9 A;  4KNW A;  4I3M A;  4U5B E;  4DRI B;  4IB4 A;  5KYW B;  3DKA A;  3DJN B;  2XM0 A;  2IM8 A;  2XLW A;  2OG2 A;  3FVY A;  3R2P A;  3U0C A;  1V55 C;  1M57 C;  5IY5 C;  1YDI A;  4A2N B;  5A6A A;  3IQT A;  4Z9I A;  1J8M F;  4KNV A;  3C7J A;  3S0X A;  3DZA A;  2KQ9 A;  1A7E A;  1WGW A;  1Z6A A;  2I15 A;  4GQH A;  1CGM E;  4YWQ A;  4JUR I;  3JSZ A;  1HE1 A;  4XEF A;  3PHF 2;  1YLM A;  1WAT A;  2NSF A;  5A6B A;  3EH1 A;  2IXP A;  2J9U A;  1QSP A;  2LFF A;  4B6I A;  1PD0 A;  1R5I D;  1SF8 A;  2VAS A;  3NKD A;  5BQH A;  5KYN A;  4PK4 A;  3VYW A;  3UNG C;  1LE4 A;  2KGO A;  4I1O B;  5KYY A;  2V3C C;  1UFB A;  3M1C B;  2H7B A;  5L0I A;  1Q0F A;  1YVI A;  2YEV A;  4CSA C;  1OW6 A;  2Q9A A;  1FR0 A;  1RKC A;  1BDJ B;  2WZG A;  1AVO B;  4YT2 A;  3ZG1 A;  5JRA A;  5KYW A;  2A6H F;  3DMD A;  1Q0K A;  1TWH A;  2V26 A;  1OCZ C;  2DGJ A;  3N2Z B;  1ZHY A;  3ZDL A;  1G8X A;  3A11 A;  3EPV A;  3S90 A;  3NYM A;  1A41 A;  3ABM C;  3NRH A;  3MYI A;  4FX5 A;  3TJ5 A;  4GEH A;  3SP1 A;  4IAO A;  3RYL A;  3F46 A;  3GWN A;  4KI2 A;  3ZQV A;  4X0R A;  3VRC A;  4C3D A;  1Q0G A;  4DVZ A;  4MVS A;  1H6G A;  3B29 A;  1LE2 A;  2CW0 F;  2ASR A;  3LEO A;  4MVM A;  4EBB A;  2CNW D;  4MTO A;  2MWQ A;  4G78 A;  3W8I A;  3EZH A;  3L1M A;  4NC3 A;  256B A;  5DQZ A;  1S7Z A;  1M6T A;  4U5G A;  1NU9 C;  3RVY A;  4CBE A;  4U5D E;  4DXW A;  4AL1 A;  2GA0 A;  5DS4 A;  5DS5 A;  4MTF A;  5T1D B;  5T3T A;  4ULW A;  1HMD A;  2XLH A;  2MHR A;  1WOL A;  3T6J A;  3K7D A;  1V54 C;  4Z9H A;  5L0F A;  4NTF A;  2WL8 A;  2EIN C;  2WVQ A;  1D0Z A;  3DWW A;  3UMH A;  1FNT c;  1LM3 B;  4RBN A;  3MX3 A;  1JR8 A;  1LIH A;  3HNK A;  4ULV A;  1H9T A;  4U5F E;  2G3V A;  4MTG A;  3U5S A;  2R7V A;  2RD9 A;  3L0I A;  4WAB A;  2OKU A;  2GAQ A;  4U5H A;  2OOC A;  3EH2 A;  2BE5 F;  4MVU A;  4PFO A;  3NDB B;  5DS6 A;  4LDK A;  2Y39 A;  3EGD B;  1ZHZ A;  2X0C A;  4E18 A;  3RQG A;  5JP7 A;  3RFY A;  4CS7 A;  5DLJ A;  1T5O A;  4YL3 A;  3AOU A;  5A6J A;  3B71 A;  1F1M A;  3C63 A;  3HNJ A;  3RVZ A;  3S29 A;  5E3A A;  3ABL C;  1RMV A;  4Q5S F;  2Y3H A;  3DM5 A;  2D4U A;  1OCC C;  1QKR A;  1YZA A;  3C8G D;  3G4X A;  4HE8 D;  3UR3 C;  1TWA A;  4QI0 A;  2DB4 A;  2H8A A;  4OIQ F;  2CCY A;  5BQI A;  2XXA B;  4EKW A;  4M63 A;  4O6N A;  3DM9 B;  3IQ6 A;  1M2V B;  1E84 A;  2M4E A;  1NFN A;  1VB5 A;  1EQ1 A;  2YZS A;  4YT5 A;  1HE9 A;  2IBF A;  2FFH A;  2HJ3 A;  4OIP F;  4PR9 A;  5D91 A;  1GGQ A;  4AE4 B;  4EBJ A;  2PX0 A;  1OR3 A;  4N4W A;  3CAX A;  1AUE A;  2HSQ A;  3DE8 A;  4IAR A;  3CZ6 A;  1TWC A;  4MQ9 F;  4Q7C A;  4YL0 A;  4BJ6 C;  3ZSU A;  3A9C A;  1RKE B;  4A4A A;  4DRH B;  3I5Q A;  2AU5 A;  3KYJ A;  3RIP A;  1MNE A;  1ORJ A;  3HNI A;  3US6 A;  1I4Z A;  4ANJ A;  4LAC B;  5B3I A;  3EGD A;  4EHP A;  3FDQ A;  1FFH A;  1A7D A;  3U9M A;  2DI3 A;  2H7O A;  2ZXR A;  3KKB A;  4WJ0 A;  2EPO A;  3I5P A;  3IQ5 A;  5E33 A;  3TUL A;  3L8I A;  1C02 A;  2R7Q A;  4BJ1 A;  2G3K A;  1ZW3 A;  3TQO A;  3C62 A;  4N06 A;  2XXA A;  5DQT A;  2ZXO A;  4DJ9 A;  4ZLD A;  1OKK D;  3EGX B;  3O39 A;  2YHS A;  3E9V A;  4PJL A;  4WGZ A;  3B0U X;  2KSF A;  1M2V A;  5JS5 A;  1E86 A;  4F4B A;  1YA7 O;  4MS2 A;  4NY3 A;  3PCV A;  3FMS A;  4ONS A;  3RH3 A;  3WG7 C;  2L81 A;  2OEV A;  2XL6 A;  4E7S A;  2J7P D;  2BC5 A;  3U8V A;  4AE4 A;  4U5C E;  1RJ9 B;  2IYL D;  1G4U S;  1JOG A;  1YAR O;  1LS1 A;  1LS4 A;  5L3Q A;  1OCR C;  1VYK A;  3JCU Q;  4L6R A;  1RKE A;  2ZPA A;  3RQF A;  3EZI A;  3GM1 A;  2OU6 A;  2KW3 C;  3SXZ A;  3X1O A;  2L6F A;  5AC5 A;  1VMA A;  3Q6M A;  1A7V A;  3M79 A;  3NMJ A;  3TK0 A;  1PV3 A;  3LS0 A;  1K04 A;  1GQA A;  1M56 C;  3WOD F;  1HW1 A;  4LLC A;  2R7W A;  3ZIB A;  1I5N A;  1T6I A;  3ECS A;  5L3V A;  2GWW A;  2XLE A;  3MLG A;  3HLZ A;  1V4A A;  3FAP B;  1JPN A;  1XWJ A;  2X51 A;  1VYI A;  1MQV A;  2GFH A;  3NKE A;  2ETS A;  2ZD9 A;  3N24 A;  1Z5Z A;  5F5F A;  3EGX A;  5BUO A;  2XLM A;  3M4B A;  4LER A;  1Z7Q c;  1U6H A;  3LLI A;  3GWL A;  4XQ1 A;  3GEI A;  5EK0 A;  3AG2 C;  2WZL A;  3LLK A;  4P9T A;  3W2V A;  1KTM A;  2XS8 A;  4CDV A;  3FHD A;  3AQC A;  5EGY A;  3K1H A;  3GEE A;  5COG A;  1RJ9 A;  4IGG A;  5COF A;  3AG3 C;  1ORS C;  3SXM A;  2XM4 A;  4HFK B;  2VCC A;  2YL3 A;  3M15 A;  2LQG A;  2J9W A;  3MYF A;  2IXO A;  3QTH A;  4FWV A;  2B0J A;  3DJU B;  4NCQ A;  4W8P A;  3POV A;  1FMV A;  2R7O A;  2WZF A;  5CIV A;  3ABK C;  1OCO C;  2IOQ A;  1TR2 A;  1QLE C;  3G50 A;  3EG9 B;  3GOR A;  3HJC A;  3L34 A; 
#chains in the Genus database with same CATH homology
 3HNL A;  4CX9 A;  1JAF A;  1BBH A;  5JP7 A;  1EKY A;  1APC A;  2XLV A;  4JE9 A;  3C63 A;  1QQ3 A;  3HNJ A;  2XLO A;  1YZA A;  1YYX A;  4CJO A;  1YZC A;  2CCY A;  5AGF A;  2XL8 A;  3IQ6 A;  4JEA A;  1E84 A;  2YL7 A;  4ER9 A;  3ZQY A;  3ZWI A;  3NMK A;  2YLI A;  3TOL A;  4CDA A;  4JEB A;  3DE9 A;  4U9E A;  4IAQ A;  4N4W A;  4CJG A;  2YLG A;  3DE8 A;  4IAR A;  5JT4 A;  4D4X A;  1NBB A;  3QVZ A;  3FOO A;  3ZTZ A;  3HNI A;  4CDY A;  4IB4 A;  5B3I A;  2XM0 A;  2XLW A;  1QPU A;  3QW1 A;  1YYJ A;  2QLA A;  2J9B A;  3IQ5 A;  3U8P A;  1CGN A;  4CIP A;  3FOP A;  3C62 A;  3TOM A;  3ZTM A;  4WGZ A;  2J8W A;  5JS5 A;  1E86 A;  4D4N A;  3QW0 A;  2XL6 A;  2BC5 A;  1CPR A;  5JVE A;  2YL1 A;  4EIY A;  4L6R A;  4WGY A;  5JRA A;  1A7V A;  3M79 A;  3NMJ A;  1GQA A;  3M4C A;  1E83 A;  2XLE A;  2XLD A;  1E85 A;  3ZQV A;  1MQV A;  2YLD A;  4N6H A;  3VRC A;  2YL0 A;  2XLM A;  3M4B A;  1S05 A;  1CPQ A;  3L1M A;  4NC3 A;  256B A;  1M6T A;  4U9D A;  4CDV A;  5JSL A;  2YKZ A;  2XLH A;  5JLI A;  5JUA A;  4JKV A;  1RCP A;  2XM4 A;  3QVY A;  2YL3 A;  3M15 A;  1CGO A;  1LM3 B;  4ULV A;  3HNK A;  3NMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...