1E85A

Cytochrome c' from alcaligenes xylosoxidans - reduced structure with no bound to proximal side of heme
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
125
structure length
125
Chain Sequence
b'EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Unprecedented Proximal Binding of Nitric Oxide to Heme: Implications for Guanylate Cyclase.
pubmed doi rcsb
molecule tags Electron transport
total genus 49
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2000-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1e85A00
1LM3B 2YL1A 4U9EA 4CDVA 3ZQYA 2YL3A 2XM0A 1BBHA 4IB4A 2YL0A 2YLIA 4D4NA 4CJOA 5JRAA 1E83A 1QPUA 2YLGA 4L6RA 5B3IA 3IQ6A 4JEBA 2YKZA 3C62A 1CGOA 3U8PA 5JUAA 1QQ3A 4IAQA 3NMIA 3NMKA 4JE9A 3M79A 3VRCA 2YL7A 2XLVA 4IARA 3HNKA 4D4XA 2XLHA 4N6HA 4CDYA 3HNIA 3C63A 3M4BA 4U9DA 2CCYA 3FOOA 3HNJA 5JLIA 1YYJA 1NBBA 3ZTZA 1GQAA 3QVYA 5JP7A 4N4WA 2XL6A 3TOMA 1YYXA 3L1MA 2BC5A 3IQ5A 1M6TA 4CX9A 5JS5A 5JSLA 256BA 1MQVA 3QW1A 2XLWA 1APCA 4JEAA 3DE8A 4ER9A 4CJGA 3ZWIA 3M15A 5JVEA 4NC3A 4WGZA 3QVZA 2YLDA 4CDAA 3HNLA 2QLAA 1RCPA 1CPRA 4ULVA 3ZTMA 3ZQVA 1E84A 2XLEA 2J8WA 3TOLA 3M4CA 1S05A 4CIPA 2XLDA 2XLOA 1YZCA 2J9BA 2XLMA 3NMJA 1YZAA 1EKYA 1A7VA 4EIYA 3FOPA 5AGFA 2XL8A 4WGYA 1E86A 4JKVA 1E85A 1CPQA 3QW0A 1CGNA 2XM4A 3DE9A 1JAFA 5JT4A
chains in the Genus database with same CATH superfamily
2YL1A 4P6IC 1KU2A 3ZVRA 4CDVA 1QKRA 2QNLA 4U5BE 4RD9A 3N2ZB 3C18A 3ASNC 2XM0A 4BPMA 2AWCA 1W2WA 1YARO 4IB4A 1L3PA 3IHUA 3ITFA 1VB5A 2XS8A 3U0CA 2ASRA 2YL0A 3AQBA 2AVKA 4XQ1A 4DJ9A 4F4BA 3W2WA 1NU9C 4K1OA 3EGDA 4CJOA 2A68F 4LDQA 1E83A 1IW7F 1C03A 2XS1A 1QPUA 3GODA 3RW0A 5KYNA 4L6RA 5HV9A 4JEBA 3G4XA 1T6UA 3EGDB 3DAFA 3TJ5A 3GM2A 4Q5SF 1OKKD 2R9RB 4YL1A 3U8PA 4BEMJ 2IM8A 3E9VA 1FR0A 4I44A 3LEVA 2IBFA 2OKUA 1OW8A 1OXBA 2Y3DA 3K1HA 2J9UA 1FFHA 2V26A 2D4UA 3MBGA 5AC4A 1R5ID 2FFHA 3TD7A 1WGWA 4HEAJ 4GYTA 1O5HA 2XLHA 3NKEA 1D0YA 1M56C 3CQZA 4N6HA 4X0RA 1SZIA 4WJ0A 3GEHA 4AK9A 4CDYA 3FOOA 3L8JA 1YA7O 4YL3A 1J8YF 1YYJA 4MTFA 2FAPB 3A9CA 2A0UA 3O39A 1T5OA 1ZHWA 1T6IA 2A1DD 5COMA 3FXHA 3GM3A 4NQFA 3PMRA 4GEHA 3F46A 5JP7A 2XL6A 2WVNA 4DOZA 4C3BA 3V7OA 1YYXA 2J7PD 3S29A 3OWTA 1YLMA 2BC5A 2GDCA 4Q7CA 4LLEA 3IQ5A 2A69F 1ZVZA 4H54A 5T3TA 1A7EA 3VAYA 4CIHA 4G7OF 1HE9A 3B71A 4BG0A 4JW1A 4UDVA 5JSLA 1XZPA 2R7QA 4OD5A 4P9FA 3OEOA 3EHNA 4MQ9F 5T1DB 1RMVA 1ZZPA 3CEXA 2HZ8A 1ZHZA 3DD7A 4CJGA 4MNDA 1VLSA 2R02A 3MFNA 2LCHA 4O6YA 1QLEC 2WZFA 5BQHA 1ZHYA 1ZYRF 4XTKA 2NUPA 3QTHA 3QVZA 4I1OB 3WG7C 2XL4A 4CDAA 1H9TA 2HJMA 3IQCA 3HNLA 2VCCA 2NUPB 1K04A 1TR2A 1RCPA 3B0PA 4AL0A 5E2QA 3W4YA 1CPRA 3S90A 3C7JA 3JYHA 4MVOA 3KYJA 2KJGA 3TOLA 3MYIA 3ABMC 2ZXWC 3JCUQ 2Y39A 4JC7A 1IZMA 2C04A 3DI5A 3ATPA 3K1IC 5D92A 5B3SC 2R7SA 2HSQA 4E0IA 3DJNB 2AP3A 2HFIA 2ICWG 1EKYA 3AOUA 1A7VA 1Q0FA 3T6JA 3FOPA 1OR2A 3DWWA 1WWPA 3LLKA 3W8HA 3JYYA 5AGFA 3FMSA 4YT2A 2LFFA 3U9MA 4EBKA 3UGPA 5E33A 2YWAA 2OJED 4FWVA 4Z9HA 3GM1A 5AC5A 4CSAC 1ORJA 4YK5A 1GS9A 3ASOC 4BJ6C 1ZW3A 3JSEO 4JKVA 4AX2A 4B6IA 5A6BD 3JTLO 1WOLA 1CGNA 2NPUA 3UGOA 2XM4A 2OEXA 3DE9A 3LS1A 4NTAA 2PFDA 1Y6DA 3UMIA 1LVKA 4DRJB 2G3VA 1OQCA 3LAYA 1FMWA 2UUHA 3OA1A 2OQMA 4CSAA 4PJMA 3RVYA 1OCOC 4A4AA 3WHNA 3TQOA 1ORSC 2NG1A 2J0XA 3EQLF 3JRMO 2B0JA 2P1AA 2PBEA 2Q4FA 4GQHA 2EPMX 2GA0A 1T01A 3ABLC 1OCZC 4KBLA 1WATA 2HKVA 4PJLA 4OIOF 2YRFA 4J30B 3FDQA 4JTAB 1SYQA 2J46A 2WB7A 3TJ6A 4OIRF 3X2QC 3TULA 2XSEA 5HSWA 5JRAA 1NLXA 1Q0KA 1DOVA 3EG9A 4CS7A 2MYSA 2YKZA 3B9QA 3JRTA 4MVMA 5E3AA 4EBJA 1U0BB 3EG9B 1QSPA 2L6GA 3NG1A 5DQTA 4Z9IA 4G7ZF 4XPYA 4ZLCA 4E17A 4Q4ZF 1MMGA 2A0BA 3IEEA 1JPNA 1Z3IX 3AQCA 4PJNA 1FFTC 2A6EF 4OINF 2AWYA 3GORA 2ZXOA 2X51A 4CS8A 1YVIA 4D4XA 3J06A 2H7BA 2KC3A 3FAPB 3HNIA 1SMYF 2LD6A 3K6BA 4MTOA 4G78A 2CCYA 3HNJA 1OW7A 2VH3A 5JLIA 1HW2A 1VOMA 1FTSA 1NBBA 4EBBA 2VCBA 3GEIA 5COFA 4E18A 1D1BA 1AEPA 1Z6AA 2DB4A 5B1BC 3RQGA 4LERA 1Z7Qc 1PD1A 2QUPA 4O6MA 3QVYA 2KYHA 2O9XA 5DLJA 1VYKA 2W4MA 3DM5A 5COGA 1TQGA 3L1MA 4PACA 2BL2A 3EPVA 2M64A 5CIVA 1ZU4A 2CGEA 2WZGA 2QY9A 2EPOA 3W2VA 4C3EA 3FAJA 4MVSA 3VM6A 5L0IA 3K33A 1Y4CA 1ZU5A 2LK4A 3S28A 3S84A 3AG1C 3DM9B 4XEVA 3Q7GA 3U3FA 1FAPB 3QW1A 3CAXA 2R7XA 1VK5A 1KNYA 1VLTA 4HE8D 4JCZA 3ZWIA 2J0WA 1MMNA 4O6NA 3N0TA 4FAPB 1TWAA 3MLGA 3I5PA 3EZIA 3GWLA 3ZIBA 1HE1A 1H9GA 1KTMA 2M4EA 2YLDA 4YJWA 3LLIA 1OXKA 4O79A 4CS9C 2RSEB 1JRAA 3U2MA 1M2VA 3LUTB 2DYRC 3R2PA 4PK4A 3RKOF 3HTKC 4N6CA 5F5HA 3ZG1A 4YL0A 5L0GA 4I1MA 2HS5A 1JOGA 1RKEA 4U5HA 2R7RA 2OJQA 2XRHA 4A2NB 1M2VB 1QZXA 3ZQVA 5L0FA 1E84A 2Q9AA 1E2XA 1RKEB 1A0BA 3NRHA 4ULWA 1JMWA 2DGJA 3FVYA 3O6XA 4JTCB 2LIGA 4W8PA 5DS6A 3AG3C 2PP4A 5L0JA 5KYUA 4BJ1A 4XEFA 1D1CA 2PX0A 3KH2A 3LESA 2PNOA 2YHSA 1LIHA 2H7VC 3NYMA 5CI8A 1WASA 4XLNF 1FNTc 5KYUB 3L0IA 3B29A 4U5GA 2WVQA 1U89A 4KI2A 2OEVA 3CSKA 1LI7A 3SEOA 1BR4A 4JJGA 2EILC 3U2LA 2DI3A 2JPUA 4YN0B 2L81A 2WL8A 3SXKA 3ZC4A 1E85A 1CPQA 4KC9A 3MX3A 2Q9CA 4ZLDA 5EHHA 3U9JA 1JAFA 1O87A 1SF8A 1TWHA 5BQIA 1N1CA 1LM3B 4U9EA 3ZQYA 2V3CC 2YL3A 3U8VA 3AG4C 2CNWA 1ORYA 4C7OB 4JRZA 2IXMA 1BBHA 1I4ZA 2VC9A 4BJ5C 2KW3C 1XWJA 4RBNA 4U5DE 3IPMO 2IYLD 2AU5A 3M1CB 1YA9A 3V5YA 1VTMP 1CGME 3AGUA 1GGQA 3POVA 5A6AA 2CDQA 4NTBA 3L34A 2UUIA 2YLIA 4KNVA 2NSGA 1DOWA 4K0DA 1A7DA 4PR9A 3VYWA 1HMOA 4YT8A 3AJMA 3DMDA 4XPXA 3TK0A 4MVRA 2IOQA 2GWWA 3KL4A 2EIJC 5A6KA 4HFKB 5B3IA 3IQ6A 3K1IA 1C17M 1D0ZA 4ONSA 2Q00A 3C62A 3X1OA 1I4YA 2XXAA 4QI2A 1QQ3A 2IXNA 2QTVA 5DQZA 1V54C 4IAQA 3NMIA 2F22A 4RDAA 1EQ1A 3M79A 1SR2A 3VRCA 2R05A 2XXAB 2YL7A 3WAQA 3HNKA 4DBRA 1M2OA 1H7IA 3EJNA 4P9TA 4E0HA 5K0IA 3RQFA 3SNHA 4BJ6A 3PDMP 3KYIA 2I8BA 4EKWA 2KNHA 1Z23A 2KK1A 1OR3A 2LSEA 4AL1A 4EHPA 2ZD9A 1MMDA 1A41A 1V55C 1T6QA 3MYFA 3ZTZA 1BDJB 1LS1A 3SP1A 1GQAA 4U5EE 5BQGA 5EK0A 4I3MA 1G4US 3C8GD 2Y3BA 1O3UA 3F47A 4JJFA 4N06A 3SXMA 3UMHA 2L7AA 4N4WA 1K05A 5D91A 3TOMA 3EHMA 5KYXA 1YAUO 4AE4B 3LJBA 2ZXRA 1OCRC 1UFBA 3DAGA 1TWCA 1M6TA 3FHDA 5B1AC 1K40A 1LS4A 3EFOA 4CX9A 1S7ZA 5KYXB 5JS5A 3RYLA 2VASA 2G62A 1HY5A 2JD3A 2OCCC 3A11A 3LEOA 4MW3A 3S27A 256BA 2Q3TA 3EFOB 5A6JA 3DXJF 2BE5F 1APCA 3H2UA 2P6VA 3DE8A 4JEAA 3UMKA 4ER9A 2L6FA 2L9JA 5F5FA 2LP4A 1FMVA 1LKXA 2X0CA 3AGTA 1AVOB 1OW6A 2Q9BA 3DKAA 3Q7LA 1PCXA 4WGZA 2A6HF 5L3VA 2Y3GA 5CI9A 4M63A 4QI0A 3T4RA 5DS4A 1V4AA 4NY3A 4HFFB 1LE2A 1TFKB 2NSFA 4MW8A 2QLAA 3NDBB 1MNEA 2D5RB 3RFYA 1BR2A 4ULVA 3O55A 1AUEA 1ST6A 1Q0GA 3IQTA 2XLEA 1NSGB 3M4CA 2I15A 4DRHB 1S05A 1TKNA 2W4BA 3SXZA 4YWQA 1OKKA 2GAQA 4MVUA 1F1MA 2XLMA 3LNRA 4E7SA 2G3KA 3I4UA 3N24A 2C03A 3GEEA 2W45A 3NMJA 4LDRA 2QE9A 4EIYA 1WTYA 2RD9A 1Q0MA 2CYDA 3HLZA 3KMIA 4MVZA 4YT5A 2HMQA 4IJJA 3B0VC 2TMVP 4OIPF 5KYYA 1G4WR 4BJTA 2P61A 5DVWA 1NFOA 3B0UX 4U5FE 4JVSA 5A69A 2EINC 4JCHA 1NU7D 2R7OA 1G8XA 4K7BA 4LLCA 4NTFA 4R32A 5KYYB 1VYIA 1C02A 1LI5A 3BEHA 1EI7A 1LPEA 3EZHA 1D0XA 4XWJA 4J7YA 3U5SA 2EPLX 4H4KC 1BR1A 2H8AA 3O10A 4DBQA 5FCLA 5IY5C 2LQGA 4PFPA 4XEKA 2R7TA 3RIPA 1JPJA 3U3BA 4DVYP 2ZPAA 3NKDA 1ZHXA 3AG2C 3KPHA 2GFHA 2JX0A 1XZQA 1Z63A 2J7PA 1I5NA 2HUJA 3NYLA 4CS9A 1D1AA 3K7DA 5L0DA 4JURI 3GWNA 5L3QA 4C3DA 1WN0A 4JIOA 2E87A 2EPKX 2WVOA 4FX5A 4XPWA 5TJ5E 3S9OA 3W8IA 4D4NA 3JT1A 2YZSA 4OD4A 4IRUA 2J9WA 2W9YA 2YLGA 4MTGA 4IAOA 2EIMC 3T6BA 2P7VA 3Q6NA 2Y3HA 3JZ0A 2Q7RA 1CGOA 2LFDA 4WABA 3S0XA 2HV7A 5JUAA 4ANJA 5L0CA 1MMAA 3QMKA 1JR8A 3NMKA 4JE9A 4C7OA 1YJGA 2EIKC 2J9VA 3H2VA 2HSBA 2XLVA 4IARA 4IGGA 3HKKA 3ECSA 3KKBA 3K66A 4MS2A 2HMZA 5FZTA 3RH3A 3SYNA 1OCCC 4JTDB 3C63A 2MWQA 3M4BA 4U9DA 4OIQF 4E7ZA 3VF0A 1ZW2A 2YEVA 2KGOA 2OOCA 3C8ZA 3CZ6A 3LS0A 3RF3A 4DRIB 4JZAA 4J32B 2R7WA 3G50A 3US6A 3JSZA 3V5XA 4DXWA 1NG1A 4BJ5A 1UG7A 4DVZA 3RVZA 3ZSUA 1RJ9A 2CNWD 5BUOA 4LACB 3R7CA 2R03A 1Z5ZA 3DJUB 2P0NA 3UR3C 5A6BA 2B0HA 1RJ9B 3G4ZA 3EH1A 3ZDLA 4IWBA 3EH2A 4CBEA 1TFOB 1HMDA 4YT4A 1MQVA 2HV6A 3T9OA 4Z9JA 2XLWA 3L8IA 4G0HA 1HW1A 2FGYA 2VB6A 3M15A 1GM5A 1U6HA 1TWGA 5JVEA 2VCAA 4NC3A 4PFOA 2R7UA 2EPNA 4FESA 5F28E 5GPGB 2OU6A 4EWCA 5KYWA 2J45A 4BEJA 2KQ9A 2PX3A 3HJCA 3WODF 5EGYA 3UNGC 5T3WA 2HJ3A 3QZCA 1B68A 3NYJA 5KYWB 3E70C 1ZHTA 1VMAA 4EUKB 1BZ4A 1T9KA 4J7TA 4AE4A 3ABKC 3ZTMA 2MHRA 2YVKA 4KNWA 2DYSC 3C8GA 2CW0F 1PD0A 3GANA 3Q6MA 1J8MF 4NCQA 2J8WA 3H65A 1V74B 3RQEA 4CIPA 2XLDA 1Q0DA 2XLOA 1YZCA 2J9BA 3C8GB 3PCVA 3EGXA 4O7GA 3SXYA 3DZAA 3V5ZA 1YZAA 2PF4E 3SZRA 2OG2A 1R4TA 3LNMB 3I5QA 3EGXB 1H6GA 3T6GB 1NZEA 4W8KA 2R7VA 4G7HF 2IXOA 2Z15A 1RKCA 4QDLA 4LDKA 4CS8C 2Y69C 1M57C 1MNDA 2IXPA 1G5ZA 1L7CA 2XL8A 2YQYA 4MVQA 4U5CE 4WGYA 3PHF2 4PJJA 2KSFA 1E86A 1QVXA 2NUTA 3QW0A 3BRJA 4XLPF 2ZXPA 1NFNA 1LE4A 1EA8A 2L6HA 2R25A 5DS5A 1RXQA 5E3CA 5L0HA 2NUTB 5JT4A 2WZLA 1YDIA 2ETSA 1PV3A 2H7OA
chains in the Genus database with same CATH topology
1LM3B 2YL1A 4U9EA 4CDVA 3ZQYA 2YL3A 2XM0A 1BBHA 4IB4A 2YL0A 2YLIA 4D4NA 4CJOA 5JRAA 1E83A 1QPUA 2YLGA 4L6RA 5B3IA 3IQ6A 4JEBA 2YKZA 3C62A 1CGOA 3U8PA 5JUAA 1QQ3A 4IAQA 3NMIA 3NMKA 4JE9A 3M79A 3VRCA 2YL7A 2XLVA 4IARA 3HNKA 4D4XA 2XLHA 4N6HA 4CDYA 3HNIA 3C63A 3M4BA 4U9DA 2CCYA 3FOOA 3HNJA 5JLIA 1YYJA 1NBBA 3ZTZA 1GQAA 3QVYA 5JP7A 4N4WA 2XL6A 3TOMA 1YYXA 3L1MA 2BC5A 3IQ5A 1M6TA 4CX9A 5JS5A 5JSLA 256BA 1MQVA 3QW1A 2XLWA 1APCA 4JEAA 3DE8A 4ER9A 4CJGA 3ZWIA 3M15A 5JVEA 4NC3A 4WGZA 3QVZA 2YLDA 4CDAA 3HNLA 2QLAA 1RCPA 1CPRA 4ULVA 3ZTMA 3ZQVA 1E84A 2XLEA 2J8WA 3TOLA 3M4CA 1S05A 4CIPA 2XLDA 2XLOA 1YZCA 2J9BA 2XLMA 3NMJA 1YZAA 1EKYA 1A7VA 4EIYA 3FOPA 5AGFA 2XL8A 4WGYA 1E86A 4JKVA 1E85A 1CPQA 3QW0A 1CGNA 2XM4A 3DE9A 1JAFA 5JT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LM3 B;  2YL1 A;  4U9E A;  4CDV A;  3ZQY A;  2YL3 A;  2XM0 A;  1BBH A;  4IB4 A;  2YL0 A;  2YLI A;  4D4N A;  4CJO A;  5JRA A;  1E83 A;  1QPU A;  2YLG A;  4L6R A;  5B3I A;  3IQ6 A;  4JEB A;  2YKZ A;  3C62 A;  1CGO A;  3U8P A;  5JUA A;  1QQ3 A;  4IAQ A;  3NMI A;  3NMK A;  4JE9 A;  3M79 A;  3VRC A;  2YL7 A;  2XLV A;  4IAR A;  3HNK A;  4D4X A;  2XLH A;  4N6H A;  4CDY A;  3HNI A;  3C63 A;  3M4B A;  4U9D A;  2CCY A;  3FOO A;  3HNJ A;  5JLI A;  1YYJ A;  1NBB A;  3ZTZ A;  1GQA A;  3QVY A;  5JP7 A;  4N4W A;  2XL6 A;  3TOM A;  1YYX A;  3L1M A;  2BC5 A;  3IQ5 A;  1M6T A;  4CX9 A;  5JS5 A;  5JSL A;  256B A;  1MQV A;  3QW1 A;  2XLW A;  1APC A;  4JEA A;  3DE8 A;  4ER9 A;  4CJG A;  3ZWI A;  3M15 A;  5JVE A;  4NC3 A;  4WGZ A;  3QVZ A;  2YLD A;  4CDA A;  3HNL A;  2QLA A;  1RCP A;  1CPR A;  4ULV A;  3ZTM A;  3ZQV A;  1E84 A;  2XLE A;  2J8W A;  3TOL A;  3M4C A;  1S05 A;  4CIP A;  2XLD A;  2XLO A;  1YZC A;  2J9B A;  2XLM A;  3NMJ A;  1YZA A;  1EKY A;  1A7V A;  4EIY A;  3FOP A;  5AGF A;  2XL8 A;  4WGY A;  1E86 A;  4JKV A;  1E85 A;  1CPQ A;  3QW0 A;  1CGN A;  2XM4 A;  3DE9 A;  1JAF A;  5JT4 A; 
#chains in the Genus database with same CATH topology
 2YL1 A;  4P6I C;  1KU2 A;  3ZVR A;  4CDV A;  1QKR A;  2QNL A;  4U5B E;  4RD9 A;  3N2Z B;  3C18 A;  3ASN C;  2XM0 A;  4BPM A;  2AWC A;  1W2W A;  1YAR O;  4IB4 A;  1L3P A;  3IHU A;  3ITF A;  1VB5 A;  2XS8 A;  3U0C A;  2ASR A;  2YL0 A;  3AQB A;  2AVK A;  4XQ1 A;  4DJ9 A;  4F4B A;  3W2W A;  1NU9 C;  4K1O A;  3EGD A;  4CJO A;  2A68 F;  4LDQ A;  1E83 A;  1IW7 F;  1C03 A;  2XS1 A;  1QPU A;  3GOD A;  3RW0 A;  5KYN A;  4L6R A;  5HV9 A;  4JEB A;  3G4X A;  1T6U A;  3EGD B;  3DAF A;  3TJ5 A;  3GM2 A;  4Q5S F;  1OKK D;  2R9R B;  4YL1 A;  3U8P A;  4BEM J;  2IM8 A;  3E9V A;  1FR0 A;  4I44 A;  3LEV A;  2IBF A;  2OKU A;  1OW8 A;  1OXB A;  2Y3D A;  3K1H A;  2J9U A;  1FFH A;  2V26 A;  2D4U A;  3MBG A;  5AC4 A;  1R5I D;  2FFH A;  3TD7 A;  1WGW A;  4HEA J;  4GYT A;  1O5H A;  2XLH A;  3NKE A;  1D0Y A;  1M56 C;  3CQZ A;  4N6H A;  4X0R A;  1SZI A;  4WJ0 A;  3GEH A;  4AK9 A;  4CDY A;  3FOO A;  3L8J A;  1YA7 O;  4YL3 A;  1J8Y F;  1YYJ A;  4MTF A;  2FAP B;  3A9C A;  2A0U A;  3O39 A;  1T5O A;  1ZHW A;  1T6I A;  2A1D D;  5COM A;  3FXH A;  3GM3 A;  4NQF A;  3PMR A;  4GEH A;  3F46 A;  5JP7 A;  2XL6 A;  2WVN A;  4DOZ A;  4C3B A;  3V7O A;  1YYX A;  2J7P D;  3S29 A;  3OWT A;  1YLM A;  2BC5 A;  2GDC A;  4Q7C A;  4LLE A;  3IQ5 A;  2A69 F;  1ZVZ A;  4H54 A;  5T3T A;  1A7E A;  3VAY A;  4CIH A;  4G7O F;  1HE9 A;  3B71 A;  4BG0 A;  4JW1 A;  4UDV A;  5JSL A;  1XZP A;  2R7Q A;  4OD5 A;  4P9F A;  3OEO A;  3EHN A;  4MQ9 F;  5T1D B;  1RMV A;  1ZZP A;  3CEX A;  2HZ8 A;  1ZHZ A;  3DD7 A;  4CJG A;  4MND A;  1VLS A;  2R02 A;  3MFN A;  2LCH A;  4O6Y A;  1QLE C;  2WZF A;  5BQH A;  1ZHY A;  1ZYR F;  4XTK A;  2NUP A;  3QTH A;  3QVZ A;  4I1O B;  3WG7 C;  2XL4 A;  4CDA A;  1H9T A;  2HJM A;  3IQC A;  3HNL A;  2VCC A;  2NUP B;  1K04 A;  1TR2 A;  1RCP A;  3B0P A;  4AL0 A;  5E2Q A;  3W4Y A;  1CPR A;  3S90 A;  3C7J A;  3JYH A;  4MVO A;  3KYJ A;  2KJG A;  3TOL A;  3MYI A;  3ABM C;  2ZXW C;  3JCU Q;  2Y39 A;  4JC7 A;  1IZM A;  2C04 A;  3DI5 A;  3ATP A;  3K1I C;  5D92 A;  5B3S C;  2R7S A;  2HSQ A;  4E0I A;  3DJN B;  2AP3 A;  2HFI A;  2ICW G;  1EKY A;  3AOU A;  1A7V A;  1Q0F A;  3T6J A;  3FOP A;  1OR2 A;  3DWW A;  1WWP A;  3LLK A;  3W8H A;  3JYY A;  5AGF A;  3FMS A;  4YT2 A;  2LFF A;  3U9M A;  4EBK A;  3UGP A;  5E33 A;  2YWA A;  2OJE D;  4FWV A;  4Z9H A;  3GM1 A;  5AC5 A;  4CSA C;  1ORJ A;  4YK5 A;  1GS9 A;  3ASO C;  4BJ6 C;  1ZW3 A;  3JSE O;  4JKV A;  4AX2 A;  4B6I A;  5A6B D;  3JTL O;  1WOL A;  1CGN A;  2NPU A;  3UGO A;  2XM4 A;  2OEX A;  3DE9 A;  3LS1 A;  4NTA A;  2PFD A;  1Y6D A;  3UMI A;  1LVK A;  4DRJ B;  2G3V A;  1OQC A;  3LAY A;  1FMW A;  2UUH A;  3OA1 A;  2OQM A;  4CSA A;  4PJM A;  3RVY A;  1OCO C;  4A4A A;  3WHN A;  3TQO A;  1ORS C;  2NG1 A;  2J0X A;  3EQL F;  3JRM O;  2B0J A;  2P1A A;  2PBE A;  2Q4F A;  4GQH A;  2EPM X;  2GA0 A;  1T01 A;  3ABL C;  1OCZ C;  4KBL A;  1WAT A;  2HKV A;  4PJL A;  4OIO F;  2YRF A;  4J30 B;  3FDQ A;  4JTA B;  1SYQ A;  2J46 A;  2WB7 A;  3TJ6 A;  4OIR F;  3X2Q C;  3TUL A;  2XSE A;  5HSW A;  5JRA A;  1NLX A;  1Q0K A;  1DOV A;  3EG9 A;  4CS7 A;  2MYS A;  2YKZ A;  3B9Q A;  3JRT A;  4MVM A;  5E3A A;  4EBJ A;  1U0B B;  3EG9 B;  1QSP A;  2L6G A;  3NG1 A;  5DQT A;  4Z9I A;  4G7Z F;  4XPY A;  4ZLC A;  4E17 A;  4Q4Z F;  1MMG A;  2A0B A;  3IEE A;  1JPN A;  1Z3I X;  3AQC A;  4PJN A;  1FFT C;  2A6E F;  4OIN F;  2AWY A;  3GOR A;  2ZXO A;  2X51 A;  4CS8 A;  1YVI A;  4D4X A;  3J06 A;  2H7B A;  2KC3 A;  3FAP B;  3HNI A;  1SMY F;  2LD6 A;  3K6B A;  4MTO A;  4G78 A;  2CCY A;  3HNJ A;  1OW7 A;  2VH3 A;  5JLI A;  1HW2 A;  1VOM A;  1FTS A;  1NBB A;  4EBB A;  2VCB A;  3GEI A;  5COF A;  4E18 A;  1D1B A;  1AEP A;  1Z6A A;  2DB4 A;  5B1B C;  3RQG A;  4LER A;  1Z7Q c;  1PD1 A;  2QUP A;  4O6M A;  3QVY A;  2KYH A;  2O9X A;  5DLJ A;  1VYK A;  2W4M A;  3DM5 A;  5COG A;  1TQG A;  3L1M A;  4PAC A;  2BL2 A;  3EPV A;  2M64 A;  5CIV A;  1ZU4 A;  2CGE A;  2WZG A;  2QY9 A;  2EPO A;  3W2V A;  4C3E A;  3FAJ A;  4MVS A;  3VM6 A;  5L0I A;  3K33 A;  1Y4C A;  1ZU5 A;  2LK4 A;  3S28 A;  3S84 A;  3AG1 C;  3DM9 B;  4XEV A;  3Q7G A;  3U3F A;  1FAP B;  3QW1 A;  3CAX A;  2R7X A;  1VK5 A;  1KNY A;  1VLT A;  4HE8 D;  4JCZ A;  3ZWI A;  2J0W A;  1MMN A;  4O6N A;  3N0T A;  4FAP B;  1TWA A;  3MLG A;  3I5P A;  3EZI A;  3GWL A;  3ZIB A;  1HE1 A;  1H9G A;  1KTM A;  2M4E A;  2YLD A;  4YJW A;  3LLI A;  1OXK A;  4O79 A;  4CS9 C;  2RSE B;  1JRA A;  3U2M A;  1M2V A;  3LUT B;  2DYR C;  3R2P A;  4PK4 A;  3RKO F;  3HTK C;  4N6C A;  5F5H A;  3ZG1 A;  4YL0 A;  5L0G A;  4I1M A;  2HS5 A;  1JOG A;  1RKE A;  4U5H A;  2R7R A;  2OJQ A;  2XRH A;  4A2N B;  1M2V B;  1QZX A;  3ZQV A;  5L0F A;  1E84 A;  2Q9A A;  1E2X A;  1RKE B;  1A0B A;  3NRH A;  4ULW A;  1JMW A;  2DGJ A;  3FVY A;  3O6X A;  4JTC B;  2LIG A;  4W8P A;  5DS6 A;  3AG3 C;  2PP4 A;  5L0J A;  5KYU A;  4BJ1 A;  4XEF A;  1D1C A;  2PX0 A;  3KH2 A;  3LES A;  2PNO A;  2YHS A;  1LIH A;  2H7V C;  3NYM A;  5CI8 A;  1WAS A;  4XLN F;  1FNT c;  5KYU B;  3L0I A;  3B29 A;  4U5G A;  2WVQ A;  1U89 A;  4KI2 A;  2OEV A;  3CSK A;  1LI7 A;  3SEO A;  1BR4 A;  4JJG A;  2EIL C;  3U2L A;  2DI3 A;  2JPU A;  4YN0 B;  2L81 A;  2WL8 A;  3SXK A;  3ZC4 A;  1E85 A;  1CPQ A;  4KC9 A;  3MX3 A;  2Q9C A;  4ZLD A;  5EHH A;  3U9J A;  1JAF A;  1O87 A;  1SF8 A;  1TWH A;  5BQI A;  1N1C A;  1LM3 B;  4U9E A;  3ZQY A;  2V3C C;  2YL3 A;  3U8V A;  3AG4 C;  2CNW A;  1ORY A;  4C7O B;  4JRZ A;  2IXM A;  1BBH A;  1I4Z A;  2VC9 A;  4BJ5 C;  2KW3 C;  1XWJ A;  4RBN A;  4U5D E;  3IPM O;  2IYL D;  2AU5 A;  3M1C B;  1YA9 A;  3V5Y A;  1VTM P;  1CGM E;  3AGU A;  1GGQ A;  3POV A;  5A6A A;  2CDQ A;  4NTB A;  3L34 A;  2UUI A;  2YLI A;  4KNV A;  2NSG A;  1DOW A;  4K0D A;  1A7D A;  4PR9 A;  3VYW A;  1HMO A;  4YT8 A;  3AJM A;  3DMD A;  4XPX A;  3TK0 A;  4MVR A;  2IOQ A;  2GWW A;  3KL4 A;  2EIJ C;  5A6K A;  4HFK B;  5B3I A;  3IQ6 A;  3K1I A;  1C17 M;  1D0Z A;  4ONS A;  2Q00 A;  3C62 A;  3X1O A;  1I4Y A;  2XXA A;  4QI2 A;  1QQ3 A;  2IXN A;  2QTV A;  5DQZ A;  1V54 C;  4IAQ A;  3NMI A;  2F22 A;  4RDA A;  1EQ1 A;  3M79 A;  1SR2 A;  3VRC A;  2R05 A;  2XXA B;  2YL7 A;  3WAQ A;  3HNK A;  4DBR A;  1M2O A;  1H7I A;  3EJN A;  4P9T A;  4E0H A;  5K0I A;  3RQF A;  3SNH A;  4BJ6 A;  3PDM P;  3KYI A;  2I8B A;  4EKW A;  2KNH A;  1Z23 A;  2KK1 A;  1OR3 A;  2LSE A;  4AL1 A;  4EHP A;  2ZD9 A;  1MMD A;  1A41 A;  1V55 C;  1T6Q A;  3MYF A;  3ZTZ A;  1BDJ B;  1LS1 A;  3SP1 A;  1GQA A;  4U5E E;  5BQG A;  5EK0 A;  4I3M A;  1G4U S;  3C8G D;  2Y3B A;  1O3U A;  3F47 A;  4JJF A;  4N06 A;  3SXM A;  3UMH A;  2L7A A;  4N4W A;  1K05 A;  5D91 A;  3TOM A;  3EHM A;  5KYX A;  1YAU O;  4AE4 B;  3LJB A;  2ZXR A;  1OCR C;  1UFB A;  3DAG A;  1TWC A;  1M6T A;  3FHD A;  5B1A C;  1K40 A;  1LS4 A;  3EFO A;  4CX9 A;  1S7Z A;  5KYX B;  5JS5 A;  3RYL A;  2VAS A;  2G62 A;  1HY5 A;  2JD3 A;  2OCC C;  3A11 A;  3LEO A;  4MW3 A;  3S27 A;  256B A;  2Q3T A;  3EFO B;  5A6J A;  3DXJ F;  2BE5 F;  1APC A;  3H2U A;  2P6V A;  3DE8 A;  4JEA A;  3UMK A;  4ER9 A;  2L6F A;  2L9J A;  5F5F A;  2LP4 A;  1FMV A;  1LKX A;  2X0C A;  3AGT A;  1AVO B;  1OW6 A;  2Q9B A;  3DKA A;  3Q7L A;  1PCX A;  4WGZ A;  2A6H F;  5L3V A;  2Y3G A;  5CI9 A;  4M63 A;  4QI0 A;  3T4R A;  5DS4 A;  1V4A A;  4NY3 A;  4HFF B;  1LE2 A;  1TFK B;  2NSF A;  4MW8 A;  2QLA A;  3NDB B;  1MNE A;  2D5R B;  3RFY A;  1BR2 A;  4ULV A;  3O55 A;  1AUE A;  1ST6 A;  1Q0G A;  3IQT A;  2XLE A;  1NSG B;  3M4C A;  2I15 A;  4DRH B;  1S05 A;  1TKN A;  2W4B A;  3SXZ A;  4YWQ A;  1OKK A;  2GAQ A;  4MVU A;  1F1M A;  2XLM A;  3LNR A;  4E7S A;  2G3K A;  3I4U A;  3N24 A;  2C03 A;  3GEE A;  2W45 A;  3NMJ A;  4LDR A;  2QE9 A;  4EIY A;  1WTY A;  2RD9 A;  1Q0M A;  2CYD A;  3HLZ A;  3KMI A;  4MVZ A;  4YT5 A;  2HMQ A;  4IJJ A;  3B0V C;  2TMV P;  4OIP F;  5KYY A;  1G4W R;  4BJT A;  2P61 A;  5DVW A;  1NFO A;  3B0U X;  4U5F E;  4JVS A;  5A69 A;  2EIN C;  4JCH A;  1NU7 D;  2R7O A;  1G8X A;  4K7B A;  4LLC A;  4NTF A;  4R32 A;  5KYY B;  1VYI A;  1C02 A;  1LI5 A;  3BEH A;  1EI7 A;  1LPE A;  3EZH A;  1D0X A;  4XWJ A;  4J7Y A;  3U5S A;  2EPL X;  4H4K C;  1BR1 A;  2H8A A;  3O10 A;  4DBQ A;  5FCL A;  5IY5 C;  2LQG A;  4PFP A;  4XEK A;  2R7T A;  3RIP A;  1JPJ A;  3U3B A;  4DVY P;  2ZPA A;  3NKD A;  1ZHX A;  3AG2 C;  3KPH A;  2GFH A;  2JX0 A;  1XZQ A;  1Z63 A;  2J7P A;  1I5N A;  2HUJ A;  3NYL A;  4CS9 A;  1D1A A;  3K7D A;  5L0D A;  4JUR I;  3GWN A;  5L3Q A;  4C3D A;  1WN0 A;  4JIO A;  2E87 A;  2EPK X;  2WVO A;  4FX5 A;  4XPW A;  5TJ5 E;  3S9O A;  3W8I A;  4D4N A;  3JT1 A;  2YZS A;  4OD4 A;  4IRU A;  2J9W A;  2W9Y A;  2YLG A;  4MTG A;  4IAO A;  2EIM C;  3T6B A;  2P7V A;  3Q6N A;  2Y3H A;  3JZ0 A;  2Q7R A;  1CGO A;  2LFD A;  4WAB A;  3S0X A;  2HV7 A;  5JUA A;  4ANJ A;  5L0C A;  1MMA A;  3QMK A;  1JR8 A;  3NMK A;  4JE9 A;  4C7O A;  1YJG A;  2EIK C;  2J9V A;  3H2V A;  2HSB A;  2XLV A;  4IAR A;  4IGG A;  3HKK A;  3ECS A;  3KKB A;  3K66 A;  4MS2 A;  2HMZ A;  5FZT A;  3RH3 A;  3SYN A;  1OCC C;  4JTD B;  3C63 A;  2MWQ A;  3M4B A;  4U9D A;  4OIQ F;  4E7Z A;  3VF0 A;  1ZW2 A;  2YEV A;  2KGO A;  2OOC A;  3C8Z A;  3CZ6 A;  3LS0 A;  3RF3 A;  4DRI B;  4JZA A;  4J32 B;  2R7W A;  3G50 A;  3US6 A;  3JSZ A;  3V5X A;  4DXW A;  1NG1 A;  4BJ5 A;  1UG7 A;  4DVZ A;  3RVZ A;  3ZSU A;  1RJ9 A;  2CNW D;  5BUO A;  4LAC B;  3R7C A;  2R03 A;  1Z5Z A;  3DJU B;  2P0N A;  3UR3 C;  5A6B A;  2B0H A;  1RJ9 B;  3G4Z A;  3EH1 A;  3ZDL A;  4IWB A;  3EH2 A;  4CBE A;  1TFO B;  1HMD A;  4YT4 A;  1MQV A;  2HV6 A;  3T9O A;  4Z9J A;  2XLW A;  3L8I A;  4G0H A;  1HW1 A;  2FGY A;  2VB6 A;  3M15 A;  1GM5 A;  1U6H A;  1TWG A;  5JVE A;  2VCA A;  4NC3 A;  4PFO A;  2R7U A;  2EPN A;  4FES A;  5F28 E;  5GPG B;  2OU6 A;  4EWC A;  5KYW A;  2J45 A;  4BEJ A;  2KQ9 A;  2PX3 A;  3HJC A;  3WOD F;  5EGY A;  3UNG C;  5T3W A;  2HJ3 A;  3QZC A;  1B68 A;  3NYJ A;  5KYW B;  3E70 C;  1ZHT A;  1VMA A;  4EUK B;  1BZ4 A;  1T9K A;  4J7T A;  4AE4 A;  3ABK C;  3ZTM A;  2MHR A;  2YVK A;  4KNW A;  2DYS C;  3C8G A;  2CW0 F;  1PD0 A;  3GAN A;  3Q6M A;  1J8M F;  4NCQ A;  2J8W A;  3H65 A;  1V74 B;  3RQE A;  4CIP A;  2XLD A;  1Q0D A;  2XLO A;  1YZC A;  2J9B A;  3C8G B;  3PCV A;  3EGX A;  4O7G A;  3SXY A;  3DZA A;  3V5Z A;  1YZA A;  2PF4 E;  3SZR A;  2OG2 A;  1R4T A;  3LNM B;  3I5Q A;  3EGX B;  1H6G A;  3T6G B;  1NZE A;  4W8K A;  2R7V A;  4G7H F;  2IXO A;  2Z15 A;  1RKC A;  4QDL A;  4LDK A;  4CS8 C;  2Y69 C;  1M57 C;  1MND A;  2IXP A;  1G5Z A;  1L7C A;  2XL8 A;  2YQY A;  4MVQ A;  4U5C E;  4WGY A;  3PHF 2;  4PJJ A;  2KSF A;  1E86 A;  1QVX A;  2NUT A;  3QW0 A;  3BRJ A;  4XLP F;  2ZXP A;  1NFN A;  1LE4 A;  1EA8 A;  2L6H A;  2R25 A;  5DS5 A;  1RXQ A;  5E3C A;  5L0H A;  2NUT B;  5JT4 A;  2WZL A;  1YDI A;  2ETS A;  1PV3 A;  2H7O A; 
#chains in the Genus database with same CATH homology
 1LM3 B;  2YL1 A;  4U9E A;  4CDV A;  3ZQY A;  2YL3 A;  2XM0 A;  1BBH A;  4IB4 A;  2YL0 A;  2YLI A;  4D4N A;  4CJO A;  5JRA A;  1E83 A;  1QPU A;  2YLG A;  4L6R A;  5B3I A;  3IQ6 A;  4JEB A;  2YKZ A;  3C62 A;  1CGO A;  3U8P A;  5JUA A;  1QQ3 A;  4IAQ A;  3NMI A;  3NMK A;  4JE9 A;  3M79 A;  3VRC A;  2YL7 A;  2XLV A;  4IAR A;  3HNK A;  4D4X A;  2XLH A;  4N6H A;  4CDY A;  3HNI A;  3C63 A;  3M4B A;  4U9D A;  2CCY A;  3FOO A;  3HNJ A;  5JLI A;  1YYJ A;  1NBB A;  3ZTZ A;  1GQA A;  3QVY A;  5JP7 A;  4N4W A;  2XL6 A;  3TOM A;  1YYX A;  3L1M A;  2BC5 A;  3IQ5 A;  1M6T A;  4CX9 A;  5JS5 A;  5JSL A;  256B A;  1MQV A;  3QW1 A;  2XLW A;  1APC A;  4JEA A;  3DE8 A;  4ER9 A;  4CJG A;  3ZWI A;  3M15 A;  5JVE A;  4NC3 A;  4WGZ A;  3QVZ A;  2YLD A;  4CDA A;  3HNL A;  2QLA A;  1RCP A;  1CPR A;  4ULV A;  3ZTM A;  3ZQV A;  1E84 A;  2XLE A;  2J8W A;  3TOL A;  3M4C A;  1S05 A;  4CIP A;  2XLD A;  2XLO A;  1YZC A;  2J9B A;  2XLM A;  3NMJ A;  1YZA A;  1EKY A;  1A7V A;  4EIY A;  3FOP A;  5AGF A;  2XL8 A;  4WGY A;  1E86 A;  4JKV A;  1E85 A;  1CPQ A;  3QW0 A;  1CGN A;  2XM4 A;  3DE9 A;  1JAF A;  5JT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...