1E88A

Solution structure of 6f11f22f2, a compact three-module fragment of the gelatin-binding domain of human fibronectin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
160
structure length
160
Chain Sequence
YGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALCHFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRONECTIN
publication title The Hairpin Structure of the (6)F1(1)F2(2)F2 Fragment from Human Fibronectin Enhances Gelatin Binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 15
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2000-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00039 fn1 Fibronectin type I domain
A PF00040 fn2 Fibronectin type II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1e88A01
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1e88A02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1e88A03
2IZ3A 4WJG2 3ERBA 3GOVA 1OK9A 2CG6A 3TVJA 5HYUB 1QGBA 2RLPA 4AYEA 2IZ4A 4FXGG 3OEDC 2RLQA 4ONTD 4YNXA 1QUBA 2MCZA 2XQWC 1VVDA 1ZJKA 4B2RA 3O8EB 3OXUD 1OJVA 2BZMA 1H8PA 2JRAA 1HFIA 2XRBA 2ERJA 2YBYA 2JGWA 3IX0A 1H2QP 3KXVA 3CALA 4K12A 2W80A 5I0QB 2V5OA 4J38B 1CK7A 1HFHA 4KKDA 5FO8C 2CKUA 4B2SA 1G4GA 2YRAA 4CSYA 3SW0X 1LY2A 4LOSA 2G7IA 1OJYA 3IU3I 1Q3XA 1GKGA 1SS2A 4ZH1D 1GXDA 1NWVA 1SRZA 1HCCA 3NFPI 4AYDA 1C1ZA 2QY0A 4AYMA 5HZPB 4A5WB 2W81A 3ZD2A 2CG7A 1H04P 2JGXA 2WIIC 1G4FA 2FN2A 1MD8A 1UOTP 2O39C 2XWJI 3EJHA 3GXEA 3ZD1A 2EHFA 2UWNA 1OJWA 3INBC 1GHQB 1TPGA 3T5OA 3RJ3D 3ZRZA 2B5ID 1CKLA 2KMSA 1L6JA 3KZJA 4F4OC 2MCYA 2EC3A 1QO6A 4MUCA 1EAKA 1MD7A 1PDCA 3MQLA 2RKZA 1Z92B 5HYPA 1GKNA 1TPNA 1U5MA 2RKYA 5JPMG 1PPQA 1H03P 1KS0A 1TPMA 1H2PP 4JHSA 4DJZA 2A55A 2XWBF 1FBRA 4IGDA 1E88A 1OK1A 2KRIA 2RL0A 2LOJA 1E8BA 3M7PA 1J7MA 2V8EA 3L89M 1OK2A 1O9AA 1OK3A 3OP8A 1GPZA 4AYIA 4C16A 1CXWA 2XRDA 4LOTA 1VVCA 4PZ5A 5HYTB 3R62A 1E5GA 1ELVA
chains in the Genus database with same CATH superfamily
2Y2OA 4OJ5A 2IZ3A 4WJG2 3ERBA 1G4FA 3VWOA 4TX8A 2Y2GA 3WX7A 3GOVA 2Y8TA 1OK9A 3L27A 2CG6A 3TVJA 3ZLDA 3WD4A 1W1PA 5HYUB 1QGBA 2RLPA 4OUIA 2Y8RA 4AYEA 2IZ4A 3KS8A 3FKEA 1GOIA 2JCHA 4FXGG 3OEDC 2RLQA 4ONTD 4YNXA 1QUBA 4OJOA 2MCZA 2XQWC 2BG1A 4IBGA 3WD0A 1VVDA 1ZJKA 4B2RA 3O8EB 4GHLA 3OXUD 1OJVA 4IBEA 2Y2KA 1H8PA 4IJEA 1HFIA 4IBIA 2BZMA 2ERJA 2JRAA 2XRBA 2YBYA 4NY2A 2JGWA 4GHAA 1YUEA 1H2QP 3IX0A 3KXVA 3CALA 4K12A 2W80A 4MSLA 2V5OA 5DN4A 5I0QB 4HMDA 4J38B 1CK7A 1HFHA 4MB3A 4KKDA 2CKUA 5FO8C 4B2SA 1YU4A 3KS4A 1G4GA 2YRAA 1YU0A 4CSYA 3SW0X 1OGBA 1W1TA 4BWCA 1LY2A 4LOSA 2G7IA 1OJYA 3IU3I 2Y2NA 2RTSA 1YU2A 4IBJA 4Z2GA 1Q3XA 2XD1A 2I2LA 4OJPA 1GKGA 1SS2A 3L25A 3L28A 4ZH1D 1GXDA 1NWVA 1SRZA 1HCCA 1W1VA 3NFPI 4AYDA 4OJ6A 1RLHA 3L29A 2Y2PA 1C1ZA 1E6ZA 3HONA 2QY0A 3FGRA 4AYMA 4IBDA 5HZPB 3NJAA 1H0IA 4A5WB 1GPFA 2W81A 3HSHA 2FFFB 3N3FA 3ZD2A 2CG7A 4Z2LA 1H04P 2JGXA 4LG2A 4QNLA 2WIIC 2FN2A 1MD8A 1UOTP 2O39C 2XWJI 2Y2MA 3EJHA 3GXEA 3ZD1A 4HMEA 2EHFA 2UWNA 1OJWA 1ED7A 1H0GA 1GHQB 1TPGA 4IBKA 3INBC 5DN5A 3RJ3D 3T5OA 2B5ID 3ZLEA 2XD5A 3ZRZA 1OGGA 5BPVA 2IOUA 4NZ4A 1CKLA 4NZ5A 4OJLA 2KMSA 2Y2LA 4N7EA 3WD1A 2ZYCA 1L6JA 3KZJA 4F4OC 3CI0J 4YIZA 2MCYA 2EC3A 1QO6A 4MUCA 3WSXA 3F6KA 1EAKA 4IBCA 3WSYA 1MD7A 2D49A 1PDCA 4NZ3A 3MQLA 1E6RA 3L26A 3K3TA 4HMCA 4Z2IA 2RKZA 1Z92B 5HYPA 2X2ZA 2UWXA 1GKNA 1TPNA 1U5MA 2RKYA 4Z2JA 2Y2IA 1YU3A 5JPMG 2Y2JA 3L2AA 1PPQA 1H03P 1KS0A 4MB5A 1TPMA 1H2PP 1E15A 4JHSA 4DJZA 2JE5A 2A55A 2XWBF 4NZ1A 1FBRA 2Y8SA 3WD3A 4IBBA 4MB4A 1YU1A 1W1YA 2Y2HA 4IGDA 1E88A 1OK1A 2KRIA 1UR9A 2RL0A 2LOJA 1ELVA 1E8BA 3M7PA 1J7MA 4IBFA 2V8EA 3L89M 1OK2A 1O6IA 1O9AA 1E6NA 1OK3A 3FGTA 1GPZA 3OP8A 4APLA 1E6PA 4AYIA 3WD2A 1CXWA 2XRDA 4C16A 4GH9A 4NYYA 1VVCA 4LOTA 1AIWA 4PO7A 4Z2KA 4NYUA 4PZ5A 5HYTB 2Y2QA 3R62A 1E5GA 4Z2HA 4IJFA 1UR8A
chains in the Genus database with same CATH topology
2IZ3A 4WJG2 3ERBA 3GOVA 1OK9A 2CG6A 3TVJA 5HYUB 1QGBA 2RLPA 4AYEA 2IZ4A 4FXGG 3OEDC 2RLQA 4ONTD 4YNXA 1QUBA 2MCZA 2XQWC 1VVDA 1ZJKA 4B2RA 3O8EB 3OXUD 1OJVA 2BZMA 1H8PA 2JRAA 1HFIA 2XRBA 2ERJA 2YBYA 2JGWA 3IX0A 1H2QP 3KXVA 3CALA 4K12A 2W80A 5I0QB 2V5OA 4J38B 1CK7A 1HFHA 4KKDA 5FO8C 2CKUA 4B2SA 1G4GA 2YRAA 4CSYA 3SW0X 1LY2A 4LOSA 2G7IA 1OJYA 3IU3I 1Q3XA 1GKGA 1SS2A 4ZH1D 1GXDA 1NWVA 1SRZA 1HCCA 3NFPI 4AYDA 1C1ZA 2QY0A 4AYMA 5HZPB 4A5WB 2W81A 3ZD2A 2CG7A 1H04P 2JGXA 2WIIC 1G4FA 2FN2A 1MD8A 1UOTP 2O39C 2XWJI 3EJHA 3GXEA 3ZD1A 2EHFA 2UWNA 1OJWA 3INBC 1GHQB 1TPGA 3T5OA 3RJ3D 3ZRZA 2B5ID 1CKLA 2KMSA 1L6JA 3KZJA 4F4OC 2MCYA 2EC3A 1QO6A 4MUCA 1EAKA 1MD7A 1PDCA 3MQLA 2RKZA 1Z92B 5HYPA 1GKNA 1TPNA 1U5MA 2RKYA 5JPMG 1PPQA 1H03P 1KS0A 1TPMA 1H2PP 4JHSA 4DJZA 2A55A 2XWBF 1FBRA 4IGDA 1E88A 1OK1A 2KRIA 2RL0A 2LOJA 1E8BA 3M7PA 1J7MA 2V8EA 3L89M 1OK2A 1O9AA 1OK3A 3OP8A 1GPZA 4AYIA 4C16A 1CXWA 2XRDA 4LOTA 1VVCA 4PZ5A 5HYTB 3R62A 1E5GA 1ELVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IZ3 A;  4WJG 2;  3ERB A;  3GOV A;  1OK9 A;  2CG6 A;  3TVJ A;  5HYU B;  1QGB A;  2RLP A;  4AYE A;  2IZ4 A;  4FXG G;  3OED C;  2RLQ A;  4ONT D;  4YNX A;  1QUB A;  2MCZ A;  2XQW C;  1VVD A;  1ZJK A;  4B2R A;  3O8E B;  3OXU D;  1OJV A;  2BZM A;  1H8P A;  2JRA A;  1HFI A;  2XRB A;  2ERJ A;  2YBY A;  2JGW A;  3IX0 A;  1H2Q P;  3KXV A;  3CAL A;  4K12 A;  2W80 A;  5I0Q B;  2V5O A;  4J38 B;  1CK7 A;  1HFH A;  4KKD A;  5FO8 C;  2CKU A;  4B2S A;  1G4G A;  2YRA A;  4CSY A;  3SW0 X;  1LY2 A;  4LOS A;  2G7I A;  1OJY A;  3IU3 I;  1Q3X A;  1GKG A;  1SS2 A;  4ZH1 D;  1GXD A;  1NWV A;  1SRZ A;  1HCC A;  3NFP I;  4AYD A;  1C1Z A;  2QY0 A;  4AYM A;  5HZP B;  4A5W B;  2W81 A;  3ZD2 A;  2CG7 A;  1H04 P;  2JGX A;  2WII C;  1G4F A;  2FN2 A;  1MD8 A;  1UOT P;  2O39 C;  2XWJ I;  3EJH A;  3GXE A;  3ZD1 A;  2EHF A;  2UWN A;  1OJW A;  3INB C;  1GHQ B;  1TPG A;  3T5O A;  3RJ3 D;  3ZRZ A;  2B5I D;  1CKL A;  2KMS A;  1L6J A;  3KZJ A;  4F4O C;  2MCY A;  2EC3 A;  1QO6 A;  4MUC A;  1EAK A;  1MD7 A;  1PDC A;  3MQL A;  2RKZ A;  1Z92 B;  5HYP A;  1GKN A;  1TPN A;  1U5M A;  2RKY A;  5JPM G;  1PPQ A;  1H03 P;  1KS0 A;  1TPM A;  1H2P P;  4JHS A;  4DJZ A;  2A55 A;  2XWB F;  1FBR A;  4IGD A;  1E88 A;  1OK1 A;  2KRI A;  2RL0 A;  2LOJ A;  1E8B A;  3M7P A;  1J7M A;  2V8E A;  3L89 M;  1OK2 A;  1O9A A;  1OK3 A;  3OP8 A;  1GPZ A;  4AYI A;  4C16 A;  1CXW A;  2XRD A;  4LOT A;  1VVC A;  4PZ5 A;  5HYT B;  3R62 A;  1E5G A;  1ELV A; 
#chains in the Genus database with same CATH topology
 2Y2O A;  4OJ5 A;  2IZ3 A;  4WJG 2;  3ERB A;  1G4F A;  3VWO A;  4TX8 A;  2Y2G A;  3WX7 A;  3GOV A;  2Y8T A;  1OK9 A;  3L27 A;  2CG6 A;  3TVJ A;  3ZLD A;  3WD4 A;  1W1P A;  5HYU B;  1QGB A;  2RLP A;  4OUI A;  2Y8R A;  4AYE A;  2IZ4 A;  3KS8 A;  3FKE A;  1GOI A;  2JCH A;  4FXG G;  3OED C;  2RLQ A;  4ONT D;  4YNX A;  1QUB A;  4OJO A;  2MCZ A;  2XQW C;  2BG1 A;  4IBG A;  3WD0 A;  1VVD A;  1ZJK A;  4B2R A;  3O8E B;  4GHL A;  3OXU D;  1OJV A;  4IBE A;  2Y2K A;  1H8P A;  4IJE A;  1HFI A;  4IBI A;  2BZM A;  2ERJ A;  2JRA A;  2XRB A;  2YBY A;  4NY2 A;  2JGW A;  4GHA A;  1YUE A;  1H2Q P;  3IX0 A;  3KXV A;  3CAL A;  4K12 A;  2W80 A;  4MSL A;  2V5O A;  5DN4 A;  5I0Q B;  4HMD A;  4J38 B;  1CK7 A;  1HFH A;  4MB3 A;  4KKD A;  2CKU A;  5FO8 C;  4B2S A;  1YU4 A;  3KS4 A;  1G4G A;  2YRA A;  1YU0 A;  4CSY A;  3SW0 X;  1OGB A;  1W1T A;  4BWC A;  1LY2 A;  4LOS A;  2G7I A;  1OJY A;  3IU3 I;  2Y2N A;  2RTS A;  1YU2 A;  4IBJ A;  4Z2G A;  1Q3X A;  2XD1 A;  2I2L A;  4OJP A;  1GKG A;  1SS2 A;  3L25 A;  3L28 A;  4ZH1 D;  1GXD A;  1NWV A;  1SRZ A;  1HCC A;  1W1V A;  3NFP I;  4AYD A;  4OJ6 A;  1RLH A;  3L29 A;  2Y2P A;  1C1Z A;  1E6Z A;  3HON A;  2QY0 A;  3FGR A;  4AYM A;  4IBD A;  5HZP B;  3NJA A;  1H0I A;  4A5W B;  1GPF A;  2W81 A;  3HSH A;  2FFF B;  3N3F A;  3ZD2 A;  2CG7 A;  4Z2L A;  1H04 P;  2JGX A;  4LG2 A;  4QNL A;  2WII C;  2FN2 A;  1MD8 A;  1UOT P;  2O39 C;  2XWJ I;  2Y2M A;  3EJH A;  3GXE A;  3ZD1 A;  4HME A;  2EHF A;  2UWN A;  1OJW A;  1ED7 A;  1H0G A;  1GHQ B;  1TPG A;  4IBK A;  3INB C;  5DN5 A;  3RJ3 D;  3T5O A;  2B5I D;  3ZLE A;  2XD5 A;  3ZRZ A;  1OGG A;  5BPV A;  2IOU A;  4NZ4 A;  1CKL A;  4NZ5 A;  4OJL A;  2KMS A;  2Y2L A;  4N7E A;  3WD1 A;  2ZYC A;  1L6J A;  3KZJ A;  4F4O C;  3CI0 J;  4YIZ A;  2MCY A;  2EC3 A;  1QO6 A;  4MUC A;  3WSX A;  3F6K A;  1EAK A;  4IBC A;  3WSY A;  1MD7 A;  2D49 A;  1PDC A;  4NZ3 A;  3MQL A;  1E6R A;  3L26 A;  3K3T A;  4HMC A;  4Z2I A;  2RKZ A;  1Z92 B;  5HYP A;  2X2Z A;  2UWX A;  1GKN A;  1TPN A;  1U5M A;  2RKY A;  4Z2J A;  2Y2I A;  1YU3 A;  5JPM G;  2Y2J A;  3L2A A;  1PPQ A;  1H03 P;  1KS0 A;  4MB5 A;  1TPM A;  1H2P P;  1E15 A;  4JHS A;  4DJZ A;  2JE5 A;  2A55 A;  2XWB F;  4NZ1 A;  1FBR A;  2Y8S A;  3WD3 A;  4IBB A;  4MB4 A;  1YU1 A;  1W1Y A;  2Y2H A;  4IGD A;  1E88 A;  1OK1 A;  2KRI A;  1UR9 A;  2RL0 A;  2LOJ A;  1ELV A;  1E8B A;  3M7P A;  1J7M A;  4IBF A;  2V8E A;  3L89 M;  1OK2 A;  1O6I A;  1O9A A;  1E6N A;  1OK3 A;  3FGT A;  1GPZ A;  3OP8 A;  4APL A;  1E6P A;  4AYI A;  3WD2 A;  1CXW A;  2XRD A;  4C16 A;  4GH9 A;  4NYY A;  1VVC A;  4LOT A;  1AIW A;  4PO7 A;  4Z2K A;  4NYU A;  4PZ5 A;  5HYT B;  2Y2Q A;  3R62 A;  1E5G A;  4Z2H A;  4IJF A;  1UR8 A; 
#chains in the Genus database with same CATH homology
 2IZ3 A;  4WJG 2;  3ERB A;  3GOV A;  1OK9 A;  2CG6 A;  3TVJ A;  5HYU B;  1QGB A;  2RLP A;  4AYE A;  2IZ4 A;  4FXG G;  3OED C;  2RLQ A;  4ONT D;  4YNX A;  1QUB A;  2MCZ A;  2XQW C;  1VVD A;  1ZJK A;  4B2R A;  3O8E B;  3OXU D;  1OJV A;  2BZM A;  1H8P A;  2JRA A;  1HFI A;  2XRB A;  2ERJ A;  2YBY A;  2JGW A;  3IX0 A;  1H2Q P;  3KXV A;  3CAL A;  4K12 A;  2W80 A;  5I0Q B;  2V5O A;  4J38 B;  1CK7 A;  1HFH A;  4KKD A;  5FO8 C;  2CKU A;  4B2S A;  1G4G A;  2YRA A;  4CSY A;  3SW0 X;  1LY2 A;  4LOS A;  2G7I A;  1OJY A;  3IU3 I;  1Q3X A;  1GKG A;  1SS2 A;  4ZH1 D;  1GXD A;  1NWV A;  1SRZ A;  1HCC A;  3NFP I;  4AYD A;  1C1Z A;  2QY0 A;  4AYM A;  5HZP B;  4A5W B;  2W81 A;  3ZD2 A;  2CG7 A;  1H04 P;  2JGX A;  2WII C;  1G4F A;  2FN2 A;  1MD8 A;  1UOT P;  2O39 C;  2XWJ I;  3EJH A;  3GXE A;  3ZD1 A;  2EHF A;  2UWN A;  1OJW A;  3INB C;  1GHQ B;  1TPG A;  3T5O A;  3RJ3 D;  3ZRZ A;  2B5I D;  1CKL A;  2KMS A;  1L6J A;  3KZJ A;  4F4O C;  2MCY A;  2EC3 A;  1QO6 A;  4MUC A;  1EAK A;  1MD7 A;  1PDC A;  3MQL A;  2RKZ A;  1Z92 B;  5HYP A;  1GKN A;  1TPN A;  1U5M A;  2RKY A;  5JPM G;  1PPQ A;  1H03 P;  1KS0 A;  1TPM A;  1H2P P;  4JHS A;  4DJZ A;  2A55 A;  2XWB F;  1FBR A;  4IGD A;  1E88 A;  1OK1 A;  2KRI A;  2RL0 A;  2LOJ A;  1E8B A;  3M7P A;  1J7M A;  2V8E A;  3L89 M;  1OK2 A;  1O9A A;  1OK3 A;  3OP8 A;  1GPZ A;  4AYI A;  4C16 A;  1CXW A;  2XRD A;  4LOT A;  1VVC A;  4PZ5 A;  5HYT B;  3R62 A;  1E5G A;  1ELV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...