1E88A

Solution structure of 6f11f22f2, a compact three-module fragment of the gelatin-binding domain of human fibronectin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
160
structure length
160
Chain Sequence
b'YGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALCHFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRONECTIN
publication title The Hairpin Structure of the (6)F1(1)F2(2)F2 Fragment from Human Fibronectin Enhances Gelatin Binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 15
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2000-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00039 fn1 Fibronectin type I domain
A PF00040 fn2 Fibronectin type II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1e88A01
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1e88A02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1e88A03
5HZPB 2JRAA 1G4FA 5HYUB 2XQWC 1H8PA 1L6JA 1SRZA 3IX0A 3IU3I 2V5OA 2G7IA 5I0QB 2MCZA 5FO8C 3ZRZA 1E88A 2KRIA 1MD7A 2A55A 3KZJA 2MCYA 1SS2A 1FBRA 4ZH1D 1CK7A 3ERBA 3GXEA 2UWNA 4F4OC 2KMSA 1VVDA 1OJVA 5HYTB 1H2QP 4PZ5A 2WIIC 1OJWA 2CG7A 2RLPA 1J7MA 2RL0A 3KXVA 3R62A 2RLQA 3MQLA 2XRBA 4JHSA 4CSYA 1GPZA 1GXDA 1ELVA 4K12A 2ERJA 2RKYA 3CALA 1VVCA 1G4GA 4AYEA 3RJ3D 1E8BA 5JPMG 4IGDA 1HCCA 1GHQB 1Q3XA 4AYMA 4A5WB 3M7PA 1OK2A 2IZ4A 2CKUA 4AYIA 2B5ID 2YBYA 4B2SA 2XWBF 1NWVA 4FXGG 1QO6A 4DJZA 2W81A 1HFHA 1PDCA 3INBC 1TPGA 1OK9A 2QY0A 1EAKA 1OK3A 1PPQA 1OK1A 4J38B 2FN2A 2XRDA 2JGWA 1E5GA 5HYPA 1KS0A 1GKGA 2O39C 2W80A 1CXWA 4ONTD 3EJHA 3SW0X 1GKNA 2RKZA 3OXUD 2CG6A 4MUCA 3ZD2A 1QGBA 2EHFA 2BZMA 4KKDA 1O9AA 2IZ3A 4AYDA 2LOJA 1LY2A 1U5MA 3O8EB 1H2PP 2EC3A 3GOVA 1H03P 1MD8A 1CKLA 4LOTA 1HFIA 4YNXA 1H04P 3NFPI 2XWJI 4C16A 1QUBA 3T5OA 3TVJA 4WJG2 1ZJKA 3L89M 3ZD1A 1TPMA 4B2RA 2JGXA 3OP8A 1TPNA 4LOSA 1Z92B 1C1ZA 1OJYA 1UOTP 2V8EA 2YRAA 3OEDC
chains in the Genus database with same CATH superfamily
5HZPB 2JRAA 1E6RA 5HYUB 3WD2A 2XQWC 2IOUA 3ZLEA 1G4FA 4APLA 1H8PA 1E6PA 1L6JA 1SRZA 3IX0A 2Y8TA 3IU3I 2V5OA 4GH9A 1RLHA 2XD1A 2G7IA 5I0QB 1E15A 2MCZA 5FO8C 3ZRZA 1OGGA 1E88A 4NZ3A 2KRIA 4OJ5A 1MD7A 2A55A 3KZJA 4Z2GA 2MCYA 2D49A 1SS2A 1FBRA 3L25A 3F6KA 1W1VA 4ZH1D 3FGRA 1CK7A 3ERBA 3GXEA 4MSLA 2UWNA 4F4OC 2KMSA 4HMDA 1OJVA 1VVDA 5HYTB 1H2QP 4PZ5A 4Z2IA 2WIIC 1OJWA 4OUIA 3N3FA 4IBBA 2UWXA 4IBEA 2CG7A 4BWCA 4GHAA 2RLPA 3HSHA 1J7MA 4IBCA 2Y2KA 2RL0A 3KXVA 1UR9A 4IBKA 3WSXA 3R62A 2RLQA 4MB5A 1YU4A 3MQLA 2XRBA 4JHSA 4CSYA 2ZYCA 1GPZA 1GXDA 1ELVA 4K12A 2ERJA 3K3TA 3WD3A 2RKYA 3CALA 4OJ6A 4Z2KA 1H0IA 1VVCA 1G4GA 4AYEA 3RJ3D 4N7EA 1E8BA 5JPMG 4IGDA 1HCCA 4HMEA 1GHQB 1Q3XA 1YU3A 4IBDA 3CI0J 4AYMA 3L29A 4A5WB 2Y8SA 3M7PA 1OK2A 2IZ4A 2CKUA 2FFFB 4AYIA 2B5ID 1O6IA 2JE5A 1YU1A 2Y2MA 2Y2JA 3WX7A 2YBYA 3NJAA 4B2SA 2XWBF 2Y2PA 1NWVA 1YUEA 4NYUA 4NY2A 1QO6A 4NZ4A 3KS4A 4FXGG 4DJZA 2W81A 1HFHA 4HMCA 1W1YA 2Y2GA 1PDCA 3WSYA 3INBC 1TPGA 1OK9A 2QY0A 1EAKA 5DN4A 1OGBA 1OK3A 1PPQA 1OK1A 4J38B 1AIWA 4Z2JA 2FN2A 3L26A 1YU0A 1YU2A 1UR8A 4IJEA 4TX8A 1W1PA 2XRDA 2JGWA 4PO7A 1E5GA 5DN5A 5HYPA 1KS0A 1GKGA 2O39C 2W80A 1ED7A 1CXWA 3FKEA 4ONTD 4YIZA 1W1TA 3EJHA 2Y2NA 4IBIA 4IBJA 4NZ5A 2RKZA 3SW0X 3OXUD 4IBFA 3FGTA 1GKNA 3VWOA 3WD1A 2CG6A 4MUCA 4Z2HA 1GOIA 3ZD2A 2Y2IA 1QGBA 2EHFA 2BZMA 4KKDA 1O9AA 4OJLA 3WD4A 2IZ3A 4AYDA 4Z2LA 2LOJA 4NZ1A 1LY2A 4OJPA 1U5MA 3O8EB 1H2PP 3L2AA 2Y8RA 2EC3A 3GOVA 4MB4A 4GHLA 1H03P 2BG1A 3KS8A 2Y2LA 1MD8A 1CKLA 3ZLDA 4LOTA 3L28A 1HFIA 4YNXA 3L27A 1H04P 3HONA 2XD5A 2X2ZA 3NFPI 1GPFA 2XWJI 5BPVA 4MB3A 1QUBA 4C16A 2Y2QA 3T5OA 3TVJA 4WJG2 1ZJKA 3L89M 3ZD1A 2Y2HA 1E6ZA 1H0GA 4IJFA 1TPMA 2I2LA 4B2RA 2JGXA 3OP8A 4OJOA 1TPNA 4QNLA 1Z92B 2JCHA 4LOSA 1E6NA 1C1ZA 1OJYA 2RTSA 4IBGA 1UOTP 2V8EA 4LG2A 2YRAA 3OEDC 3WD0A 4NYYA 2Y2OA
chains in the Genus database with same CATH topology
5HZPB 2JRAA 1G4FA 5HYUB 2XQWC 1H8PA 1L6JA 1SRZA 3IX0A 3IU3I 2V5OA 2G7IA 5I0QB 2MCZA 5FO8C 3ZRZA 1E88A 2KRIA 1MD7A 2A55A 3KZJA 2MCYA 1SS2A 1FBRA 4ZH1D 1CK7A 3ERBA 3GXEA 2UWNA 4F4OC 2KMSA 1VVDA 1OJVA 5HYTB 1H2QP 4PZ5A 2WIIC 1OJWA 2CG7A 2RLPA 1J7MA 2RL0A 3KXVA 3R62A 2RLQA 3MQLA 2XRBA 4JHSA 4CSYA 1GPZA 1GXDA 1ELVA 4K12A 2ERJA 2RKYA 3CALA 1VVCA 1G4GA 4AYEA 3RJ3D 1E8BA 5JPMG 4IGDA 1HCCA 1GHQB 1Q3XA 4AYMA 4A5WB 3M7PA 1OK2A 2IZ4A 2CKUA 4AYIA 2B5ID 2YBYA 4B2SA 2XWBF 1NWVA 4FXGG 1QO6A 4DJZA 2W81A 1HFHA 1PDCA 3INBC 1TPGA 1OK9A 2QY0A 1EAKA 1OK3A 1PPQA 1OK1A 4J38B 2FN2A 2XRDA 2JGWA 1E5GA 5HYPA 1KS0A 1GKGA 2O39C 2W80A 1CXWA 4ONTD 3EJHA 3SW0X 1GKNA 2RKZA 3OXUD 2CG6A 4MUCA 3ZD2A 1QGBA 2EHFA 2BZMA 4KKDA 1O9AA 2IZ3A 4AYDA 2LOJA 1LY2A 1U5MA 3O8EB 1H2PP 2EC3A 3GOVA 1H03P 1MD8A 1CKLA 4LOTA 1HFIA 4YNXA 1H04P 3NFPI 2XWJI 4C16A 1QUBA 3T5OA 3TVJA 4WJG2 1ZJKA 3L89M 3ZD1A 1TPMA 4B2RA 2JGXA 3OP8A 1TPNA 4LOSA 1Z92B 1C1ZA 1OJYA 1UOTP 2V8EA 2YRAA 3OEDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HZP B;  2JRA A;  1G4F A;  5HYU B;  2XQW C;  1H8P A;  1L6J A;  1SRZ A;  3IX0 A;  3IU3 I;  2V5O A;  2G7I A;  5I0Q B;  2MCZ A;  5FO8 C;  3ZRZ A;  1E88 A;  2KRI A;  1MD7 A;  2A55 A;  3KZJ A;  2MCY A;  1SS2 A;  1FBR A;  4ZH1 D;  1CK7 A;  3ERB A;  3GXE A;  2UWN A;  4F4O C;  2KMS A;  1VVD A;  1OJV A;  5HYT B;  1H2Q P;  4PZ5 A;  2WII C;  1OJW A;  2CG7 A;  2RLP A;  1J7M A;  2RL0 A;  3KXV A;  3R62 A;  2RLQ A;  3MQL A;  2XRB A;  4JHS A;  4CSY A;  1GPZ A;  1GXD A;  1ELV A;  4K12 A;  2ERJ A;  2RKY A;  3CAL A;  1VVC A;  1G4G A;  4AYE A;  3RJ3 D;  1E8B A;  5JPM G;  4IGD A;  1HCC A;  1GHQ B;  1Q3X A;  4AYM A;  4A5W B;  3M7P A;  1OK2 A;  2IZ4 A;  2CKU A;  4AYI A;  2B5I D;  2YBY A;  4B2S A;  2XWB F;  1NWV A;  4FXG G;  1QO6 A;  4DJZ A;  2W81 A;  1HFH A;  1PDC A;  3INB C;  1TPG A;  1OK9 A;  2QY0 A;  1EAK A;  1OK3 A;  1PPQ A;  1OK1 A;  4J38 B;  2FN2 A;  2XRD A;  2JGW A;  1E5G A;  5HYP A;  1KS0 A;  1GKG A;  2O39 C;  2W80 A;  1CXW A;  4ONT D;  3EJH A;  3SW0 X;  1GKN A;  2RKZ A;  3OXU D;  2CG6 A;  4MUC A;  3ZD2 A;  1QGB A;  2EHF A;  2BZM A;  4KKD A;  1O9A A;  2IZ3 A;  4AYD A;  2LOJ A;  1LY2 A;  1U5M A;  3O8E B;  1H2P P;  2EC3 A;  3GOV A;  1H03 P;  1MD8 A;  1CKL A;  4LOT A;  1HFI A;  4YNX A;  1H04 P;  3NFP I;  2XWJ I;  4C16 A;  1QUB A;  3T5O A;  3TVJ A;  4WJG 2;  1ZJK A;  3L89 M;  3ZD1 A;  1TPM A;  4B2R A;  2JGX A;  3OP8 A;  1TPN A;  4LOS A;  1Z92 B;  1C1Z A;  1OJY A;  1UOT P;  2V8E A;  2YRA A;  3OED C; 
#chains in the Genus database with same CATH topology
 5HZP B;  2JRA A;  1E6R A;  5HYU B;  3WD2 A;  2XQW C;  2IOU A;  3ZLE A;  1G4F A;  4APL A;  1H8P A;  1E6P A;  1L6J A;  1SRZ A;  3IX0 A;  2Y8T A;  3IU3 I;  2V5O A;  4GH9 A;  1RLH A;  2XD1 A;  2G7I A;  5I0Q B;  1E15 A;  2MCZ A;  5FO8 C;  3ZRZ A;  1OGG A;  1E88 A;  4NZ3 A;  2KRI A;  4OJ5 A;  1MD7 A;  2A55 A;  3KZJ A;  4Z2G A;  2MCY A;  2D49 A;  1SS2 A;  1FBR A;  3L25 A;  3F6K A;  1W1V A;  4ZH1 D;  3FGR A;  1CK7 A;  3ERB A;  3GXE A;  4MSL A;  2UWN A;  4F4O C;  2KMS A;  4HMD A;  1OJV A;  1VVD A;  5HYT B;  1H2Q P;  4PZ5 A;  4Z2I A;  2WII C;  1OJW A;  4OUI A;  3N3F A;  4IBB A;  2UWX A;  4IBE A;  2CG7 A;  4BWC A;  4GHA A;  2RLP A;  3HSH A;  1J7M A;  4IBC A;  2Y2K A;  2RL0 A;  3KXV A;  1UR9 A;  4IBK A;  3WSX A;  3R62 A;  2RLQ A;  4MB5 A;  1YU4 A;  3MQL A;  2XRB A;  4JHS A;  4CSY A;  2ZYC A;  1GPZ A;  1GXD A;  1ELV A;  4K12 A;  2ERJ A;  3K3T A;  3WD3 A;  2RKY A;  3CAL A;  4OJ6 A;  4Z2K A;  1H0I A;  1VVC A;  1G4G A;  4AYE A;  3RJ3 D;  4N7E A;  1E8B A;  5JPM G;  4IGD A;  1HCC A;  4HME A;  1GHQ B;  1Q3X A;  1YU3 A;  4IBD A;  3CI0 J;  4AYM A;  3L29 A;  4A5W B;  2Y8S A;  3M7P A;  1OK2 A;  2IZ4 A;  2CKU A;  2FFF B;  4AYI A;  2B5I D;  1O6I A;  2JE5 A;  1YU1 A;  2Y2M A;  2Y2J A;  3WX7 A;  2YBY A;  3NJA A;  4B2S A;  2XWB F;  2Y2P A;  1NWV A;  1YUE A;  4NYU A;  4NY2 A;  1QO6 A;  4NZ4 A;  3KS4 A;  4FXG G;  4DJZ A;  2W81 A;  1HFH A;  4HMC A;  1W1Y A;  2Y2G A;  1PDC A;  3WSY A;  3INB C;  1TPG A;  1OK9 A;  2QY0 A;  1EAK A;  5DN4 A;  1OGB A;  1OK3 A;  1PPQ A;  1OK1 A;  4J38 B;  1AIW A;  4Z2J A;  2FN2 A;  3L26 A;  1YU0 A;  1YU2 A;  1UR8 A;  4IJE A;  4TX8 A;  1W1P A;  2XRD A;  2JGW A;  4PO7 A;  1E5G A;  5DN5 A;  5HYP A;  1KS0 A;  1GKG A;  2O39 C;  2W80 A;  1ED7 A;  1CXW A;  3FKE A;  4ONT D;  4YIZ A;  1W1T A;  3EJH A;  2Y2N A;  4IBI A;  4IBJ A;  4NZ5 A;  2RKZ A;  3SW0 X;  3OXU D;  4IBF A;  3FGT A;  1GKN A;  3VWO A;  3WD1 A;  2CG6 A;  4MUC A;  4Z2H A;  1GOI A;  3ZD2 A;  2Y2I A;  1QGB A;  2EHF A;  2BZM A;  4KKD A;  1O9A A;  4OJL A;  3WD4 A;  2IZ3 A;  4AYD A;  4Z2L A;  2LOJ A;  4NZ1 A;  1LY2 A;  4OJP A;  1U5M A;  3O8E B;  1H2P P;  3L2A A;  2Y8R A;  2EC3 A;  3GOV A;  4MB4 A;  4GHL A;  1H03 P;  2BG1 A;  3KS8 A;  2Y2L A;  1MD8 A;  1CKL A;  3ZLD A;  4LOT A;  3L28 A;  1HFI A;  4YNX A;  3L27 A;  1H04 P;  3HON A;  2XD5 A;  2X2Z A;  3NFP I;  1GPF A;  2XWJ I;  5BPV A;  4MB3 A;  1QUB A;  4C16 A;  2Y2Q A;  3T5O A;  3TVJ A;  4WJG 2;  1ZJK A;  3L89 M;  3ZD1 A;  2Y2H A;  1E6Z A;  1H0G A;  4IJF A;  1TPM A;  2I2L A;  4B2R A;  2JGX A;  3OP8 A;  4OJO A;  1TPN A;  4QNL A;  1Z92 B;  2JCH A;  4LOS A;  1E6N A;  1C1Z A;  1OJY A;  2RTS A;  4IBG A;  1UOT P;  2V8E A;  4LG2 A;  2YRA A;  3OED C;  3WD0 A;  4NYY A;  2Y2O A; 
#chains in the Genus database with same CATH homology
 5HZP B;  2JRA A;  1G4F A;  5HYU B;  2XQW C;  1H8P A;  1L6J A;  1SRZ A;  3IX0 A;  3IU3 I;  2V5O A;  2G7I A;  5I0Q B;  2MCZ A;  5FO8 C;  3ZRZ A;  1E88 A;  2KRI A;  1MD7 A;  2A55 A;  3KZJ A;  2MCY A;  1SS2 A;  1FBR A;  4ZH1 D;  1CK7 A;  3ERB A;  3GXE A;  2UWN A;  4F4O C;  2KMS A;  1VVD A;  1OJV A;  5HYT B;  1H2Q P;  4PZ5 A;  2WII C;  1OJW A;  2CG7 A;  2RLP A;  1J7M A;  2RL0 A;  3KXV A;  3R62 A;  2RLQ A;  3MQL A;  2XRB A;  4JHS A;  4CSY A;  1GPZ A;  1GXD A;  1ELV A;  4K12 A;  2ERJ A;  2RKY A;  3CAL A;  1VVC A;  1G4G A;  4AYE A;  3RJ3 D;  1E8B A;  5JPM G;  4IGD A;  1HCC A;  1GHQ B;  1Q3X A;  4AYM A;  4A5W B;  3M7P A;  1OK2 A;  2IZ4 A;  2CKU A;  4AYI A;  2B5I D;  2YBY A;  4B2S A;  2XWB F;  1NWV A;  4FXG G;  1QO6 A;  4DJZ A;  2W81 A;  1HFH A;  1PDC A;  3INB C;  1TPG A;  1OK9 A;  2QY0 A;  1EAK A;  1OK3 A;  1PPQ A;  1OK1 A;  4J38 B;  2FN2 A;  2XRD A;  2JGW A;  1E5G A;  5HYP A;  1KS0 A;  1GKG A;  2O39 C;  2W80 A;  1CXW A;  4ONT D;  3EJH A;  3SW0 X;  1GKN A;  2RKZ A;  3OXU D;  2CG6 A;  4MUC A;  3ZD2 A;  1QGB A;  2EHF A;  2BZM A;  4KKD A;  1O9A A;  2IZ3 A;  4AYD A;  2LOJ A;  1LY2 A;  1U5M A;  3O8E B;  1H2P P;  2EC3 A;  3GOV A;  1H03 P;  1MD8 A;  1CKL A;  4LOT A;  1HFI A;  4YNX A;  1H04 P;  3NFP I;  2XWJ I;  4C16 A;  1QUB A;  3T5O A;  3TVJ A;  4WJG 2;  1ZJK A;  3L89 M;  3ZD1 A;  1TPM A;  4B2R A;  2JGX A;  3OP8 A;  1TPN A;  4LOS A;  1Z92 B;  1C1Z A;  1OJY A;  1UOT P;  2V8E A;  2YRA A;  3OED C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...