1E89A

On the mechanism of cyanogenesis catalyzed by hydroxynitrile lyase from manihot esculenta. crystal structure of active site mutant ser80ala in complex with acetone cyanohydrin
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
262
structure length
262
Chain Sequence
PISKMVTAHFVLIHTICHGAWIWHKLKPALERAGHKVTALDMAASGIDPRQIEQINSFDEYSEPLLTFLEKLPQGEKVIIVGEACAGLNIAIAADRYVDKIAAGVFHNSLLPDTVHSPSYTVEKLLESFPDWRDTEYFTFTNITGETITTMKLGFVLLRENLFTKCTDGEYELAKMVMRKGSLFQNVLAQRPKFTEKGYGSIKKVYIWTDQDKIFLPDFQRWQIANYKPDKVYQVQGGDHKLQLTKTEEVAHILQEVADAYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic Aspects of Cyanogenesis from Active-Site Mutant Ser80Ala of Hydroxynitrile Lyase from Manihot Esculenta in Complex with Acetone Cyanohydrin
pubmed doi rcsb
source organism Manihot esculenta
molecule tags Lyase
molecule keywords HYDROXYNITRILE LYASE
total genus 98
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2000-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1e89A00
3R3WA 5JAUA 3DJYA 4J0GA 2WIKA 5AIAA 1W6RA 2BUBA 1LPAB 2WTMA 1XKLA 3WZMA 4FLEA 1ZJ5A 4FDMA 3QVMA 4ZWNA 1VE7A 3VKFA 3L1IA 2XUKA 3VJMA 5AO9A 5HF9A 5IH7A 3H04A 4M0EA 4KAJA 1OXMA 5JATA 1PJAA 1XZJA 4B7ZA 2QS9A 3G0GA 2GZRA 3WA7A 3IUNA 1DQZA 4UHDA 2ZYHA 3ANSA 5HQ3A 3SK0A 4AXBA 2G5PA 4C88A 3TRDA 4HXGA 2XMRA 4LXHA 3FVRA 5LZ2A 4W63A 4OB7A 3STXA 1J07A 5AKIA 3ICWA 2VT6A 1THTA 4X71A 4OD0A 3ZV7A 4QE3A 2WILA 1H22A 3B3QA 3HEAA 4LYDA 2K2QB 3WA6A 4EY4A 2W22A 5FUMA 5AM4A 1SCKA 4QLOA 1UK8A 2QUBA 2WFZA 2CMFA 5HZGA 4JNCA 1ZOIA 3HRHA 4HZGA 1CUDA 4B9EA 2BKLA 1U2EA 3I6MA 3BIXA 3DNMA 1TCBA 1IUNA 2EEPA 2H9YA 1WPRA 1P0QA 2BGRA 5SYMA 5AKEA 5AI6A 2X8BA 3A2MA 4OU4A 5JD4A 4EY6A 2RONA 1IZ8A 3KD2A 2XT0A 1TQHA 2J4CA 4BB0A 2VEOA 5C8ZA 2OAEA 4MYSA 5ALPA 2VAVA 1GZ7A 4FFVA 4S0XA 3MUNA 2PSFA 3O4HA 2IITA 1ZI8A 4MWTA 2JIDA 1UK7A 4BDSA 2ZYSA 3V1LA 3I6ZA 1N5MA 4INZA 1CLEA 5K3FB 5D7BA 1GPNA 3WZLA 3H18A 5AJHA 4N8SA 1HKHA 5JASA 4ARAA 4UHCA 1CV2A 4GEGA 3BF7A 4X94A 1ACLA 1LPMA 1FFDA 1CUSA 2XUQA 1YAHA 5AI8A 1KU0A 5CURA 1R3DA 2X76A 2Y6VA 5H3HA 3PE6A 5CW2A 1PV1A 2O2HA 1XKTA 1M33A 4WY8A 3JW8A 5AKHA 2Z8XA 2WIJA 3H1BA 5LKAA 2BAGA 1QONA 4DYHA 4UFPA 1E89A 4LYEA 4CCWA 1LBTA 1UWCA 5CH5A 2WFLA 3O9MA 2WHPB 4X00A 4X6YA 5E4YA 4W9RA 3ZI7A 1DWOA 2JGEA 5A7GA 2GYUA 4PSDA 1LBSA 1AX9A 5C8XA 3FLAA 5ALFA 3BDIA 4UBMA 4JUIA 3W05A 4DMHA 2C0PA 1BCSA 5EHXA 2ZSHA 3O95A 5LZ5A 5K3AA 3IBTA 3QM1A 3WK4A 2WJ3A 4Y2XA 1E5TA 3BJRA 5I9IA 2PVSA 4WDRA 5ALJA 5SYNA 2UZ0A 4Q05A 3OM8A 3G9ZA 2CJPA 5LLSA 3PF9A 2D5LA 1UK6A 1XZIA 2HA6A 1FFBA 1G4HA 1QIHA 4Y9SA 5FXMA 2XUOA 2H7CA 4PW0A 1R50A 2HA2A 4A16A 3WQHA 4B81A 4Y7DA 4ZXFA 4Y2RA 1CUYA 5AKYA 2XUJA 5ALHA 2AJDA 4W1QA 5T4FA 5JAPA 4BBZA 3VJLA 2QT9A 5K3BA 1B41A 4BVJA 2WKWA 5JAHA 3N2ZB 2JGFA 5ALUA 3DKRA 4QDZA 4V2IA 1EA5A 2HA3A 3FYTA 1FFAA 1UOOA 5EHNA 2XMSA 4G4GA 4B6GA 4DMFA 3A2NA 3O4JA 5AICA 4CG1A 3H0CA 2BUAA 4UBIA 1XZGA 2CB9A 4WJLA 2HA5A 4ZRDA 3E3AA 1IMJA 4QDOA 3ANTA 5AM2A 1K4YA 2C7BA 4J0IA 3EBLA 1P0PA 3ICVA 3A2LA 1SC9A 3A6ZA 4EBBA 3Q8WA 1ZJ4A 2HA0A 3BF8A 5LZ9A 1ZICA 4C4XA 3KWFA 2QJWA 2RHTA 4PQEA 3F67A 5EIAA 3W2TA 1XQXA 2V9ZA 4B82A 3B12A 5ALVA 1BU8A 1MO2A 1SCQA 1THGA 4PV7A 5BWCA 1XZDA 1E8NA 1HPLA 4NMWA 1F0NA 3STWA 5ISMA 3FAKA 3IB3A 2EDCA 5DJ5A 5J3JA 4CCYA 2O2GA 4CCYB 4ARBA 2WHPA 5ALSA 4UHHA 1DWPA 1QIFA 3JYHA 4H7KA 4DSZA 1LZLA 1MTZA 1F8UA 2JGMA 5CBKA 1H2XA 2J3DA 4RE6A 4BP9A 2CZQA 5D3KA 1QTIA 1LNSA 2ZVDA 4IH9A 3QBJA 3GUUA 5DYWA 4B9AA 3R3UA 5BOVA 1JFRA 2Z3WA 4Y2SA 3QZUA 2OGZA 2XQKA 3QPAA 4L72A 3V9AA 4GBGA 5D3ZA 1O6GA 3D5EA 4QZVA 2P8SA 4YX9A 3L1JA 1XROA 2G4LA 2PU7A 3I2GA 5CMLA 3IUMA 4HRYA 5ESRA 3WYNA 2XQGA 2OCIA 1QE3A 4W1SA 1AURA 2XUHA 2FJ0A 4IQ4A 4XIIA 2RI6A 1LLFA 1UKBA 4ZV9A 3DYIA 5C8VA 1HL7A 1EI9A 1FJ2A 2ES4A 4HRXA 4XVCA 1YCDA 2RGUA 3C5WP 1PFQA 2WUFA 4DNQA 2LIPA 2ZJFA 3AIMA 3D59A 3G0DA 3H2IA 4E15A 2PL5A 3H1AA 5JANA 1WHSA 1VZ2A 2O7VA 5FOQA 5ALMA 2CUTA 4MQLA 2VJDA 5T4EA 1MNQA 4BE9A 1UOQA 4FBLA 5JZSA 2XMCA 2PX6A 3FLBA 3HACA 4GI1A 5ALIA 2HM7A 2Y2VA 1LPSA 3OG9A 3V48A 4OCZA 2PU5A 1IVYA 2IIVA 2H7YA 3KSRA 4DMKA 1C4XA 5FRDA 3G9UA 4FHZA 1VA5A 2QR5A 4LXGA 2DQYA 4JH0A 4U2BA 3M3DA 5K5EA 5AM1A 3FCXA 5AI0A 4A23A 5FPPA 1XLUA 4NVRA 5DTJA 5ALKA 1YAJA 1XQWA 4PNZA 1F0PA 3PUIA 4C6HA 2YH2A 3FVTA 2XQJA 3QPCA 3V1KA 1R9NA 4ZREA 4GXNA 3STTA 5DYTA 3T4UA 3DL4A 2JGIA 4LIPD 2VSQA 1ODTC 2VA9A 3PUHA 3ESCA 4PSUA 5A7HA 4E11A 1DX6A 4Q3KA 5AK6A 4QDXA 3UUEA 2QM0A 1L7QA 3ESAA 4RNCA 1CUFA 4EB0A 5IVKA 4DNPA 2X5XA 4FFWA 1I6WA 5FLKA 1C7JA 3BWXA 5IVHA 4K6KA 5I7UA 5JD6A 1CEXA 1WB5A 5AM3A 3I2HA 3DQZA 4U2GA 5AKXA 3D2CA 4AO8A 3QMMA 5F4ZA 3STVA 1JKMA 5EIEA 3C70A 1XRPA 5ALRA 4QA9A 4X6UA 3HABA 1QIJA 2JGKA 3C6ZA 5DNVA 4FNMA 4MWSA 1XZFA 4AMZA 2BJHA 4BZZA 4IHAA 1D07A 3HJUA 3DYVA 1XZCA 3WKDA 1SCIA 1EDBA 1QO7A 1VE6A 3FBWA 4YPVA 1WCYA 5AOCA 1E8DA 3H2JA 1CUXA 2GYVA 3OOSA 3S8YA 1YASA 1TIBA 3S2ZA 4ETWA 2WU3A 3W06A 1N8SA 2PUHA 2ROQA 4G5XA 4P93A 4Y2VA 5LZ4A 2I78A 1RP1A 3LIIA 4MEBA 4NS4A 3PFBA 1IUOA 1BRTA 1CUJA 4BRSA 1HQDA 6YASA 1Q0RA 3KDAA 4GECA 4JEIA 5JALA 5ALWA 2V98A 4FOLA 3WK5A 3G9TA 4I3FA 4N8DA 1JJBA 1EX9A 1XZKA 3EQ7A 1XZLA 1J06A 3HSSA 5FKJA 1UFOA 4G9EA 3R3XA 3CN9A 5EFZA 1WHTA 4G8DA 4H7FA 3WWOA 3NWOA 3GZJA 1XZHA 3FYUA 4Q3LA 1GQRA 5AKJA 2HU5A 3DOIA 3I2JA 2O7RA 2J4FA 1WB4A 3PI6A 3R0VA 2WFLB 1W76A 2PKYX 3IA2A 4AZ0A 4UFNA 1DINA 2OCLA 2Z5GA 3H2GA 3WWPA 5AH0A 3WWCA 4W1RA 2ECFA 1EDDA 4UBJA 2FJPA 4ZV7A 1O6FA 4XWGA 4CIBA 3ZLTA 4IH4A 2WG0A 2GYWA 5LP1A 3IVMA 1LPNA 4D9JA 1A8SA 2QUAA 3IULA 1R9MA 3SX4A 3QPDA 3T52A 1Q84A 2AJLI 3BJMA 1NX9A 4X97A 1X70A 1FFCA 3PF8A 4DLNA 1GT6A 2WG1A 3I2KA 3CCBA 2AXEA 3IUQA 5HK8A 4BDTA 1CUVA 3WL5A 3CXUA 3QMWA 5HKAA 2OLEA 4J03A 1K63A 3F96A 1Q83A 3FSGA 4N5HX 2WUGA 5AKKA 1JU3A 1K5PA 1DX4A 1XRQA 4EY7A 3G0IA 1YSCA 1GPKA 3F97A 1EDEA 1H2ZA 3AJAA 1XZBA 3MUOA 4Q3OA 4EY5A 1KU6A 3C6XA 4FBMA 5AOAA 1CR6A 1ZGBA 1IUPA 1QIGA 2DSNA 1G5FA 2PUJA 3LCRA 5DTIA 3AIKA 4TGLA 2QRUA 4N5IX 1JU4A 1E8MA 2HFJA 2XMZA 4X92A 3VVMA 4RPCA 5ALYA 3E4DA 2RAUA 5IVIA 3FWHA 3HLKA 2QVBA 3GA7A 1EK2A 1EHYA 1HDEA 3R41A 2ZSIA 3N0TA 5IVDA 4AN0A 1NU8A 3JWEA 3GROA 2VAXA 4GDMA 2OXEA 2Y2UA 1DTEA 1YA4A 2NW6A 4KAAA 2WIFA 1P0MA 5HF8A 1MT3A 4KJXA 4UBLA 1XZMA 2WIDA 4BC1A 1VKHA 1YS2X 5CT4A 2JEZA 3G8YA 5AIBA 4UBNA 5AKZA 1U4NA 2O2IA 2JGJA 4U2EA 2D0DA 2VT7A 4JYPA 1XQVA 3EIOA 2ACKA 1RWQA 1OILA 4P92A 2WJ6A 3M83A 3PFCA 1GKLA 1UK9A 4Y2UA 4BVLA 1VOTA 1A88A 4WCVA 4FNGA 5A2GA 1W52X 3D2AA 2I03A 1CUIA 4AO6A 1BN7A 1QIEA 2JGLA 5CT5A 3DLTA 2B9VA 2RHWA 3DL7A 5K3EA 3BXPA 4L3WA 4J3JA 4KE7A 4ITVA 5A71A 2I3DA 4J0JA 7YASA 4HAIA 3WK8A 3I1IA 1QFMA 3GBSA 5AK3A 1EVQA 1QTRA 4JYMA 3DCNA 4H7JA 3RKSA 1P0IA 3C45A 3AILA 3M81A 3C8HA 3WKBA 3IDAA 4ZI5A 2XMGA 3UUFA 4AX4A 1EH5A 2VJBA 4U2FA 5EIHA 4DMCA 2QMQA 5AK4A 1GQSA 2QTBA 5HFAA 4BVKA 3RLIA 4CG2A 1T4MA 3EQ9A 2WHQA 3K2IA 4B80A 2FX5A 3GELA 4F60A 4U2DA 4K2AA 4LXIA 4H35A 5ALNA 3AZOA 3FYUC 4CG3A 1W75A 2XUPA 3ZPXA 5JAOA 4G4IA 2QOEA 3FLEA 3HI4A 1H2YA 1QZ3A 5T4BA 2HRQA 2HU8A 3K6KA 4MJ3A 4AQDA 1Y37A 2H7XA 5BWBA 2WFMA 2DCMA 1FFEA 3AUKA 1JMYA 1UZAA 2BFNA 1AKNA 1RYYA 1QO9A 1UT6A 1UKCA 5CH3A 1MX5A 3ZLUA 1QIDA 4Q34A 5CT9A 3I1YA 5CT8A 4HXFB 4J0KA 1VXRA 3ILSA 2C5FA 1BE0A 5AKLA 3WKCA 2WIGA 5LZ8A 1EVEA 4BTLA 1JMKC 3KXPA 2HU7A 4KE6A 2EDAA 1CUAA 4TVKA 4J0CA 5ALTA 1CUUA 5ALOA 2OCGA 3WMRA 5T4HA 1JT2A 3VDXA 4WFIA 2HDWA 1JJFA 4EA6A 3D2BA 4DSAA 3EQ8A 1WOMA 2QZPA 4QWMA 1CUWA 4G8BA 1QFSA 4B83A 4X95A 1AZWA 1ORVA 2XUIA 2DHCA 5CXUA 4HVTA 2C0QA 1GXSA 5JADA 4BAUA 5CTAA 1W4LA 4WFJA 1XQYA 2PSEA 2B4KA 4KRYA 4X85A 3AINA 5K3FA 3ESBA 5HQ3B 3WI7A 1BROA 5FPQA 3WIOA 1EB9A 4G4JA 1BCRA 2E3JA 1UXOA 2W6CX 2CKMA 4P9NA 3DKKA 4E14A 3AZPA 5CT6A 5CXXA 1XZAA 4WFKA 1H2WA 3M82A 3I28A 5LIPA 2V96A 4H7DA 1BEZA 2OQIA 4LKOA 5AI5A 2AJ8A 4LHEA 3RK4A 1HLGA 2GBCA 2WTNA 3NOXA 3B5EA 3HYSA 2GZSA 1R4ZA 4EZIA 3RARA 1USWA 1BN6A 2C58A 1X2EA 3G7NA 2PSHA 4UHEA 2OCKA 2WUDA 5FV4A 1NU6A 1Y7IA 4WDQA 4DM7A 3KOOA 2OAGA 3RM3A 1GKKA 4UBKA 1LZKA 1UOPA 3W9BA 4YASA 4K6GA 3WKEA 5JZBA 4FTWA 5JARA 5I8PA 1IZ7A 4U2CA 1CPYA 1ETHA 1Z68A 3NUZA 1XRRA 3DOHA 4WY5A 5FP0A 2XLCA 4UFOA 5HKBA 1XRMA 1ZD5A 3C43A 2XQFA 4J7AA 4L0CA 1MNAA 1DWQA 3DDUA 3WIBA 1CUCA 1Y7HA 1CUGA 1K6EA 2PM8A 3GFFA 4BRZA 4L9AA 3OC0A 2XMBA 5DNUA 4MXDA 4YK7A 3C6YA 4ROTA 5DNWA 4BCBA 5C7YA 1YR2A 3FOBA 4BYMA 4KRXA 2ZJ6A 3EF3A 3WWEA 1MU0A 4J0HA 3OPMA 1ZGCA 4O08A 2B61A 5ALXA 5AKGA 2XUDA 4HTAA 4QDTA 4UBOA 4OB6A 4C87A 2Z3ZA 4Q1VA 4AB1A 3F98A 2VATA 2GBIA 2DQZA 3DS8A 5EHZA 4FMPA 3D3NA 3H19A 1Q0ZA 3IIIA 2WJ4A 4AZ3A 1CQWA 2GBFA 3L1HA 1XLWA 2BUCA 1QLWA 1DT3A 3U1TA 2VF2A 5AM5A 3TGLA 1F6WA 4DNOA 5ALLA 4BP8A 1VZ3A 5JZ9A 3LLCA 3SWWA 5A7FA 1T2NA 4RE5A 1K8QA 4GLBA 3G0BA 2ZJ7A 4H0CA 4OU5A 4IH1A 4QNNA 4KR0A 2H1IA 3HXKA 5E4JA 3D4LA 5EGNA 2B20A 4QLAA 2FUKA 2G63A 4CFSA 5KREA 4TPKA 4C4ZA 4G8CA 4M0FA 3ESDA 2HA4A 1ISPA 4UHBA 1JJIA 4UHFA 2C4HA 1YB7A 1VA4A 4EY8A 2OGTA 1A8QA 1H23A 3LP5A 3O9VA 3V1MA 4J0DA 1N1MA 1QIIA 1XRLA 5AI9A 4C4YA 3WK9A 5CRIA 1J2EA 1QJ4A 4BCCA 3NGMA 2XMDA 2Y6UA 1GGVA 1G42A 2OGSA 2DHEA 3G02A 3STUA 1CIJA 4QEKA 4BCDA 4AN1A 1U8EA 1DT5A 1MX1A 5AI4A 1L7RA 2XUFA 2ONCA 1ZI9A 3ZWQA 2IX9A 5E2IA 5HK9A 4F21A 3G0CA 4E46A 1BS9A 1TKRA 3R3VA 1SFRA 4C89A 2WSLA 4I19A 2C5GA 3WK7A 1ORWA 1GPLA 2WG2A 1CVLA 1ZIYA 4Y2JA 5C81A 3O4IA 2CBGA 2R8BA 1S8OA 1VLQA 4PO3X 3IURA 2OG1A 5KWJA 4GHWA 3VISA 2XI4A 1CUEA 1L7AA 2HADA 1A7UA 2PPLA 3CN7A 3LS2A 3PICA 1CQZA 4Z49A 5AM0A 2GBGA 3MGAA 4F5ZA 4GWLA 1ACJA 4OYYA 5ALQA 1VXOA 4MYDA 2WQZA 5ALGA 3P2MA 3F9CA 3H2KA 1C7IA 4AMYA 4K5QA 3U0VA 2QXTA 5AP9A 3OTQA 1EK1A 3A70A 5D6OA 4BATA 1WPXA 1LPPA 1XZEA 1YB6A 3BDVA 3FCYA 2XLBA 2PSDA 5EI5A 4H7IA 3K9BA 5LZ7A 3C87A 5DWDA 3C6BA 4XJVA 4W1PA 3KWJA 1QIMA 3TEJA 4P08A 3WL8A 5BV7A 1AQLA 4G1FA 2HFKA 3QMVA 5K3CA 2WU4A 4KEAA 3BIWA 3WWDA 2YASA 1AGYA 2CEKA 2YXPX 1CUHA 4OYLA 2QJRA 3O4GA 1XRNA 4OPMA 3FYUB 2XE4A 1ZIXA 1MAAA 1MJ5A 2XDWA 4OB8A 1U65A 1EXWA 3D0KA 3X3HA 1ZD2P 2QKYA 2VQ6A 3C8DA 1B6GA 1CRLA 1ODCA 1QIKA 2DHDA 3OURA 4BAZA 5HF6A 3ED1A 4B85A 4B0OA 3WK6A 3AZQA 3FNBA 1EINA 1YA8A 4MEAA 3DEAA 4UUQA 5A62A 4EUSA 1TK3A 3W9UA 5LYYA 4Y2YA 5ALDA 1EB8A 2DFPA 5ALZA 4BAGA 5KWIA 3UMJA 2WLSA 3IUJA 1YS1X 4CIAA 1UKAA 3H2HA 1J1IA 3W04A 3HC7A 3G9XA 1MPXA 1WB6A 3WL6A 4RGYA 1AUOA 3E1GA 4H7HA 2AJBA 4DNFA 2JBWA 3WLAA 5AK5A 5E4TA 3BE8A 1AC5A 1E3QA 2I3ZA 5JD5A 3YASA 3MVEA 2VJAA 1XLVA 1SOMA 3QITA 5KBYA 3AIOA 4FWBA 4Y2PA 2ACEA 4BTVA 2ORYA 4BC0A 1CFJA 2WUEA 4HS9A 1MX9A 4Q82A 3SC2A 1QOZA 3I2FA 2HL6A 1R88A 2XUGA 4OUKX 2R11A 1MAHA 2Z8ZA 3I2IA 3O0DA 3WJ1A 3VXKA 1TAHA 3TJMA 1KEZA 4Y2QA 2VTVA 1W1IA 4KACA 5K3DA 1CUBA 2JEYA 3V1NA 4M0MA 3CCCA 1E66A 4ZGBA 2Q0XA 3VJKA 4KE8A 4AO7A 1G66A 5A6VA 3H17A 2JF0A 2XUAA 4UPDA 3C5VA 5IKXA 4KYVA 1A8UA 4FLFA 4X6XA 5DLPA 4H18A 1ODSA 3WJ2A 1TCCA 4X3CA 1TRHA 2WM2A 2BGNA 1LGYA 4K6HA 4BE4A 2WHRA 5YASA 4DTCA 4DGQA 4B84A 3STYA 3BL8A 4XX1A 1VJ5A 4H7EA 1ZI6A 1JI3A 4KAFA 1LPBB 4NZZA 5AHXA 1LPOA 1N5RA 2RIPA 3E0XA 4B0PA 1R1DA 2AJCA 2PSJA 5EHQA 1X2BA 3QYJA 4FKBA 1DQYA 4HXEB 1AMNA 3PDCA 1WM1A 5HCUA 2XMQA 3FSGD 4PSCA 2PBLA 4A5SA 1HBJA 3DD5A 4QDUA 4Y2TA 4IO0A 4OSEA 2BCEA 1OCEA 4BZWA 3WYDA 3QH4A 5CH8A 2J3QA 4F0JA 3VVLA 4I4CA 2ZYRA 2QXUA 2HIHA 3R3YA 4X7BA 2HRRA 3D7RA 2XQIA 3HZOA 4N8EA 2HHAA 3LIPA 1ZD3A 3R3ZA 4QWWA 1BEEA 4X91A 4PF1A 2XB6A 1QGED 5HFNA 5JYCA 4KE9A 1ZD4A 3WL7A 3ZLVA 4H77A 1TCAA 3F8SA 5DYYA 2OPHA 4G9GA 4CI9A 5LKRA 2YYSA 5JIBA 5AOBA 1FSSA 3R40A 2OQVA 3AFIA 4X90A 4MQMA 4EHBA 2G5TA 4C01A 2V97A 4GW3A 2ZYIA 1MN6A 5HF5A 1CUZA 4DIUA 3WKAA 2Y1KA 5ALEA 1XFDA 5FDFA 3I6YA 4X93A 2HA7A 1DU4A 4FLMA 2DR0A 3Q0TA 2VJCA
chains in the Genus database with same CATH superfamily
5JAUA 2EKZA 3GJYA 2CKDA 2IYVA 3BYZA 4Z0PA 1LVHA 1AKWA 5E7MA 3CZMA 3N1UA 3G1WA 5EMKA 1U9IC 1TU4A 1P9OA 2ETXA 3BMNB 2BUBA 2Q6OA 3NTOA 2CT8A 2EFEB 2H31A 5JHGB 1BWRA 1XKLA 1ML4A 2GO1A 2QP9X 1U0BB 3E4CA 1NE7A 4EO4A 1SCNE 4OQZA 1NVWQ 3NZEA 3IT2A 4UVIA 4RKFA 3WAKA 1G3MA 2HW8A 3VKFA 3IEVA 3AO0B 5B4UA 4PLFA 3NXKA 1ODIA 3L1IA 3UMRA 2PRZA 3TTUA 5EOVA 1P5HA 2J07A 1BOOA 3R7WA 2J0UA 4R0NA 2FK8A 2ZRIA 4PBRA 3URMA 3JZIA 2PVCA 5H70A 4MYUA 5IH7A 1TFUA 1IONA 1AHHA 3CF6R 3HCRA 4GOOD 4QU5A 1YFKA 1F2DA 5FLEX 4AJKA 2HC9A 1F8XA 2NUPA 3UT5B 7ABPA 1GKUB 2FWRA 1E6CA 4R9SA 4OHMA 3LE8A 5B2FA 4P82A 4O2AF 3PEWA 3UB3A 4LJ5A 1IG3A 2GZRA 4PXAA 4YDQA 1NYRA 3DL0A 2ZRBA 4F5YA 5C34B 3IUNA 3GMSA 3TFOA 2LRHA 1V7QA 1RBYA 1U0JA 2P1DA 2ZYHA 1ESEA 1U9YA 2XE7A 3ANSA 1UMCA 3QPUA 5EVJA 4BEBA 4D02A 4YQZA 2G5PA 4O5OA 2FR8A 2XIJA 3C8UA 4GT1A 4DV6B 1HT0A 2P3LA 3RG2A 3T38A 2XAAA 4FHFA 1FYXA 3KWLA 1V37A 2AUTA 3EDMA 4UD6A 4BWYA 3NI2A 1V7CA 4KGXA 3E84A 3C5HA 3H0EA 3CNBA 1FMCA 3MAJA 2ONZA 4KX3A 4RTLA 3DFIA 4OB7A 3STXA 2QIPA 4FSDA 3H86A 3QVKA 1U7WA 3WGJA 3ICWA 3C4QA 2FEOA 1ULSA 1NYQA 1Z2EA 2Q5CA 1ZLYA 3AU8A 1ZN7A 4HQFA 5CDFA 4DRYA 5GADl 4X71A 4IIJF 4AXXA 4JKYA 2BGGA 1K92A 1W46A 4QE3A 5BN3A 1N36B 2PYIA 4OOFA 1H22A 3DW3X 3F6RA 3QE9Y 2I6GA 2VK1A 3HXQA 4YUWA 2K2QB 3EVFA 3L7IA 3WA6A 2BE7A 1N4DA 1PV4A 9LDTA 4FX5A 2W22A 4V38A 4CHGA 2I54A 1JKIA 1O9GA 3DXYA 1A7AA 1WF6A 3LH5A 1VG0B 2YJZA 4I1PA 1E92A 4OKIA 2XTJA 4LOLA 5CDUA 3LKZA 2FPOA 2Q0HA 3I34X 3TVYA 2WFZA 1OGJA 3UK7A 2NYAA 5HZGA 4B1FA 1K5HA 2BM8A 5CYOA 1Z5NA 3V7YA 4BQFA 5IKOA 4WKGA 3KLBA 2P9YA 4JNCA 4FSHA 3GRKA 1HX7A 3QKIA 5GONA 3NVDA 2J41A 3TPCA 3DDOA 4BU0A 5I7VA 2BKLA 1EM6A 3Q7SA 3I6MA 5EIBC 3KKLA 1KEEB 1TCBA 2YVQA 3CNHA 1Y81A 2H9YA 3D2LA 4FCWA 4A10A 1NUHA 4HPJB 2P78A 1FDVA 2SKDA 2ZIWB 4RMIA 4A27A 3OICA 1C0PA 1P0QA 1F7UA 3HSKA 3L7DA 3QWHA 3EW9A 2ZB8A 3UHJA 3QI7A 4Q18A 1HF3A 1SZPA 5AI6A 4OI1A 3ACBA 1KZHA 4BFXA 1YFJA 4ZOCA 1R8YA 5JD4A 4RIFA 1EX7A 1I51A 1WQ3A 2WQ6A 4AJ2A 1M2FA 1E2MA 3LUKA 4RDCA 3OQNA 1ZMXA 2XT0A 4XJSA 3EOAI 2TYSB 4P31A 3UMGA 1J56A 3GVHA 5EXSA 1VLVA 1Q0SA 3BE6A 4MHOA 1PR1A 4ZYWA 1O0SA 4JBYA 4MYSA 2IYLD 2Q41A 5ALPA 2VAVA 2RGDA 1T91A 5JYEA 2IBSA 4KUEA 1GNTA 1V2GA 4XW2A 4YV1A 5AW2A 2ZGVA 4N49A 1PSDA 1JPVA 5FA6A 1QGOA 2R8OA 1PZMA 4QGSA 3JAKB 2JIDA 2YS6A 1REQB 4BV9A 5KB3A 4G0YA 4DIFA 2ZSAA 4XYBA 3ZHRA 4CQMB 2BPOA 3P32A 2PGLA 4BLQA 4EKYA 1N5MA 3EVDA 1CLEA 4INZA 2E5LB 1LQ2A 1E7SA 4V3CA 1Z13A 5DYIA 4BMVA 4BKQA 1TVCA 3GV0A 4MB0A 4BKMA 2R1UA 2YWJA 2D4HA 3BHNA 4QXPA 3SN6A 4N8SA 4OO3A 4MW2A 1GTRA 4W7HA 3OMXA 2FZVA 1EIZA 1L7EA 1XDSA 4KIGA 1BH6A 1Q7EA 3PIDA 1AOXA 4MUHA 1E2UA 1CKEA 2O2ZA 2PSSA 2O2CA 5DLYA 1N6HA 2AE1A 5H4HA 1HE8B 3N6VA 4FGUA 4BJ6A 3QUCA 3MJTA 1EP1B 3LCCA 3B9RA 5H16A 5A3VA 1JL3A 1CUSA 1T35A 2XUQA 3EG9B 1QO0D 4GGMX 2G07A 1R15A 4JMLA 1U2GA 1D6SA 1CZRA 4HNQA 4G37A 2X76A 3G49A 2OXRA 2YMLA 4ISBA 4PWYA 4QATA 4Q0MA 2XCLA 3S8MA 4M83A 3O38A 3D81A 3SDZA 4ZTBA 1WW2A 1HA3A 2NSLA 1C9NA 2F1KA 2H9IA 3TUJC 2H4ZA 3DE6X 4YT4A 5AKHA 3JW8A 3L7KA 4CMEC 5ELLA 5FO1A 4A2QA 1DFGA 1M66A 1KMIY 1K8RA 4M8NE 4CUZA 1UXHA 3L41A 2GXAA 3OWOA 3Q7EA 1P1RA 4LDPA 3K2QA 4Q3NA 1PLJA 3WVNA 2P2NA 3CS3A 4YY3B 3ADDA 4DWJA 4WNAA 1U2TA 4ON9A 2CL0X 4JBLA 3AKYA 1L6RA 3F7TA 5DN9A 4UKDA 3UGKA 5DBHX 1WNFA 3BKXA 5EJGA 2FMXA 5FORA 4EEZA 3P9SA 3RYIA 1DFIA 1UWCA 2A9PA 1Z4LA 1YONA 2EX4A 2P1RA 1K88A 1RQ7A 2W37A 3RYIB 3G68A 3UGQA 4GKBA 1COWA 1TVMA 4X00A 4D4MA 4DA7A 5LR6A 1NI5A 4PFKA 1DWOA 3W5CA 2WAAA 4E5DA 4R1TA 2VDKB 2IELA 5KNCH 3MWDB 4C6RA 2OYCA 3UPUA 2AS0A 4XFKA 4PN3A 5AUNB 3VAYA 3COVA 1DEKA 2JHAA 1AX9A 5CUQA 2A5YB 2ZWVA 3D7NA 1BMFD 1II8A 2C5BA 4RL6A 1ZSYA 4I3HA 1NW6A 3BDIA 1AN9A 3VPCA 1S2OA 2G04A 1T1GA 3H42B 3REQA 4KL8S 5KHLB 1RDFA 1UT5A 1UBUS 4YJ3F 1BCSA 1XV5A 3O3NB 3DTVD 4KLRA 4YRDA 3RF7A 1GPDG 4MR7A 4BFUA 5LZ5A 1CWUA 1P4AA 3IBTA 2B78A 3QM1A 1FDTA 4OLHA 3H5TA 4AW9A 4CQNA 4ZVLA 1O94A 2YHUA 3A31A 3A6DA 4HEJA 4IQFA 4Y2XA 5FFFA 1Q3HA 3KQWA 1M1YB 4J1NA 4M86A 5I9IA 3C3WA 2QLNA 2BKUA 3MTDA 1QYCA 5DHTA 3UK6A 5FPTA 1HT1E 5A4FS 5SY6A 4WDRA 4DLPA 1E2HA 1QR2A 5ALJA 1YE8A 4DR5B 1IXRC 1WULS 4ZOQI 3ZWWA 4D8YA 3R5SA 3E8MA 2H7VA 5K01A 2IZ1A 3MLBA 2VRNA 1KH2A 1E6MA 1NW4A 1Y1TA 2Y0CA 3MTAA 1KSJA 2ZUCA 3B8EA 3OM8A 3ZCTA 4E2WA 5AVZA 1BKYA 3PF9A 1DBVO 4ZCQA 3EMKA 3IT3A 3KSMA 1SG0A 1UK6A 1YQDA 3HKBA 5FQNA 5A3QA 4A8JC 4MLDA 1QIHA 1YUMA 2CDCA 1DB3A 2GPTA 2HSGA 3BREA 3CJQA 3SM3A 3BRSA 1LVGA 3CY6A 3NRBA 3DGFC 5FUYA 5U4QA 2FI1A 3N53A 2YMMA 1P1IA 2IOYA 2JHFA 1E4YA 4D82A 4LV6A 2IBMA 3NMUF 3S2GA 1UXJA 2B25A 3EQZA 3PRKE 3TAXA 2IKSA 1YFLA 1N3IA 2FPLA 3WQHA 6Q21A 2FN7A 4ZXFA 1EHIA 3ZJUA 3CF4A 3MM4A 3QEOA 5IT9A 1TZCA 1M6WA 2F8MA 2PY6A 1T6YA 1P9WA 3KQQA 1VLHA 3HGMA 4BQOA 2AJDA 3GEGA 2JFUA 4ISCA 3S81A 1KEPA 1SOUA 2GX6A 2QT9A 4WTOA 4CYMA 4HX2A 1QTQA 2VLIA 4YQFA 6REQA 3KVRA 2ERCA 2G4VA 1S02A 4NZPA 5F77A 1DTWB 5FADA 1YUNA 2JGFA 3V55A 1XA3A 5B1EA 4M6WA 4IUYA 2RFLA 1D8AA 4V2IA 1Q7CA 5TGDA 1FFAA 4NK5A 2C31A 4BXOA 2HJWA 4I36A 1KOFA 3KQKA 2QN3A 2GN9A 5EHNA 2PGJA 2PDAA 3EIWA 4G4GA 1HQYE 4JAVC 4B6GA 1KMHA 1YDWA 4LJYA 1M73E 5AJXA 3RS9A 4RTPA 2Q1YA 1GA4A 1NBME 2VDVE 3H5AA 1YZNA 5J5CA 4TQUS 3ZXIA 5KSZA 1FTQA 1U1CA 2B6HA 1FNSA 2XCUA 3K4HA 3DAFA 2Z6UA 4F6CA 1YQGA 5CEFA 2ZTHA 5BV1A 2LR0A 3WYBA 4P4SA 1BDMA 4AKHA 3ZIAD 4ZCSA 3FPKA 3OC6A 1K06A 1OT5A 1O5IA 2AXQA 1X7GA 1RWWA 4TWZA 5F7ZA 3RS7A 3KQVA 5JH7B 4DRXB 4QFDA 3RRFA 3ANYB 3O2NA 3SIPA 1WY5A 4LRUA 4H16A 1U94A 2ZUVA 3ZR4B 3KPVA 1S3IA 5I5EA 1BKDR 1SC1A 1FW8A 3OA0A 2YYZA 4XB2A 3P4YA 4J0IA 4QFCA 4PEVA 1XTTA 2FN4A 2OO5A 1TYDE 3A2LA 1DKRA 4EIWA 1ZM2A 2EJWA 3IEPA 4OX9Y 2X0EA 1UBOS 1RJFA 4P3NA 3DFFA 5LQMA 1OFVA 3W5HA 4EFDA 4YV2A 3CVXA 1EJ6A 3LC1O 1ZICA 1XTRA 3NJ8A 1FL9A 1XPJA 2IF0A 2RHTA 5DYGA 1KYZA 4V24A 1V5WA 2GXUA 4FYIA 4ZOEA 1XQXA 2REQB 3CG0A 5EA2A 4KDRA 5C9ZA 1Z7WA 3V2IA 5B58C 3HXTA 1BU8A 1T36A 3VZSA 1U1DA 1MO2A 4PLVA 1YRYE 1THGA 4IXMA 2Z3VA 5AVKA 5KCZA 2VTKA 1JAXA 2YV3A 3KZMA 1YDMA 3BMOA 3HKBB 2EBUA 3AEUB 4OHYA 4MMXB 4EQZA 1FXSA 3P4UA 1AU9A 3TOSA 1FUKA 2XRFA 4NMWA 4MTCA 4FMDF 4M1MA 2W2TA 2A0YA 4HWSA 1R0YA 2ZWOA 1F0NA 1YZTA 4QQ8A 4BRWA 1SIOA 5ISMA 5AJTA 3PX7A 3ME5A 721PA 1Q15A 3AY6A 2WF5A 1TYZA 4NF2A 4AI6A 4KNYA 1OLSA 3BFKA 1HWYA 4K9SA 4O4JF 2IIBA 1PGPA 4ARBA 1C3XA 4K03A 4QYTA 3G2HA 1YZUA 1RWKA 5KTOA 2H17A 3FWPA 4CE6A 1XNRB 3KHUA 1I1QB 1PEKE 1YQEA 2ZYUX 1KO8A 4FYKA 1WZIA 4LOKA 1NQTA 4UHHA 3OBBA 4JJGA 5AJVB 2R47A 4BNIA 3HJTA 2BFMA 3H6GA 3Q1LA 4UM9B 3A2KA 1EGQA 3KL2A 1AB6A 2GR9A 2OPBA 3TZBA 1S2IA 1M67A 3WQRA 1MTZA 2Q07A 4ZKEA 5LM3A 3COJA 2D7JA 4TSRA 5JYBA 2WF6A 5E4FA 4ZRMA 2PUTA 3VR6A 2J3DA 4RE6A 5AW3A 2C4TA 2C77A 4NBWA 2FWNA 1PEAA 4LEIA 1TKBA 5D3KA 5LC1A 1C3JA 5SZJA 1WETA 1T3LA 3R9XB 2FG7C 3GGSA 4KQXA 3DBLA 3NBUA 4Z9XA 1CNEA 2YVLA 4ZAYA 1UP6A 1YV9A 4EECA 2ZAMA 3ZV6A 5KVVA 3U4MA 1T3ZA 5DYWA 1QM5A 2M1XA 2OV1A 2QTFA 3HP1A 3PNMA 1BYUA 4HUTA 5MF6A 5BOVA 3VO2A 1EFPA 1UR5A 1WMBA 2OV4A 3BB3A 4Q37A 4O2LA 4FEYA 4RPJA 4U5QA 5CHYA 3N5CA 3D7MA 2Z3WA 3CNQS 3OX4A 1D9ZA 1BA2A 3NVAA 3IJ5A 5AHOA 3FH0A 3H2BA 3WQBA 3OX2A 3OT5A 4FFBB 4V0QA 3N87A 2Q1SA 4JI3B 1IBKB 4ZPXA 2I71A 4GBGA 4NCBA 4DM4A 1TJNA 2DPYA 3HJFA 2W6QA 1Q14A 1TM4E 2R66A 2Q5EA 1Z9BA 3AKEA 1QGZA 2Q29A 3MJCA 4KN9S 2C2YA 4L8FA 2ZT6A 1O6GA 4U7FA 4WL0A 3PNSA 3TSCA 4JBXA 5F23A 4YX9A 5JNWA 3EGEA 2WTEA 3HA5A 4D9EA 2NUTA 1KH1A 3MTJA 2PUBA 2RI1A 2EATA 3V1YA 1YHNA 1J39A 4HRYA 2TS1A 4DC1A 1E9FA 3WYNA 3NBKA 4BFWA 5FF9A 1QE3A 3MG9A 4S35A 4IKEA 5E0KB 4JB2A 3DZBA 5HTOA 4W1SA 4IDCA 3VOSA 2V8OA 1W7AA 4INAA 2XEDA 3L93A 4YJHB 3SSAA 4QYSA 4RKYA 3VX3A 3RC8A 3FJYA 3T4PA 3D4BA 1N77A 1LLFA 4B31A 5JISA 2IXTA 3GX1A 1IRIA 3RS3A 2V7GA 2GI4A 3AUYA 1KE1A 3T7EA 3RVDA 4ZV9A 3EWAA 3ZBTA 3EPHA 1IZYA 4NBNA 1S0UA 1TDJA 4R1SA 2QM8A 4WV3A 2FX2A 3W6ZA 2QENA 4F1WA 2ZWAA 2BTEA 4LYGA 2ES4A 4HRXA 3UV3A 3ICEA 3CNOA 2QTMA 4MV7A 2Z2KA 3U9LA 3UVEA 4OJKA 1X6VA 3U3ZA 3N2EA 1JWLA 2PR2A 4TWRA 5NULA 2WUFA 4IQ8A 3FPBA 4B2LA 3LDUA 4G2TA 1XTVA 2ZJFA 2BI4A 3G5TA 5IS2A 4DSTA 3AIMA 3U0BA 3D59A 1CZNA 3H2IA 3TIFA 1VL5A 4WCFB 1WHSA 1Z16A 5LSAA 2O7VA 2X6RA 4XYMA 4ENQA 1YZLA 1TU3A 1E2DA 1R37A 2IGBA 1XAIA 2F9LA 5AJZA 4HNUA 2C96A 3RAPR 2RBKA 1UOQA 4YRCA 4L6CA 4NG4A 3JQCA 4M88A 4YWHA 2CFCA 1JHDA 5DHUA 4WJKB 2PX6A 2WPNA 3G13A 1B26A 5EEGA 3TEFA 1KHTA 1EVYA 1ZWKA 2FJUA 2Q5JA 4IG4A 1UKYA 4Q1FA 4XGNA 4UM8B 9ATCA 4DG5A 4CDMA 4EB8A 1UBEA 1AQJA 1RE0A 2Y2VA 3MCAA 2INGX 1MG0A 1U3TA 2E48A 4G1EB 5CM8B 5D86A 4TKMA 2DEUA 3K8QA 1E6KA 4YAWA 3PXUA 1DIHA 3OG9A 3V48A 4OCZA 5A0FA 2ZOSA 1WO8A 2ERXA 1NBIA 2IIVA 2X7JA 5JSYA 4F8YA 2I6QA 2BCJQ 1PTKA 1SQ0A 5EINA 4E1AA 2JJMA 1C4XA 3THWA 2BEJA 1P7WA 4CFYA 4ZDKA 4Q48A 2J5RA 1L7VC 3EZLA 4FHZA 4OM7A 3TVDA 5EZYA 4MUFA 3TDNA 4E6PA 2QTCA 2ZUBA 3IJRA 2QR5A 1A1SA 1F17A 2O8BA 2CHFA 1D0VA 2JI8A 3OLZA 2YV5A 4JH0A 4MVYA 1D2AA 2B82A 3FCXA 1ARZA 5AR1A 4XCVA 4I4TF 2J32A 1Z15A 1VG8A 5JJBA 4E7PA 4IGFA 2AMYA 2E82A 2OXCA 3UCXA 5HZKA 1G0NA 1E99A 1G0OA 4IJWA 2HMAA 2ENWA 1U8YA 1K3UB 4W5HA 4D46A 5LDGA 1E2KA 1X7XA 3CM0A 3LOUA 4B5KA 1DMSA 2BMDA 3CWZA 3AY3A 3IL2A 2JLVA 1F0PA 1O3YA 2PGXA 3GJ5A 3MTBA 3PUIA 4X0EA 4C88A 1GTJ1 2X5KO 3WBBA 3OOJA 1QFZA 2I2CA 2I99A 2OBYA 2W2VA 4QQKA 1NBAA 5IWAB 2JZNA 3FWYA 2QQ5A 4KN5A 3E9EA 4M99A 1QRRA 2EZ8A 3H1GA 3TGPA 3DLIA 1ESMA 4HBGA 1IIRA 1XYVA 2VSQA 1ODTC 2GARA 2VA9A 5FUBA 1VHLA 2Q5HA 1CS0A 1JRLA 2YJ4A 3ESCA 3OTWA 4PSUA 1EGAA 1M5TA 3A0RB 5DM4A 3VTKA 1DX6A 5HTKA 1NQOA 3GT0A 1A1VA 4KPYA 4QDXA 2LP4Y 3QX7A 1W19A 2HDNB 3SQLA 3OX3A 2X9LA 3L7OA 4KMMA 4Q9AA 1IHUA 5DHSA 3NHSA 2RCNA 4M9RA 3UHOA 1L7QA 4FHCA 5F2EA 1CUFA 1MZPA 1L7XA 3V8MA 5CVCA 3WYAA 1OVGA 3DEKA 4FFWA 3WLMA 3MSXA 4XDGA 3A6EA 2C4MA 5FLKA 1M0WA 1A77A 3BWXA 2HPZA 2NZ8A 4LDNA 1RABA 3FYHA 4K6KA 2VDRB 3ZXYA 2MSCB 2VDMB 4JP8A 2NU8A 5BQ3A 5HGXA 1WSDA 5JD6A 3L0ZA 4X1IB 1QKJA 3AW8A 2G71A 5DFAA 3GQBA 4HMOA 4MEJA 1Z5PA 2EGGA 4YRBA 1FVHA 3F90A 3JD0A 3K30A 4S1VA 5JNSA 4BNTA 3WHKA 3BA1A 1SM4A 3D2CA 1EUDA 3F5QA 3OESA 3P45A 4TKUA 3WLRA 1L3BA 2DX7A 3STVA 3A4IA 3DQQA 2K87A 4ILKA 3RASA 3ZBPA 2WMOB 5TMEA 5FBWB 3BZWA 3WLLA 1FMTA 4UMDA 1GN8A 2DWCA 2PZ8A 1ZFNA 3IOMA 1MTOA 1R0BA 1K7SN 4FI3F 5DX0A 4CKZA 1M2KA 1IAVA 4QA9A 4QUEA 3P0RA 5BWLA 1G7CA 3HABA 2ID4A 4AIIA 4J7UA 3DLPX 1TPYA 3GOQA 4F9GA 1XWFA 2R6AA 5B37A 2NPFA 4EHHA 2DB3A 4MMZB 3L8YA 3C6ZA 6ADHA 4KOEC 2YHAA 3U1BA 3TVTA 1V8PA 2HNBA 1NRIA 3GLGE 1JSXA 3OF5A 5IANA 3Q8MA 4ZO7A 1EE1A 1GZUA 4M46A 4XVHA 3N8HA 4Z4QA 1E5QA 1IHYA 2B8TA 2GWHA 1QE0A 1UJ4A 2ZR0A 4OAOA 1D2EA 1OI7A 2W4QA 4CF6A 3OCVA 2GVDC 4KNVA 2BJHA 4V2UA 4ZT7A 4IHAA 2XT9A 2XA2A 3DUFA 2JGNA 4OI4A 1QF9A 3SF8B 1JMVA 3HG7A 8LDHA 1GM5A 1I3MA 1N8KA 1JH9A 1VPDA 3M4XA 3U4CA 5JJCA 2GKSA 3S1AA 1XI2A 3DYVA 3D43A 3P52A 4UE2A 5D00A 5CXQA 2ZRCA 3I9JA 2GBPA 4OLAA 2BONA 2VYFA 1XZCA 1N78A 4RTRA 4PAOA 3QE2A 3WKDA 3QY9A 3GY0A 3G2PA 1SA0A 4PQYA 3Q88A 4I5GA 5ERGB 1YGPA 4I8XA 4TRNA 5F7XA 4KO3S 5F64A 3TM5A 3SZ3A 1KIAA 1JP7A 1IK6A 1N2OA 1X1QA 2V9CA 4MA0A 2ZTMA 4M49A 4B3BA 3FKSD 13PKA 3OOSA 3S8YA 1M2NA 1PN3A 1YASA 2UZIR 2R7LA 2WBLC 1TD9A 4HQLA 1DKPA 2X41A 3MINA 4WK6A 1CEQA 4Y2VA 3PXGA 2GK3A 1C3LA 1NR1A 2I78A 3IUSA 3ENNA 3KKNA 3HR8A 1RP1A 3ICOA 4K2HA 5HE9A 1XVIA 4OMUA 5BP7A 3FI0A 1Z0AA 2OBFA 2BFPA 2Z8YA 4C7KA 4ZYTA 4W5NA 1IATA 4MV1A 3CEMA 4R8MA 5ENZA 4YJGA 4Q9HA 3WO0A 3PPIA 1BRTA 2FWBA 2I22A 4I6JA 3FJ1A 1PFVA 2PXHA 1QRTA 1M75A 3GHHA 1B6SA 4PLCA 5CB0A 4JYZA 4DA4A 2UUOA 4QQRA 5CFRA 1MGPA 4Y9UA 3A6PC 4FOLA 3KBOA 1A8PA 3WK5A 4P38A 3TBHA 2LUOA 2W43A 3OLWA 3CKYA 1RYHA 2R85A 4RLFA 4RVNA 4CLOB 5CDTA 1EX9A 5FTWA 1QUEA 1RWBA 3EQ7A 1FP1D 2C98A 3D8TA 3SYLA 3H5LA 3R3XA 5T8KC 3UICA 3M6IA 5FUQA 3OPYB 4MYRA 1BXRB 1EXDA 4UQOA 1ZGHA 2DBYA 4GKJB 2PWZA 1EGVB 1N75A 3AUUA 4NQZA 2AG8A 5JCPA 4PYJA 1JQJC 1YMVA 2PT7A 2Q62A 1LI5A 2H18A 3GDOA 3WHPA 1PL0A 1VC2A 4C2TA 4D3SA 3G5LA 3HV0A 5FI1B 5DNDA 5EQDA 3TK1A 4Q3LA 1GQRA 3EA5A 4QUAA 1Z2DA 5F5NA 4Y98A 1KARA 3D3EA 5E9AA 2YVAA 3Q85A 3I2JA 3QKTA 1AKYA 2DFVA 4NEHB 4PXSA 1ZH4A 1NR7A 2FFQA 1DUSA 3GDWA 3PSHA 4D9MA 2AZXA 3EPPA 1TQDA 5F76A 5THXA 4YCDA 1ZSNA 1ZX1A 3JZMA 1L4HA 2BRUC 1YRLA 1Y3FE 3DE4X 4L2IA 4NWIA 3H1EA 1KJ8A 2N75A 4R3WA 3P2IA 4LVCA 4MSUA 2H1FA 1UT8A 1V1RB 2YOHA 1XHLA 2ZSDA 2AFIA 5DYNA 4F3TA 3T5AA 4PIPA 3B52X 1DPFA 2ZIVB 3L8CA 4J2TA 2Z5GA 1WU8A 2I6FA 3AP2A 3N8DA 1M2GA 4YMLA 3H2GA 2A5FA 5I4KA 3WWPA 4PANA 1IB6A 4WADA 2VF4X 1H66A 5AH0A 1TUIA 3U80A 4EF4A 2CXHA 3QSGA 4O1MA 4O2BB 4PR0A 5D51S 4PG8A 2RH4A 4AZ3B 1NP7A 1NZDA 4FFSA 2EERA 1N25A 4KBYA 4ERXA 1FLDA 1PGJA 5GV8A 5HMMA 3GMDA 2W2XA 4XWOA 1DO2A 1QHIA 1OWPA 3OUZA 5JV5A 1L5VA 1B76A 2OBBA 1ZN9A 4GYYA 2PUEA 4J1SA 3X2EA 1UMBB 1CDOA 2VA8A 4MRSA 1NBMD 1E61A 3KUKA 2ONJA 16PKA 3DV0B 4ZDIA 4FFLA 1BHSA 5JXIA 4RGVA 1KVTA 4EATA 2HDOA 3E9YA 2IHJA 2IC5A 3EYWA 2BZ0A 3SE0A 1S89A 5CVDA 4NFYA 4BKPA 1A8SA 1WNTA 3M5PA 3S5UA 3LX8A 2GDZA 4LYHA 4DANA 4YMVA 2W2PA 5L6MB 3IULA 4QO7A 1TE2A 4RD0A 4JJ4A 2C7RA 2ZI5A 2XDQA 4BP1A 4CL3A 1WP9A 4OQXA 4PAGA 1WCIA 3CE9A 3GUCA 3PHJA 1TCVA 4KZPA 2VUUA 3RFXA 1B8NA 3G9QA 5IC5A 4K05A 5LD2B 2O52A 4GO1A 2HV9A 3IUPA 1HNXB 4KFTA 1U7XA 4KMRA 3ROEA 3ZD8A 4GYWA 2C4VA 2CL7X 3NKVA 3WRVA 4I6EA 5ITWA 3I0ZA 3U7IA 1IIBA 1MOZA 4MZXA 1TO2E 5IAAA 4EG5A 3ZHSA 4FW9A 5ADWA 1DZ3A 4E5MA 1KEWA 1SEPA 5CK5A 2XYRA 1JPNA 4BNJA 4Q16A 1N2HA 2OHJA 3G6WA 1QOQB 3RT1A 3K92A 3RANA 4KCGA 1EA7A 3ZNQA 3CNNA 4B4DA 2NOAA 4J2HA 3ZXSA 3GP5A 5JFOA 1ODFA 2XBLA 3TIVA 4QUHA 1IEVA 1WXEA 3ND6A 2C20A 2B8NA 2XR1A 3RHFA 3MRVA 4AUMA 1VL2A 2F67A 2JBAA 4C43A 2XZTA 2ZI6A 3ESQA 2CSUA 3CXUA 4G23A 3ZEAA 2QD5A 5HKAA 5JZOA 2OXFA 2AG5A 3UY4A 5L3SA 1SKYE 4WESB 3NV7A 5EKSA 3TOZA 2QRQA 5I51A 4KJZA 1UFKA 2HCBA 1IAQA 2WV7A 3F96A 4M7WA 4X54A 2C2WA 2GD6A 4TXJA 1VJTA 4HDMA 4FD2A 4N5HX 4OQFA 3IBYA 4Y1RB 4JQCA 3N2YA 3KJEA 4LY6A 4TSKA 2I3AA 3QU9A 1K5PA 5AKKA 2ZAIA 3WGLA 4MGHA 3ZI0A 2ZU0C 4HB4A 1V5EA 1DX4A 2P30A 2F8LA 4U4AA 1RJ9A 1U0EA 1EFCA 4D3XA 1YSCA 3PQ7A 3NIGB 2VHTA 3EF1A 4V0RA 4I2NA 2XECA 1T13A 4BMCA 3KAPA 3AF3A 1JWAB 2QSYA 3WYEA 2GCEA 3MUOA 3TWOA 3C6XA 3ZCRA 2UZ4A 1DAPA 3DZJA 4CPDA 3CKLA 4HXYA 4IILA 4UMFA 5T67A 4PYMA 3ZWPA 1JLLB 8ABPA 2I80A 4EW3A 4CXMA 2HT6A 3DZCA 3RUAA 4YAIA 3DSRA 3LQ4A 3HWX1 3SX0A 4A7PA 2H8GA 3FDIA 3PCTA 4DB4A 2PUJA 3LCRA 1L4BA 1YR8A 1Q2XA 2C3PA 2ZT7A 5DTIA 4BFYA 3LZCA 4M0KA 4TGLA 4G56A 3KLMX 2QRUA 1TQ8A 2V1XA 2YTZA 4BQSA 4JNKA 1OLUB 4CM5A 1CQPA 1J2YA 4AG3A 3QF4A 3P26A 1NE2A 4V02A 5DIZA 5C7LO 1JR3A 3LT5A 4RZ2A 1I30A 1G21E 1FRNA 5AK0A 3PJRA 3EPLA 3QUBA 1GXSB 2JJ2D 4MK4A 5BT8A 5JROA 4F85A 5ESDA 3QVVA 3EIXA 3OUTA 1L7NA 3IV9A 4JVMA 1ZWLA 5BSKA 3WFZA 3C97A 2J6HA 2XMZA 3B7GA 4KH1A 1N6KA 2CHVA 3VGPA 2NU8B 3QOWA 1C50A 1L8AA 4JSRA 1UXGA 2VDPB 1E9CA 1JLSA 4K8RB 1D2MA 1RRPA 4PO1A 2RAUA 5G0SA 3RIYA 5FEUA 2Z09A 1U6JA 4HPWA 4WZBB 1XPUA 3EZ7A 1CF2O 1F6BA 1L7DA 2VYCA 4G9BA 1G6Q1 3UXMA 2H92A 1ATZA 3NHZA 3H4TA 3L77A 3NHWA 1HSOA 4W99A 3IELA 1TIPA 1OBVA 2BF4A 2NTVA 3C7TA 2QX6A 3QOXA 4ZT6A 5IVDA 3ZQ4A 4BO4A 3AQIA 3QVGA 2G1UA 5IJ0A 2D0OB 3QWAA 4ZZ0A 2BE9A 2WF7A 2QP3A 3JWEA 2QF7A 4H3KB 1IWBB 1J21A 3L40A 2IXAA 1K6XA 4C06A 3LPDA 1KI1A 1L4EA 2Y2UA 3IAS1 2FSVC 3ILYA 3I8XA 3I9MA 4KNWA 4Z2AA 2G7MC 1ZN8A 1ID8A 1QRAA 2DHQA 4CG0A 1VI6A 1SXGA 3C3EA 5HF8A 4ACBA 4NBKA 4U5XA 1EBUA 4KJXA 5EGSA 3NTXA 4CM6A 1ILEA 4RJKA 3RC1A 3BK2A 4H15A 3GLIA 3L1KA 2MR6A 3DZDA 4URHA 1XZMA 3NIBA 1NW8A 4RJJA 1G291 1L1QA 1XVVA 1PJTA 1YS2X 3CW2A 1GR1A 4XH9B 2H2IA 3BTVA 3GFOA 3FTFA 3SBXA 2FFHA 2GAAA 2B4QA 3G8YA 5FIUA 1VLZA 3OCWA 5AIBA 1TYEB 1JHVA 3TJRA 4MARA 1SC3A 2P2GA 4E1BA 1SXJA 3EXFA 4YDSA 1N5KA 1L7BA 4LHWA 3E53A 5LOVA 2QTVB 4C0XA 1JR6A 4NAUA 2VBIA 1RTKA 1U4NA 2JASA 2JI7A 4F4DA 1P8AA 2NSDA 2XW6A 4HSGA 2Y76A 4HYQA 3ZXUB 3M89A 4DCPA 4YPOA 2F1OA 3VM6A 2VT7A 4JYPA 1XZNA 1QSGA 3SGLA 4MDHA 1G16A 3GLFB 2YMPA 2PQ0A 4BUZA 4BMDA 4TM7A 2OBMA 2ACKA 1RWQA 2QZ4A 3IHWA 4EHJA 2BBSA 1OILA 5JR3A 3ADPA 4DJDC 4PZEA 2XD4A 3PFCA 2EFHB 1M2VA 2AFRA 4KQJA 4WASA 4BASA 3LY5A 2ZQYA 3GLHE 4UVDA 5CDGA 4FNGA 2PPVA 2ZIFA 3D2AA 3PD0A 2HWUA 2GTIA 4WY2A 2PMDA 1QQTA 1QIEA 2Q45A 4CN8A 2JGLA 5EUCA 4YRKA 5JPCA 5CT5A 3V4LA 1TMKA 3NVMB 4IXNA 2ZITA 1RXCA 2VP2A 1NTOA 3T9AA 3UENA 1YRHA 3JVVA 4KGVA 4P7JA 2WD7A 5IUNC 2IHKA 4ZCIA 2IH5A 2I7CA 2P5SA 3GZNB 3HPRA 2AG0A 2I3DA 4J0JA 4HAIA 4OJTA 2GTHA 2BFFA 3I1IA 3WK8A 3ZG6A 4TZKA 4W9NC 5EP3A 5AJYA 2FSIA 1GRCA 2C1EA 5AK3A 2VK8A 5LWQA 3CLUC 3MCZA 4HZIA 3TLGA 2OM2A 4HFMA 2VPZA 2YZKA 3LYLA 4XEHA 4CM8B 1Y8QA 3OM9A 4C22A 2OHVA 1NIPA 5AT1A 1OIXA 1C80A 3PYLA 2CUNA 2PX5A 1P0IA 2HH9A 4TV8F 4MWGA 5DHAA 3WIUA 3PITA 3M1LA 4FU0A 3CGGA 5IHXA 2IX3A 3RNOA 1OYYA 1G8PA 1EG2A 5DM1A 2XMGA 4I1YA 1KOLA 3ZOKA 3N2GA 2VIIA 4A5OA 4F1JA 3JQAB 3SHQA 1IQPA 3KKPA 2VJBA 4I55A 3L4SO 4PLZA 2CMGA 5JQGA 2JA1A 4KWIA 4IDQA 3KEFA 4E94A 3AI2A 3A37A 3Q87B 4IMRA 3E9MA 3BBLA 1V43A 1KI9A 5HPYB 5DGHA 1I01A 3OZVA 5EJIA 1CYDA 1YQUA 4CG2A 5F98A 2P40A 4HH4A 4NARA 1YC2A 4YRLA 1YE5A 2OOKA 4YACA 1E3WA 5KJ1A 1KNXA 2IHVA 3GELA 4ILEA 3C8MA 3A11A 3HUEA 4U2DA 2CXUA 4K2AA 4WHMA 3KR9A 1DBIA 5DM0A 4JB0A 2WHXA 3PC2A 5K0TA 1Z36A 3DBIA 3E8XA 5ALNA 2BLNA 3AZOA 4MDFA 1DBRA 4KLNA 2FLKA 5L3QB 2AL7A 3GHYA 2R6R1 1K8ZB 2YY7A 4ERNA 3TMKA 1W75A 2F3UA 1FLAA 2R4TA 3LLVA 3HHPA 4JP2A 3PHCA 4UUPA 1E1RD 3IR5A 3O8DA 4CLRB 1T1IA 3OZSA 1BYIA 1WPGA 1JIVA 3JQFC 1QZ3A 4KYIB 5T4BA 2HRQA 1RPJA 1EUYA 1OV4A 1WVIA 4TTJA 1VIMA 1Y37A 3LHFA 2IW3A 5LIRA 4GOLD 4XWWA 1RHRA 4PZDA 1X1DA 4LV8B 2NU9B 1MIHA 3O4VA 3FHOA 1ENOA 5K9ZA 4UATA 1EFUA 4DWVA 4ENPA 2X14A 3AUKA 1JMYA 1UZAA 1DHRA 4J6FA 4KQGA 4P3KA 4YXWA 2NADA 3F78A 4EUEA 1AKNA 1Y8RA 2ZIAA 5KVSA 4WA8A 4EYOA 3OMLA 4MWBA 5ANRB 4QJ3A 1YOBA 1P1FA 1VCHA 1D2RA 2A8YA 2SICE 4KUGA 2NTEA 3HXMA 1I4WA 1I4DD 4L8GA 5KC8A 5G4KB 1MW9X 2XTZA 4M1SA 4QICA 2HF7A 1A9PA 2ZBDA 2FW8A 3ZLUA 1O8BA 2ZK7A 3ELUA 5CT9A 3DOJA 4RA9B 1N2CA 2E2WA 1UFRA 4JUAA 2DHRA 4YAJA 1EUDB 1PZFA 4YPFA 1TTTA 4TL7A 1GADO 1TEHA 4FQ7A 3ETNA 4OI2A 3UW3A 3LC0A 5LXTB 2C5FA 1W581 3JWHA 4V0KA 4WJZA 4ZO9A 1ICEA 3FDFA 1MP0A 3FMIA 2EL9A 3QPBA 4O2AB 1RXYA 2QV7A 4QDKA 1ZONA 5C37A 4QO8A 4EG4A 5CITA 5DK6A 2ZRHA 4RFLA 2RG1A 3KXPA 1J90A 1N6OA 2HU7A 4QXAA 3MWEB 4FYPA 3EEQA 5ALTA 2G72A 3ZGNA 3NYIA 3GJ6A 1E9DA 3EA0A 3LQQA 4JOBA 2GFHA 2OCGA 3O47A 3T5MA 4GKVA 1J97A 3M4YA 5T4HA 1P44A 4J91A 2PZKA 1IY8A 5FBZA 3SKYA 4DCVA 5FO0A 5THKA 2DUNA 3VAZA 2WJYA 4GVXA 3D2BA 2P7HA 2XNDD 4P98A 4BLSA 4QEDA 1RWMA 3PCXA 1O2DA 2F2TA 3MJEA 4C0WA 2ZPUA 3D7KA 3R6LA 5CBPB 1U0NA 5DM60 2R60A 3AM5A 2ANCA 2NXWA 3EQ8A 1AB5A 1JYEA 2YL2A 4F3NA 1JFFA 5L4SA 1CUWA 1A27A 2J09A 2NN3C 1QFSA 1UBTS 5M5BA 2ODWA 1A4UA 5KSPA 1T4DA 3CRZA 3MUEA 3HFJA 1BHQ1 4GZ5A 1AZWA 2XUIA 4YRJA 3L1VA 2X58A 3HBAA 5GJWC 5CXUA 5LQUA 2C0QA 4S0ZA 5KNBA 1G2OA 3T61A 4XRGA 4DCNA 2P9CA 2OUIA 2ZJ0A 1TO1E 3ZVLA 2G1AA 3MCUA 1TKAA 1UZMA 1XQYA 3WLEA 4B48A 3EXIA 2RH8A 1T8SA 1P2VA 2QVCA 3ENVA 3UMCA 1KJZA 3W7BA 3ANXA 3LUGA 4KRYA 3U3RA 4R31A 1JAHA 3L49A 2QRKA 1T9GS 3AINA 2YWRA 1VP9A 5K3FA 2PKCA 6NULA 1I2DA 1DCTA 1CF9A 3W5UA 3FVVA 4BVHA 1KK1A 2MSLA 3P9PA 1LTKA 2VTBB 1PG2A 2V6BA 4JHXA 3K1TA 1S1MA 2Y92A 2QI9F 1PFYA 3VR4D 1LV8A 1J5PA 3T7RA 5HM6A 2R4QA 2VWGA 1H4TA 3DVRX 1G21A 3AZPA 3EXHA 3GFGA 4WFKA 4XZ3A 1H2WA 5CXXA 3RVNA 2DWUA 1X74A 2PTGA 4BVGA 5A06A 3V80A 3I28A 3GP8A 3Q2IA 1T29A 1MEEA 4REOA 2FA9A 4NABA 5LIPA 1LBQA 2FU5C 4IZ6A 4XIGS 4IGEA 2P9BA 2BMEA 2P2CA 3GXOA 5FTMA 4DPKA 3OIYA 4IG9A 4LKOA 2I8CA 2GJKA 2ZS7A 2XWSA 5AI5A 5AMXA 3UJAA 3DPSA 3LQFA 3SFZA 1XDDA 4TQAA 1Q7GA 2J5QA 4YRRA 2EWWA 4DT1A 1FYVA 4LGYA 2GBCA 1NSTA 2GQ0A 2NUAA 3MS4A 2XH8A 3PRHA 1AF7A 3LPAA 3NOXA 3VDQA 1GWNA 1GARA 2O8EB 1DLJA 3B5EA 2ZANA 1J49A 2F7SA 2ZUDA 2YZ2A 3MQ4A 1MOSA 2Y05A 3RARA 4EZIA 4TS4A 2IXFA 3TQTA 4MI6A 3T06B 4Z9BA 3ZD6A 1IN4A 3I39X 1T0BA 4JWTA 1IBLB 3P5BA 1KIFA 1X2EA 1FC0A 2O59A 3R0XA 2CYBA 3BKWA 5BT9A 3KTAA 4MITA 2G5CA 1QU3A 2R84A 3HVJA 3FI9A 3FOAA 4M9QA 4CWAA 1TM2A 3BERA 3GBVA 3NDIA 5H81A 1Y7IA 4D9BA 5HIKA 2OMEA 3KOOA 2OAGA 3LHDA 4S2UA 3PQ3A 4UAGA 4LBZA 3IUEA 1IJKA 1CHNA 1GKKA 1NVEA 3VHXA 2FXIA 2RHBA 1I3NA 1OASA 3AUTA 5EP2A 1G4AE 2XB4A 3FX2A 3NHKA 4HJRA 2OB2A 4BWFB 4ZAVA 1LTQA 5T3YA 4LFAB 3I1JA 1BX3A 5D1HA 4GVLA 5JOQA 1HNZB 3WR5A 4FTWA 4GPZA 3A9CA 4UEQA 5I8PA 1IZ7A 2O7NA 2J7PD 4QJBA 4XB6B 3HCPA 4PZPA 3AETB 2YIJA 4PPFA 3U7FB 2J59A 2XYVA 3OLVA 4I4TB 4W7IA 1EU1A 2Y9PB 1ZJ6A 3PC6A 4M21A 3SPXA 3M2TA 1J0BA 4OQEA 1NXXA 3TKLA 1XRRA 1SKMA 4YBZA 1LDEA 5AUPB 2XOEA 1YTLA 4X64B 3K70D 3HJCA 4RZIA 4ESHA 1R0RE 1FK8A 2LW7A 5JCJD 1VGQA 5ELMA 5DBOA 4F3YA 3L8HA 4UFOA 1U99A 3P9ZA 1PQ4A 2DKOA 3WMFA 1OI2A 1V8DA 2Q5FA 3NBMA 3JSXA 1ZD5A 1SHLA 2BFBB 1E60A 5JECA 3W3ZB 4EBFA 1XD2B 5FUXA 2XMPA 3W4JA 4QRIA 2XHEA 2Z83A 1KK3A 4J7AA 1EWRA 1MNAA 2H4WA 3Q6NA 4IUDS 1U98A 1Y7HA 2X3FA 4MKIA 4WEQA 1NAHA 4OP1A 4JK3A 4RSHA 2RGWA 2P79A 1K6EA 2NZUG 4ZI7B 4QGGA 3WDMA 1MABB 3EH2A 3MHTA 3BTUA 1BCSB 3C8ZA 3GU3A 4M8LA 4PG5A 3GFFA 4B8YA 2J9XB 2QSUA 4L9AA 1R12A 1SH7A 3OU6A 3T5DA 4BOYA 1C2TA 4ZVSA 4AMVA 3CB2A 2IPOA 1T6XA 3ZHOA 4I4NA 5FR1A 4OVKA 3RVOA 3IJEB 4H7PA 4AFNA 3ML1A 1ORIA 1WMSA 5DNWA 5LNK6 2I66A 5IBPA 1BHJA 4UUBA 3P2EA 3A1TA 3QXJA 2Z6VA 3N75A 1H6BA 4U6SA 2JVJA 1JG6A 1WKVA 4E22A 4KRXA 5EIFA 2ZJ6A 1QYRA 1KS9A 2IE8A 4NENA 5G0VA 2AFHB 4DJTA 4TKVA 1MU0A 2PLWA 4UVHA 4DV0B 2NXJA 3NEJA 3PR3A 4M9CA 4FCCA 3A1UA 4OFZA 1Z0KA 5IH3A 3T5TA 1ZMBA 3U31A 2B61A 1FX0A 2OORA 4F9TA 5KX5B 3SHTA 3I64A 1DCMA 2QVLA 4UQPA 2A57A 1NVBA 2P69A 3NAZA 2HN9A 2XUDA 1YZHA 1E3LA 3VZCA 2WW8A 1ZITA 1JJ7A 1E94E 4AJ9A 3IAFA 1GZSA 2Z3ZA 3D3JA 1SURA 4Q1VA 4IIXA 4Y3UA 3MCVA 1JEAA 2PG3A 1HYBA 1WEHA 2JAPA 4UDXX 3P20A 1CC1S 1F2VA 5IZCA 5ER9A 3ZQ6A 2CV2A 4EG1A 1GPUA 3RRNA 3U4QB 1W34A 3KX2A 1MBZA 2D2EA 3TOCA 3DS8A 3WRWA 4FMPA 4BLUA 2AVNA 3T4EA 4KODA 4DUZB 1WA5A 3VH1A 3R4VA 3ITDA 2IUTA 2P4EA 3AKCA 5IAGA 4PX2A 4AZ3A 1IXYA 1CQWA 1O08A 3HKDA 3HLYA 4B6JA 2ATVA 2WF9A 3OJCA 3MBOA 1QLWA 1OLUA 1JQEA 5G0TA 3W3AH 1GTVA 4DPLA 2ZIUB 3U1TA 1PAUA 1J42A 4JUCA 2ZRKA 3TOVA 5HCIA 5E7QA 1Q22A 3THYB 2X19A 4BP8A 4JN6B 3NHUA 4Z4EA 2UYYA 2DQKA 4K28A 1VZ3A 3BRQA 3DTVA 3N58A 5HDQA 5BN5B 3SWWA 1R18A 3IE2A 2ZI9A 1T2NA 3Q98A 4HLQB 3ZHVA 1W36C 2I4RA 3UW1A 2PZGA 1X77A 1A04A 1K8QA 4PSAA 1PEYA 2JK0A 4YCJA 3QWBA 3RC2A 4RTOA 1SZDA 4II2A 3U3OA 2H1IA 3P19A 1V4VA 1T0IA 1T1RA 4R7ZA 4DRXA 1L5ZA 4UTPA 1II8B 4GPBA 4MYCA 3I4FA 1W0KA 2D5BA 1WCV1 4C0JA 2I7DA 4O6VA 2BSQA 4LK2A 1C4WA 4M89A 3SQOA 1EDZA 4OSOA 4QLAA 1BE8A 3OU7A 3FHLA 1E3TA 3KALA 4G4SO 3S7TA 1JIQA 4TQ9A 4M1EA 1YRWA 2G63A 2GEDA 2NO4A 1S96A 1XVAA 1D4OA 5CLFA 3K6SA 5KTPA 3SCZA 3IR7A 3E81A 3VU1A 4UHBA 1R5OA 4K3UA 3SR3A 1KGSA 1TYBE 1TZKA 3QYFA 2JFFA 4UHFA 4DLZA 1DJNA 2HDHA 3OY7A 4F2HA 3LUAA 2NU7B 4AULA 4JJEA 1GLNA 4EY8A 2CVOA 3CUYA 4UXJA 1A8QA 4H08A 1JEYA 3QKWA 2H1OA 4QPZA 1XRLA 3VI3B 3WK9A 1ILWA 2ZM5A 3I3SR 1KWKA 3R9IA 1WAMA 4M8IA 3G88A 3PQDA 5AW9A 1GV1A 4BCCA 2VWPA 2Y1DA 2XMDA 2Y6UA 4I1OA 4Z7JA 2J5KA 1G2PA 3NDBB 1X19A 2J9RA 4RIEA 2VT3A 3SOPA 3MB5A 3L4BC 4OLFA 2GVZC 3H8JA 3EPJA 3VH4A 1VYUA 4DRZA 2WSIA 3GUVA 3GUZA 4LF7B 3PLRA 2QTZA 2BC9A 1CIJA 5BSFA 2GS9A 4GM0A 3ZJYA 1M76A 1GPMA 2ZYVX 3KT0A 3PE4A 3RRYA 2BGIA 4B44A 4YJ2F 1U8EA 4GSYA 1D2GA 1LW6E 4D3DA 1DT5A 2ZRNA 1N6NA 3RYHB 1N4AA 2HTFA 3RTBA 4RSMA 3AHDA 3UMVA 4CV2A 2UZ3A 1M2VB 3DE7X 1FS4A 5COQA 4DMGA 5BR8B 3LKDA 5AI4A 5IM4A 4JI0B 5CW1A 4K0RA 2ONCA 2G3YA 2J48A 3PYXA 3TTTA 5JUWA 5F35A 2FSUA 2HWXA 1UBMS 2WA2A 4JKOA 1WSWA 3ONEA 5FL7A 1Q57A 3WMEA 1ZNZA 5MHTA 4OM8A 3NTLA 1GGFA 2NG1A 3P9NA 1BS9A 4ZYLA 1KZ1A 4MW4A 4DGSA 3HB1A 4B4KA 1IH8A 3FMFA 1B16A 2NPOA 5EWMA 1C1DA 4PC7A 4E2FA 3M5DA 3L0DA 3D7LA 2AA3A 3FCAA 3IIEA 4TLMB 1T0JB 5DNAA 2XXBA 4UE6A 2Z1NA 4WCDA 1SUAA 2FEPA 2XGMA 1H1LB 2BBTA 2IU3A 3H2ZA 4LMBA 4Y2JA 3UFXB 2J6BA 3QVOA 1NVUQ 2QVZX 2D5AA 3V32A 1QG4A 1E2IA 1L8XA 2GK7A 1S8OA 2R8BA 4QG7A 4MCIA 4IICA 4B6OA 1P77A 4OBBA 1KKUA 3GDHA 3QV2A 1UANA 4KQKA 4GHWA 4MVJA 1T4BA 3AR5A 5DHPA 3RIMA 2FW6A 3EA4A 4O0LA 2ETVA 4KLCA 1L7AA 2FMFA 3SY8A 3H5IA 1X7YA 4K6MA 1A7UA 1XA0A 3Q4GA 3AETA 2Q8QA 5AQ1A 3LS2A 3LYAA 3N5KA 3ZDYB 2IV2X 3T99A 1J22A 1CQZA 1QZZA 3VR3D 3G85A 1ZMTA 5HM8A 1CZUA 3AG5A 3I45A 4F5ZA 2FWIA 2H3EA 1RPNA 2JFQA 2QB5A 3ZIAA 4DIEA 1DIRA 1IN8A 3FG9A 5ALQA 2X77A 4FUQA 2WMNB 4HY3A 2YV1A 4D56A 1ETUA 3WXMA 4C20A 5M29A 4B3GA 3MELA 1C7IA 2QA5A 1C8KA 3MJHA 3DWEX 3OTQA 1XMOB 2C4NA 5D6OA 4G97A 4XUDA 4BATA 1WPXA 1LPPA 3FYDA 1N9ZA 5JVDB 1G18A 3HN2A 3BDVA 4A8JA 2ACWA 3L8DA 3HFRA 1ZK2A 2YXDA 2D3TA 4MV8A 4MRRA 1WDMA 1PE0A 3OT1B 5CA0F 4AJJA 1SO8A 4QYIB 1LI4A 2C2GA 2AQHA 3PFWO 4IAOA 1GNPA 1NFQA 2EZUA 2AOTB 5LXTF 3GI1A 5E2BA 4RSGA 1AN0A 1FYFA 4YJGB 3FFTA 1MQ9A 4P1ZA 5HQ3A 3LDHA 4MX8A 1NLYA 1BG6A 3H5VA 2MMGA 3E9NA 3WNCA 1NI4B 2TMKA 3C4JA 4XJVA 1M0SA 2B3TA 1E3SA 4JSYA 4NCNA 4R54A 2A14A 4UTZA 2I91A 1O0BA 2P0EA 2VNSA 3W5JA 2EQ5A 4P08A 3OQ6A 5K0EA 2BKXA 2KYRA 1MH1A 3SYMA 2HFKA 3OTGA 2QTRA 1C7RA 1MJGM 3ETJA 4G5YA 4JFRA 4CF5A 1JE0A 1CY8A 1V71A 3BIWA 3VC7A 2NYUA 1N2XA 2CMDA 2JGRA 2YXPX 1IPFA 5D3QA 1NUPA 4CKEA 1O97C 4PC6A 5J1TB 1E1DA 1J7KA 2R1VA 5HUJA 1Q1ZA 3PP8A 3U49A 1DHTA 4YGYA 4B2YA 3IALA 1XRNA 1GPAA 1YL5A 2VPXA 3O26A 4C30A 4FZRA 5K8VA 3HVIA 2XE4A 4AKIA 3JWIA 4EKIA 2CUZA 3L05A 4CMIB 2XB2A 2DWPA 3PGXA 2XDWA 3QA9A 2CV0A 5J58A 4NAHA 5AHWA 5L7YA 3DTNA 2FEWB 4F12A 3E5NA 2PGOA 1R2QA 4LC9A 1SMKA 1ZUHA 2DBRA 4GUDA 4V1CA 3L0OA 1LXCA 1W8IA 2B2CA 1TLLA 1DKUA 4KC0A 4OJQA 2VQ6A 3G2QA 1G20E 3C8DA 1Z26A 1JHUA 1UC5B 3O4FA 1AHNA 3B6MA 3OFSA 1QF6A 4EVSA 3T9BA 1G8GA 1R0ZA 1RZ3A 4J29A 1ODCA 3TSYA 1I36A 4BKUA 2ZRMA 2OFWA 4BAZA 2IZ5A 4F45A 3E9ZA 1DV2A 2Z58A 3HB4X 3LFHA 1KOJA 2ZUWA 3PA6A 1RHJA 3AZQA 3FNBA 4EG6A 4QG3A 3MJVA 4EQ6A 3S40A 2WU1A 4MEAA 1QYVA 1N1DA 1NUQA 3FNQA 4PR3A 5CLHA 4CIXA 2P4SA 4D6YA 1BMFA 4TLCA 4UUQA 4WNIA 4KPFC 4WE3A 5A62A 4WZBE 1TK3A 4M60A 3W9UA 4AP9A 4ECEA 3P2JA 3PGVA 4B79A 4N6NA 3N39C 4R1MA 1ENPA 4E07A 4PHHA 2KQUA 4PIVA 4J90A 5KWIA 4MPJA 1QHFA 2HMYB 3LYHA 4L85A 2WLSA 4FDVA 3IUJA 1OBHA 5JW6A 4CIAA 4MOWA 3GFRA 4DDUA 1NRXA 1CEEA 1F1BA 1XTJA 1H6CA 1WZUA 3W04A 2AC7A 4JLBA 3HC7A 2ATEA 2VH5R 1YBAA 4Y67A 5TS3A 4TVBA 4CL2A 4EO9A 1JU9A 4UNQA 3D02A 4DR1B 3FGOA 1L1EA 1T2CA 1QG2A 1JEDA 4WA7A 1KYTA 4JLPA 4PLTA 3W9YA 3Q6MA 3BSSA 3UF0A 2AK2A 4ND2A 5JE8A 5BVGB 3OY2A 5DTQA 4MS3A 2BI8A 3LBNA 1PW5A 5D2CA 1BQ3A 3FN4A 3K72B 4WKBA 4R4JA 2B30A 1YDEA 2CZGA 2P1ZA 1Z83A 3GVCA 3P27A 5EJ2A 1NVVR 1FFGA 3UV6A 1EUCB 4J16A 3W8FA 4BJ3A 3EVZA 3L7AA 4LHSA 1QTNA 5DRYA 2X2FA 4URXR 5JXWA 4URWR 1SXQA 2OT3B 2OXIA 1O96B 4DS3A 1IZZA 1P5RA 1U9IA 4RHFA 1L5WA 5JD5A 4RS4A 5LU8A 2VBGA 1F14A 2EKDA 2IHYA 2X3UA 4MR9A 2VJAA 3CZ4A 4E5VA 4Q7QA 4NXNB 1JDTA 2J9ZB 1OX4A 4KSBA 3KSAC 3QITA 2C5HA 1NNEA 2BMFA 1Y5NA 3DVLA 2WUVA 3OAAD 3LUHA 3DTTA 2I9KA 2V7VA 2WSSD 3OZRA 5J59A 5KTYA 2QDXA 2FRVA 3BFVA 3FWNA 5TQ0B 3E1SA 4BC0A 3HL4A 1ANKA 1DCFA 4G0QA 1AQIA 4WLEA 1II0A 2KMLA 1R6TA 3ODGA 4Q82A 3SC2A 4ZICA 4XM0A 1OF1A 2P6RA 2PBFA 1A5SB 1DC8A 2VG8A 3I2FA 4IGIA 4WCFC 3PQ4A 1Z08A 2NACA 4S1WA 4ENRA 4RKQA 1TAQA 2JFWA 2I2DA 3CEPB 4GR4A 3L8GA 1XQ1A 3ZGYA 3B3AA 4FB5A 2ODBA 3THXA 4OUKX 1NMQA 2UXCB 4G5SA 3D6NB 4V3BA 5HOEA 4RTSA 2FWMX 2E87A 4EW1A 5AW6A 1LSJA 5I45A 2VTVA 1AA9A 1W1IA 1JGTA 5CP8A 3CVOA 3U3KA 1Q91A 2MYPA 2V9PA 1XXHA 1K2VN 3L5KA 4N7MA 4XSHA 1X7DA 4M0MA 1PT5A 2O2EA 3ND9A 5ADUS 3TB4A 1RPAA 2RMKA 5CCBA 1FVXA 5DBFA 4TT3D 4ZI7F 2OVFA 1XT6A 1PSZA 1W93A 2OD7A 5JNVA 2CE2X 3DXXA 1OYOA 5IK2D 2P0AA 4AO7A 1ZR4A 1CZHA 1YJAA 2Q4EA 1LRLA 4RDHA 1RJEA 1PJCA 3WIVA 3C5VA 4RKEA 2CLKB 2I8AA 4MINA 4UEOA 2FH5B 1QG6A 4FLFA 2BY4A 5ICEA 4CQMD 1YS7A 2PCLA 2Z1MA 4N3CA 2FRDC 2AHOA 4YA6A 2ABWA 2ZJ4A 1U3GA 3AEYA 3N6RA 3TW8A 2GM9A 2CVFA 3DCYA 4E3ZA 5L3ZA 4DXDA 1ODSA 2AOXA 3FNGA 1SJ9A 3DNPA 3M3HA 3E58A 1TCCA 3Q7PA 4X3CA 3RBAA 2NO0A 3BGVA 2BGNA 4K6HA 4PYRA 5TX7A 2Q3LA 1QS0A 3TM4A 4DSNA 5CCEA 3PNPA 1V9CA 4A2CA 2ADFA 2WHRA 1M72A 1WW8A 2QORA 3TN7A 4HCJA 1XZPA 2CJFA 3NLLA 4MQUA 5EPOA 3V4FA 5CA1F 3U61B 1N33B 4E09A 2BM1A 2FQQA 3PRYA 4OHOA 2CFRA 3Q72A 4ALKA 4BGEA 1CX9B 3IV6A 4P34A 1SCJA 2EJTA 3JATB 3KV3O 5F2KA 3STYA 3BL8A 4B84A 3B1JA 4DGQA 4ZCRA 3R0IA 4DR6B 3K09A 1Z07A 4OH1A 1JI3A 4KAFA 3ZE0B 3IP8A 4L4YA 1DUIA 1QH1A 3TQQA 5BPHA 2XRMA 5F1OA 2RIRA 4JY7A 3LCUA 1HEUA 3A1DA 3RUCA 4B7XA 4E31A 3RSFA 4YP6A 3TNFA 3NC4A 4YRQA 1FSZA 1SOWA 1AS0A 1E1YA 1X2BA 4FWIB 5EHQA 2R7NA 1M34A 2EVWX 4RCVA 3GFVA 3GBPA 1PWXA 4N47A 3BMCB 3VR5D 5SZHB 4FKBA 2LCIA 1DQYA 3F71A 1A2KC 3PS9A 4CU5A 2C92A 1Z4OA 4PVCA 3VO8A 2GZ1A 3UJ6A 4PYQA 5K4AA 1W5TA 2X9VA 1WM1A 3Q8LA 3ZDBA 1TKCA 2VDWA 4WERA 4P32A 1A7JA 4BNKA 2XPCA 5EL0A 1I4LD 2XMQA 3PFIA 1M7HA 4PSCA 3SNKA 4RY9A 1TJ5A 3K7EA 5EMHA 4EEXA 2DQ4A 1INLA 1QAMA 1Z6ZA 4P5EA 4LF9B 7MDHA 4MVXA 1D8TA 3E9QA 3VPGA 2I87A 4R51A 1A7KA 4FDAA 4NJMA 3VHQA 1RW4A 3TAUA 4EI8A 3CVUA 3I4CA 1E1NA 1ULBA 2REXB 3RDPA 1E3MA 5IAJA 4UOEA 4EB6B 3WYDA 1S7CA 4HI0E 3QH4A 2DECA 3JQDA 3QEMB 2QG9A 4IHKA 3SIXA 1LEHA 1KY5A 1ZXBA 1MVOA 3CNLA 2ZBUA 1WUYA 2PX4A 2A3RA 3PUZA 4LYAA 4XQ9A 5H7XA 5JSKA 5JAMA 5H5JA 4DLKA 1SBTA 4IWXA 4B4OA 3OH8A 2QXUA 2XOKA 3SMVA 1JN0A 4H59A 2CHGA 4MIYA 3LCVB 1KK2A 4P80A 1UPXA 1KZGB 3D5QA 1ADGA 1FVFA 1F60A 2HRRA 4P36A 1KYWA 3MOIA 4RY8A 3ZXXA 4HYTA 4QGBA 5BXYA 3HZOA 4XLTA 2QYHA 4WD3A 4Y2GA 4GQAA 1ZD3A 2G77B 1ZK4A 5FWYB 4JCCA 1BEEA 4X91A 3QUTA 2P91A 4I66A 4PF1A 5JDCC 5BSEA 1Y98A 2OD2A 1RZRA 3VR6H 3VJRA 1QGED 1PKXA 2WTAA 4QBGB 3F6CA 5HFNA 3VH3A 4KE9A 4YYZA 3UWPA 5LXTA 4F4JA 5FWAA 3X2SA 2WD7B 3ZLVA 3P97A 4FDUA 2ZTLA 4H77A 3OQOA 1WY7A 2QW1A 4OAPA 4I4LA 5JDIC 2WWGA 4FYJA 1SK9A 2IUFA 1O97D 5ES3A 1ZH0A 3KBBA 3MQFA 1Z8DA 5I9TA 3UJ9A 5JIBA 2RD2A 1ADFA 4FR2A 4V1CB 1GGNA 3FHJA 3PFKA 1ZVQA 4MPDA 1GJRA 2P2SA 4WK0B 1EWYA 3NBFA 5E8JA 5FBKA 4X90A 4JP1A 4MQMA 5BRAA 4OMFG 4DLXA 2G5TA 4TWIA 4RXMA 2G9RA 2ZI7A 1VIDA 4YC7A 3TR6A 1ABFA 3VQTA 1VHTA 2QTHA 1X42A 4PYLA 3F9RA 1RJWA 2ATIA 3H1TA 5EKTA 5TQ2B 3RTAA