1E8BA

Solution structure of 6f11f22f2, a compact three-module fragment of the gelatin-binding domain of human fibronectin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
160
structure length
160
Chain Sequence
b'YGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALCHFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRONECTIN
publication title The Hairpin Structure of the (6)F1(1)F2(2)F2 Fragment from Human Fibronectin Enhances Gelatin Binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 14
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2000-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00039 fn1 Fibronectin type I domain
A PF00040 fn2 Fibronectin type II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1e8bA03
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1e8bA02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1e8bA01
1OK2A 2BZMA 1OK1A 4LOTA 1OK3A 3TVJA 1FBRA 2IZ3A 4IGDA 1Q3XA 5FO8C 4MUCA 2KMSA 2YRAA 2RKYA 1GPZA 4PZ5A 3RJ3D 4AYEA 1C1ZA 2RL0A 1HFIA 1G4FA 1TPGA 2CG7A 1H04P 4K12A 1HCCA 4CSYA 1L6JA 1EAKA 1OJVA 4YNXA 2MCZA 1H2QP 2V8EA 1E8BA 1MD8A 4F4OC 2FN2A 3KXVA 5HYUB 3M7PA 2B5ID 3ZD2A 3CALA 1HFHA 2EHFA 4WJG2 4LOSA 3L89M 3MQLA 2MCYA 3OEDC 3NFPI 4AYDA 2JRAA 2LOJA 1OK9A 3ZRZA 4AYMA 5HYPA 1E5GA 1NWVA 1PDCA 1O9AA 2JGXA 2XRDA 2RKZA 3IX0A 2KRIA 1OJYA 5I0QB 1H2PP 2IZ4A 2G7IA 5HZPB 2UWNA 1PPQA 3SW0X 1CK7A 2O39C 1QUBA 3GOVA 1QO6A 1G4GA 2XQWC 1H03P 3OP8A 2W81A 4C16A 1CKLA 4KKDA 5HYTB 3T5OA 1GHQB 1TPMA 2YBYA 2XWBF 1ELVA 3KZJA 3R62A 4B2SA 2V5OA 4JHSA 3EJHA 4J38B 4DJZA 1SRZA 2XRBA 1TPNA 2WIIC 5JPMG 3IU3I 2ERJA 1J7MA 1SS2A 1VVDA 4B2RA 4ZH1D 1GKNA 2JGWA 2XWJI 2RLPA 2QY0A 3ERBA 2EC3A 2A55A 2W80A 3INBC 3OXUD 1VVCA 4A5WB 1E88A 1LY2A 1MD7A 4FXGG 1QGBA 4AYIA 2RLQA 4ONTD 1H8PA 3ZD1A 3GXEA 1ZJKA 1U5MA 1CXWA 1Z92B 1OJWA 1UOTP 3O8EB 2CG6A 1KS0A 1GKGA 1GXDA 2CKUA
chains in the Genus database with same CATH superfamily
4YNXA 1OK2A 1GOIA 2BZMA 3WD4A 4MB4A 1OK1A 4IBKA 3L28A 2XD1A 1FBRA 1OK3A 4LOTA 2UWXA 2Y2KA 3L29A 3TVJA 2Y8SA 4MB5A 1YU2A 2IZ3A 4IGDA 1Q3XA 3K3TA 5FO8C 4MUCA 2KMSA 2YRAA 2RKYA 1GPZA 4PZ5A 1UR8A 3RJ3D 1C1ZA 2RL0A 1HFIA 4AYEA 1G4FA 1TPGA 4TX8A 2CG7A 4HMEA 1H04P 4MB3A 2Y2MA 4K12A 1HCCA 4CSYA 3L26A 1L6JA 1EAKA 2Y2GA 1OJVA 1H2QP 2MCZA 2V8EA 1E8BA 4Z2JA 4NYUA 1MD8A 3FGRA 3N3FA 5DN4A 1ED7A 3WSYA 4NZ4A 4F4OC 2IOUA 2XD5A 3WD1A 2FN2A 2Y2OA 2JCHA 3KXVA 1OGBA 5HYUB 3M7PA 2B5ID 3ZD2A 2Y2LA 2Y2JA 1UR9A 3CALA 1HFHA 2EHFA 2I2LA 4WJG2 4LOSA 4PO7A 2Y8RA 4IBEA 4IBGA 3L89M 3MQLA 2MCYA 1W1PA 2X2ZA 3OEDC 3NFPI 3FGTA 4NZ5A 4AYDA 2JRAA 2LOJA 1OGGA 2Y2HA 1E15A 1OK9A 5BPVA 4NYYA 3ZRZA 4AYMA 1E6ZA 5HYPA 1YU4A 1E6NA 2Y2QA 4IBCA 2Y2PA 4Z2LA 2JE5A 3WD0A 1E5GA 1NWVA 1PDCA 1O9AA 4GHLA 2JGXA 3F6KA 2XRDA 4NZ3A 2RKZA 4NY2A 3IX0A 2KRIA 1OJYA 1H0GA 5I0QB 1H2PP 3L27A 2IZ4A 4N7EA 2G7IA 4NZ1A 5HZPB 2UWNA 4LG2A 1PPQA 3SW0X 2BG1A 4IBFA 1CK7A 1YU1A 2O39C 3L25A 1QUBA 3GOVA 1W1YA 1QO6A 1G4GA 4OJLA 2XQWC 4IBJA 2FFFB 1E6PA 3L2AA 4MSLA 1H03P 3OP8A 4GHAA 2W81A 3WSXA 1CKLA 4OJOA 4C16A 4OUIA 4KKDA 5HYTB 3T5OA 4BWCA 1GHQB 1TPMA 2YBYA 4B2RA 2XWBF 1ELVA 3KZJA 2Y2NA 3R62A 1YU3A 3KS4A 4B2SA 4Z2KA 2V5OA 2Y8TA 3ZLEA 4HMCA 4JHSA 4Z2GA 1E6RA 3EJHA 4J38B 4DJZA 1SRZA 3WD3A 1TPNA 2WIIC 2XRBA 1O6IA 3IU3I 4YIZA 5JPMG 1W1TA 2Y2IA 4OJPA 1J7MA 1SS2A 1VVDA 1RLHA 1AIWA 2ERJA 4IJEA 3NJAA 4IBDA 1YUEA 1W1VA 2JGWA 3CI0J 1GKNA 2XWJI 4ZH1D 2RLPA 1H0IA 1GPFA 2QY0A 3ERBA 4IBBA 2EC3A 3WX7A 3HONA 2A55A 2W80A 3INBC 4HMDA 3KS8A 4Z2HA 3OXUD 1VVCA 4A5WB 1E88A 4Z2IA 1LY2A 1MD7A 3FKEA 1YU0A 1QGBA 4FXGG 2RTSA 3HSHA 4AYIA 3VWOA 2RLQA 4ONTD 2D49A 1H8PA 3ZD1A 3GXEA 4GH9A 4IJFA 4OJ6A 4IBIA 3WD2A 1CXWA 1OJWA 1U5MA 1Z92B 1ZJKA 1UOTP 3O8EB 2CG6A 2ZYCA 1KS0A 4OJ5A 4QNLA 5DN5A 3ZLDA 1GKGA 1GXDA 4APLA 2CKUA
chains in the Genus database with same CATH topology
1OK2A 2BZMA 1OK1A 4LOTA 1OK3A 3TVJA 1FBRA 2IZ3A 4IGDA 1Q3XA 5FO8C 4MUCA 2KMSA 2YRAA 2RKYA 1GPZA 4PZ5A 3RJ3D 4AYEA 1C1ZA 2RL0A 1HFIA 1G4FA 1TPGA 2CG7A 1H04P 4K12A 1HCCA 4CSYA 1L6JA 1EAKA 1OJVA 4YNXA 2MCZA 1H2QP 2V8EA 1E8BA 1MD8A 4F4OC 2FN2A 3KXVA 5HYUB 3M7PA 2B5ID 3ZD2A 3CALA 1HFHA 2EHFA 4WJG2 4LOSA 3L89M 3MQLA 2MCYA 3OEDC 3NFPI 4AYDA 2JRAA 2LOJA 1OK9A 3ZRZA 4AYMA 5HYPA 1E5GA 1NWVA 1PDCA 1O9AA 2JGXA 2XRDA 2RKZA 3IX0A 2KRIA 1OJYA 5I0QB 1H2PP 2IZ4A 2G7IA 5HZPB 2UWNA 1PPQA 3SW0X 1CK7A 2O39C 1QUBA 3GOVA 1QO6A 1G4GA 2XQWC 1H03P 3OP8A 2W81A 4C16A 1CKLA 4KKDA 5HYTB 3T5OA 1GHQB 1TPMA 2YBYA 2XWBF 1ELVA 3KZJA 3R62A 4B2SA 2V5OA 4JHSA 3EJHA 4J38B 4DJZA 1SRZA 2XRBA 1TPNA 2WIIC 5JPMG 3IU3I 2ERJA 1J7MA 1SS2A 1VVDA 4B2RA 4ZH1D 1GKNA 2JGWA 2XWJI 2RLPA 2QY0A 3ERBA 2EC3A 2A55A 2W80A 3INBC 3OXUD 1VVCA 4A5WB 1E88A 1LY2A 1MD7A 4FXGG 1QGBA 4AYIA 2RLQA 4ONTD 1H8PA 3ZD1A 3GXEA 1ZJKA 1U5MA 1CXWA 1Z92B 1OJWA 1UOTP 3O8EB 2CG6A 1KS0A 1GKGA 1GXDA 2CKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OK2 A;  2BZM A;  1OK1 A;  4LOT A;  1OK3 A;  3TVJ A;  1FBR A;  2IZ3 A;  4IGD A;  1Q3X A;  5FO8 C;  4MUC A;  2KMS A;  2YRA A;  2RKY A;  1GPZ A;  4PZ5 A;  3RJ3 D;  4AYE A;  1C1Z A;  2RL0 A;  1HFI A;  1G4F A;  1TPG A;  2CG7 A;  1H04 P;  4K12 A;  1HCC A;  4CSY A;  1L6J A;  1EAK A;  1OJV A;  4YNX A;  2MCZ A;  1H2Q P;  2V8E A;  1E8B A;  1MD8 A;  4F4O C;  2FN2 A;  3KXV A;  5HYU B;  3M7P A;  2B5I D;  3ZD2 A;  3CAL A;  1HFH A;  2EHF A;  4WJG 2;  4LOS A;  3L89 M;  3MQL A;  2MCY A;  3OED C;  3NFP I;  4AYD A;  2JRA A;  2LOJ A;  1OK9 A;  3ZRZ A;  4AYM A;  5HYP A;  1E5G A;  1NWV A;  1PDC A;  1O9A A;  2JGX A;  2XRD A;  2RKZ A;  3IX0 A;  2KRI A;  1OJY A;  5I0Q B;  1H2P P;  2IZ4 A;  2G7I A;  5HZP B;  2UWN A;  1PPQ A;  3SW0 X;  1CK7 A;  2O39 C;  1QUB A;  3GOV A;  1QO6 A;  1G4G A;  2XQW C;  1H03 P;  3OP8 A;  2W81 A;  4C16 A;  1CKL A;  4KKD A;  5HYT B;  3T5O A;  1GHQ B;  1TPM A;  2YBY A;  2XWB F;  1ELV A;  3KZJ A;  3R62 A;  4B2S A;  2V5O A;  4JHS A;  3EJH A;  4J38 B;  4DJZ A;  1SRZ A;  2XRB A;  1TPN A;  2WII C;  5JPM G;  3IU3 I;  2ERJ A;  1J7M A;  1SS2 A;  1VVD A;  4B2R A;  4ZH1 D;  1GKN A;  2JGW A;  2XWJ I;  2RLP A;  2QY0 A;  3ERB A;  2EC3 A;  2A55 A;  2W80 A;  3INB C;  3OXU D;  1VVC A;  4A5W B;  1E88 A;  1LY2 A;  1MD7 A;  4FXG G;  1QGB A;  4AYI A;  2RLQ A;  4ONT D;  1H8P A;  3ZD1 A;  3GXE A;  1ZJK A;  1U5M A;  1CXW A;  1Z92 B;  1OJW A;  1UOT P;  3O8E B;  2CG6 A;  1KS0 A;  1GKG A;  1GXD A;  2CKU A; 
#chains in the Genus database with same CATH topology
 4YNX A;  1OK2 A;  1GOI A;  2BZM A;  3WD4 A;  4MB4 A;  1OK1 A;  4IBK A;  3L28 A;  2XD1 A;  1FBR A;  1OK3 A;  4LOT A;  2UWX A;  2Y2K A;  3L29 A;  3TVJ A;  2Y8S A;  4MB5 A;  1YU2 A;  2IZ3 A;  4IGD A;  1Q3X A;  3K3T A;  5FO8 C;  4MUC A;  2KMS A;  2YRA A;  2RKY A;  1GPZ A;  4PZ5 A;  1UR8 A;  3RJ3 D;  1C1Z A;  2RL0 A;  1HFI A;  4AYE A;  1G4F A;  1TPG A;  4TX8 A;  2CG7 A;  4HME A;  1H04 P;  4MB3 A;  2Y2M A;  4K12 A;  1HCC A;  4CSY A;  3L26 A;  1L6J A;  1EAK A;  2Y2G A;  1OJV A;  1H2Q P;  2MCZ A;  2V8E A;  1E8B A;  4Z2J A;  4NYU A;  1MD8 A;  3FGR A;  3N3F A;  5DN4 A;  1ED7 A;  3WSY A;  4NZ4 A;  4F4O C;  2IOU A;  2XD5 A;  3WD1 A;  2FN2 A;  2Y2O A;  2JCH A;  3KXV A;  1OGB A;  5HYU B;  3M7P A;  2B5I D;  3ZD2 A;  2Y2L A;  2Y2J A;  1UR9 A;  3CAL A;  1HFH A;  2EHF A;  2I2L A;  4WJG 2;  4LOS A;  4PO7 A;  2Y8R A;  4IBE A;  4IBG A;  3L89 M;  3MQL A;  2MCY A;  1W1P A;  2X2Z A;  3OED C;  3NFP I;  3FGT A;  4NZ5 A;  4AYD A;  2JRA A;  2LOJ A;  1OGG A;  2Y2H A;  1E15 A;  1OK9 A;  5BPV A;  4NYY A;  3ZRZ A;  4AYM A;  1E6Z A;  5HYP A;  1YU4 A;  1E6N A;  2Y2Q A;  4IBC A;  2Y2P A;  4Z2L A;  2JE5 A;  3WD0 A;  1E5G A;  1NWV A;  1PDC A;  1O9A A;  4GHL A;  2JGX A;  3F6K A;  2XRD A;  4NZ3 A;  2RKZ A;  4NY2 A;  3IX0 A;  2KRI A;  1OJY A;  1H0G A;  5I0Q B;  1H2P P;  3L27 A;  2IZ4 A;  4N7E A;  2G7I A;  4NZ1 A;  5HZP B;  2UWN A;  4LG2 A;  1PPQ A;  3SW0 X;  2BG1 A;  4IBF A;  1CK7 A;  1YU1 A;  2O39 C;  3L25 A;  1QUB A;  3GOV A;  1W1Y A;  1QO6 A;  1G4G A;  4OJL A;  2XQW C;  4IBJ A;  2FFF B;  1E6P A;  3L2A A;  4MSL A;  1H03 P;  3OP8 A;  4GHA A;  2W81 A;  3WSX A;  1CKL A;  4OJO A;  4C16 A;  4OUI A;  4KKD A;  5HYT B;  3T5O A;  4BWC A;  1GHQ B;  1TPM A;  2YBY A;  4B2R A;  2XWB F;  1ELV A;  3KZJ A;  2Y2N A;  3R62 A;  1YU3 A;  3KS4 A;  4B2S A;  4Z2K A;  2V5O A;  2Y8T A;  3ZLE A;  4HMC A;  4JHS A;  4Z2G A;  1E6R A;  3EJH A;  4J38 B;  4DJZ A;  1SRZ A;  3WD3 A;  1TPN A;  2WII C;  2XRB A;  1O6I A;  3IU3 I;  4YIZ A;  5JPM G;  1W1T A;  2Y2I A;  4OJP A;  1J7M A;  1SS2 A;  1VVD A;  1RLH A;  1AIW A;  2ERJ A;  4IJE A;  3NJA A;  4IBD A;  1YUE A;  1W1V A;  2JGW A;  3CI0 J;  1GKN A;  2XWJ I;  4ZH1 D;  2RLP A;  1H0I A;  1GPF A;  2QY0 A;  3ERB A;  4IBB A;  2EC3 A;  3WX7 A;  3HON A;  2A55 A;  2W80 A;  3INB C;  4HMD A;  3KS8 A;  4Z2H A;  3OXU D;  1VVC A;  4A5W B;  1E88 A;  4Z2I A;  1LY2 A;  1MD7 A;  3FKE A;  1YU0 A;  1QGB A;  4FXG G;  2RTS A;  3HSH A;  4AYI A;  3VWO A;  2RLQ A;  4ONT D;  2D49 A;  1H8P A;  3ZD1 A;  3GXE A;  4GH9 A;  4IJF A;  4OJ6 A;  4IBI A;  3WD2 A;  1CXW A;  1OJW A;  1U5M A;  1Z92 B;  1ZJK A;  1UOT P;  3O8E B;  2CG6 A;  2ZYC A;  1KS0 A;  4OJ5 A;  4QNL A;  5DN5 A;  3ZLD A;  1GKG A;  1GXD A;  4APL A;  2CKU A; 
#chains in the Genus database with same CATH homology
 1OK2 A;  2BZM A;  1OK1 A;  4LOT A;  1OK3 A;  3TVJ A;  1FBR A;  2IZ3 A;  4IGD A;  1Q3X A;  5FO8 C;  4MUC A;  2KMS A;  2YRA A;  2RKY A;  1GPZ A;  4PZ5 A;  3RJ3 D;  4AYE A;  1C1Z A;  2RL0 A;  1HFI A;  1G4F A;  1TPG A;  2CG7 A;  1H04 P;  4K12 A;  1HCC A;  4CSY A;  1L6J A;  1EAK A;  1OJV A;  4YNX A;  2MCZ A;  1H2Q P;  2V8E A;  1E8B A;  1MD8 A;  4F4O C;  2FN2 A;  3KXV A;  5HYU B;  3M7P A;  2B5I D;  3ZD2 A;  3CAL A;  1HFH A;  2EHF A;  4WJG 2;  4LOS A;  3L89 M;  3MQL A;  2MCY A;  3OED C;  3NFP I;  4AYD A;  2JRA A;  2LOJ A;  1OK9 A;  3ZRZ A;  4AYM A;  5HYP A;  1E5G A;  1NWV A;  1PDC A;  1O9A A;  2JGX A;  2XRD A;  2RKZ A;  3IX0 A;  2KRI A;  1OJY A;  5I0Q B;  1H2P P;  2IZ4 A;  2G7I A;  5HZP B;  2UWN A;  1PPQ A;  3SW0 X;  1CK7 A;  2O39 C;  1QUB A;  3GOV A;  1QO6 A;  1G4G A;  2XQW C;  1H03 P;  3OP8 A;  2W81 A;  4C16 A;  1CKL A;  4KKD A;  5HYT B;  3T5O A;  1GHQ B;  1TPM A;  2YBY A;  2XWB F;  1ELV A;  3KZJ A;  3R62 A;  4B2S A;  2V5O A;  4JHS A;  3EJH A;  4J38 B;  4DJZ A;  1SRZ A;  2XRB A;  1TPN A;  2WII C;  5JPM G;  3IU3 I;  2ERJ A;  1J7M A;  1SS2 A;  1VVD A;  4B2R A;  4ZH1 D;  1GKN A;  2JGW A;  2XWJ I;  2RLP A;  2QY0 A;  3ERB A;  2EC3 A;  2A55 A;  2W80 A;  3INB C;  3OXU D;  1VVC A;  4A5W B;  1E88 A;  1LY2 A;  1MD7 A;  4FXG G;  1QGB A;  4AYI A;  2RLQ A;  4ONT D;  1H8P A;  3ZD1 A;  3GXE A;  1ZJK A;  1U5M A;  1CXW A;  1Z92 B;  1OJW A;  1UOT P;  3O8E B;  2CG6 A;  1KS0 A;  1GKG A;  1GXD A;  2CKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...