1E8BA

Solution structure of 6f11f22f2, a compact three-module fragment of the gelatin-binding domain of human fibronectin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
160
structure length
160
Chain Sequence
YGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALCHFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRONECTIN
publication title The Hairpin Structure of the (6)F1(1)F2(2)F2 Fragment from Human Fibronectin Enhances Gelatin Binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 14
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2000-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00039 fn1 Fibronectin type I domain
A PF00040 fn2 Fibronectin type II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1e8bA03
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1e8bA02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1e8bA01
2W81A 4J38B 2RKZA 1E88A 1OK2A 2CKUA 3EJHA 1E5GA 1G4FA 1OK1A 2QY0A 1TPGA 3GXEA 1HFHA 2KRIA 1QO6A 3RJ3D 2RLPA 4JHSA 2JGXA 2RKYA 1GKGA 1H2QP 3OXUD 1FBRA 2YRAA 1HCCA 3IX0A 4K12A 3TVJA 3OP8A 2B5ID 1O9AA 4MUCA 4CSYA 2RL0A 3SW0X 4B2RA 4AYDA 4FXGG 1Z92B 1GPZA 5I0QB 2MCYA 3L89M 4WJG2 4AYMA 2V8EA 2UWNA 4KKDA 1MD7A 2EHFA 1SS2A 2MCZA 1CKLA 2RLQA 1EAKA 3INBC 1QUBA 4F4OC 2ERJA 1OK9A 3R62A 1GKNA 2EC3A 5HZPB 1E8BA 1OJYA 4ONTD 1OJVA 1GHQB 2XRBA 3KZJA 3O8EB 1OJWA 3IU3I 1H2PP 4A5WB 1H8PA 1G4GA 1NWVA 3OEDC 3T5OA 3ZD1A 4PZ5A 1Q3XA 1VVCA 1HFIA 3ERBA 4ZH1D 4LOTA 2XWBF 5HYTB 1L6JA 2WIIC 4C16A 1ELVA 2YBYA 2IZ4A 2IZ3A 1ZJKA 2O39C 5HYPA 2KMSA 2CG7A 2LOJA 2XWJI 1OK3A 5HYUB 1H03P 2V5OA 1CK7A 2G7IA 2JGWA 2W80A 1TPNA 1C1ZA 1TPMA 2JRAA 1LY2A 3GOVA 2XRDA 5JPMG 3MQLA 2FN2A 2BZMA 1SRZA 1MD8A 4IGDA 1PDCA 1UOTP 4YNXA 3ZD2A 3M7PA 3ZRZA 2CG6A 2A55A 5FO8C 2XQWC 4B2SA 1H04P 1PPQA 4AYIA 1VVDA 3CALA 1KS0A 4LOSA 1J7MA 4DJZA 1QGBA 3NFPI 1CXWA 4AYEA 3KXVA 1GXDA 1U5MA
chains in the Genus database with same CATH superfamily
2W81A 4J38B 3ZLEA 1W1VA 2RKZA 1E88A 1OK2A 2CKUA 3EJHA 1E5GA 1G4FA 1OK1A 1YUEA 3L28A 2QY0A 1TPGA 3GXEA 4APLA 1HFHA 4PO7A 2KRIA 1QO6A 3RJ3D 2Y2GA 4IBEA 2RLPA 4JHSA 2JGXA 2RKYA 3NJAA 4OJPA 4GHAA 4YIZA 1H2QP 3OXUD 1GKGA 4Z2KA 1FBRA 2YRAA 1HCCA 4GH9A 3L2AA 3IX0A 1E6NA 4K12A 3TVJA 4IBFA 2B5ID 3WX7A 3FGTA 4OUIA 1E6RA 1O9AA 3OP8A 4MUCA 4IBKA 4CSYA 4IJFA 1W1YA 2ZYCA 4NY2A 2RL0A 1O6IA 2RTSA 4B2RA 3SW0X 4AYDA 4FXGG 1GPFA 1Z92B 4QNLA 1GPZA 3WD3A 5I0QB 1ED7A 4GHLA 2MCYA 3L89M 4WJG2 4AYMA 4TX8A 3FGRA 4IJEA 4NZ4A 2V8EA 4LG2A 2UWNA 4KKDA 1W1TA 4IBBA 2Y2LA 1MD7A 1OGBA 3L29A 2EHFA 5DN4A 1SS2A 2MCZA 1CKLA 2RLQA 1EAKA 1UR9A 3L26A 1QUBA 3INBC 4F4OC 2ERJA 1H0GA 2FFFB 2UWXA 1E6ZA 4IBGA 1OK9A 3WSXA 3R62A 1GKNA 1H0IA 3KS4A 2EC3A 5HZPB 1E8BA 1OJYA 4ONTD 1OJVA 1OGGA 3FKEA 1GHQB 2XRBA 2Y8TA 3KZJA 3O8EB 1OJWA 3IU3I 4MB3A 4NZ5A 1H2PP 1H8PA 4A5WB 1YU1A 3KS8A 1G4GA 1NWVA 3OEDC 3T5OA 3ZD1A 4IBJA 4PZ5A 1Q3XA 1VVCA 4BWCA 1HFIA 1E15A 3ERBA 4Z2GA 4ZH1D 4LOTA 4N7EA 2XWBF 2Y2NA 2Y2KA 5BPVA 5HYTB 4MB5A 1L6JA 3HONA 2WIIC 4Z2IA 4C16A 1ELVA 2Y2HA 4Z2HA 2YBYA 3HSHA 3L25A 2IZ4A 4OJLA 2D49A 4HMDA 4IBIA 4OJ6A 2IZ3A 3ZLDA 4Z2JA 2Y2MA 4MB4A 3WD2A 1ZJKA 2O39C 1YU0A 2IOUA 2XD1A 4Z2LA 5HYPA 1YU2A 1GOIA 3N3FA 2KMSA 2CG7A 2LOJA 2XWJI 1OK3A 2JCHA 3CI0J 2Y2IA 1H03P 1RLHA 5HYUB 2V5OA 4MSLA 1CK7A 2G7IA 2JGWA 2W80A 1TPNA 3L27A 3WSYA 1C1ZA 3K3TA 1TPMA 2Y2PA 4NZ3A 4NYYA 2JRAA 1LY2A 3GOVA 1YU4A 2XRDA 3VWOA 5JPMG 2Y8SA 3MQLA 3WD0A 3WD1A 2XD5A 2FN2A 4OJOA 1W1PA 3WD4A 2BZMA 1SRZA 1MD8A 4IGDA 1PDCA 1UOTP 4YNXA 4IBCA 3F6KA 1UR8A 3ZD2A 3M7PA 5DN5A 3ZRZA 2CG6A 2JE5A 1AIWA 2A55A 5FO8C 2XQWC 2Y2JA 4B2SA 2Y2QA 4HMEA 1H04P 2Y2OA 1PPQA 1E6PA 4AYIA 1VVDA 3CALA 4IBDA 1KS0A 1J7MA 4LOSA 4DJZA 1QGBA 3NFPI 2I2LA 2BG1A 4HMCA 4NZ1A 1CXWA 4OJ5A 2X2ZA 4AYEA 3KXVA 1GXDA 4NYUA 2Y8RA 1YU3A 1U5MA
chains in the Genus database with same CATH topology
2W81A 4J38B 2RKZA 1E88A 1OK2A 2CKUA 3EJHA 1E5GA 1G4FA 1OK1A 2QY0A 1TPGA 3GXEA 1HFHA 2KRIA 1QO6A 3RJ3D 2RLPA 4JHSA 2JGXA 2RKYA 1GKGA 1H2QP 3OXUD 1FBRA 2YRAA 1HCCA 3IX0A 4K12A 3TVJA 3OP8A 2B5ID 1O9AA 4MUCA 4CSYA 2RL0A 3SW0X 4B2RA 4AYDA 4FXGG 1Z92B 1GPZA 5I0QB 2MCYA 3L89M 4WJG2 4AYMA 2V8EA 2UWNA 4KKDA 1MD7A 2EHFA 1SS2A 2MCZA 1CKLA 2RLQA 1EAKA 3INBC 1QUBA 4F4OC 2ERJA 1OK9A 3R62A 1GKNA 2EC3A 5HZPB 1E8BA 1OJYA 4ONTD 1OJVA 1GHQB 2XRBA 3KZJA 3O8EB 1OJWA 3IU3I 1H2PP 4A5WB 1H8PA 1G4GA 1NWVA 3OEDC 3T5OA 3ZD1A 4PZ5A 1Q3XA 1VVCA 1HFIA 3ERBA 4ZH1D 4LOTA 2XWBF 5HYTB 1L6JA 2WIIC 4C16A 1ELVA 2YBYA 2IZ4A 2IZ3A 1ZJKA 2O39C 5HYPA 2KMSA 2CG7A 2LOJA 2XWJI 1OK3A 5HYUB 1H03P 2V5OA 1CK7A 2G7IA 2JGWA 2W80A 1TPNA 1C1ZA 1TPMA 2JRAA 1LY2A 3GOVA 2XRDA 5JPMG 3MQLA 2FN2A 2BZMA 1SRZA 1MD8A 4IGDA 1PDCA 1UOTP 4YNXA 3ZD2A 3M7PA 3ZRZA 2CG6A 2A55A 5FO8C 2XQWC 4B2SA 1H04P 1PPQA 4AYIA 1VVDA 3CALA 1KS0A 4LOSA 1J7MA 4DJZA 1QGBA 3NFPI 1CXWA 4AYEA 3KXVA 1GXDA 1U5MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W81 A;  4J38 B;  2RKZ A;  1E88 A;  1OK2 A;  2CKU A;  3EJH A;  1E5G A;  1G4F A;  1OK1 A;  2QY0 A;  1TPG A;  3GXE A;  1HFH A;  2KRI A;  1QO6 A;  3RJ3 D;  2RLP A;  4JHS A;  2JGX A;  2RKY A;  1GKG A;  1H2Q P;  3OXU D;  1FBR A;  2YRA A;  1HCC A;  3IX0 A;  4K12 A;  3TVJ A;  3OP8 A;  2B5I D;  1O9A A;  4MUC A;  4CSY A;  2RL0 A;  3SW0 X;  4B2R A;  4AYD A;  4FXG G;  1Z92 B;  1GPZ A;  5I0Q B;  2MCY A;  3L89 M;  4WJG 2;  4AYM A;  2V8E A;  2UWN A;  4KKD A;  1MD7 A;  2EHF A;  1SS2 A;  2MCZ A;  1CKL A;  2RLQ A;  1EAK A;  3INB C;  1QUB A;  4F4O C;  2ERJ A;  1OK9 A;  3R62 A;  1GKN A;  2EC3 A;  5HZP B;  1E8B A;  1OJY A;  4ONT D;  1OJV A;  1GHQ B;  2XRB A;  3KZJ A;  3O8E B;  1OJW A;  3IU3 I;  1H2P P;  4A5W B;  1H8P A;  1G4G A;  1NWV A;  3OED C;  3T5O A;  3ZD1 A;  4PZ5 A;  1Q3X A;  1VVC A;  1HFI A;  3ERB A;  4ZH1 D;  4LOT A;  2XWB F;  5HYT B;  1L6J A;  2WII C;  4C16 A;  1ELV A;  2YBY A;  2IZ4 A;  2IZ3 A;  1ZJK A;  2O39 C;  5HYP A;  2KMS A;  2CG7 A;  2LOJ A;  2XWJ I;  1OK3 A;  5HYU B;  1H03 P;  2V5O A;  1CK7 A;  2G7I A;  2JGW A;  2W80 A;  1TPN A;  1C1Z A;  1TPM A;  2JRA A;  1LY2 A;  3GOV A;  2XRD A;  5JPM G;  3MQL A;  2FN2 A;  2BZM A;  1SRZ A;  1MD8 A;  4IGD A;  1PDC A;  1UOT P;  4YNX A;  3ZD2 A;  3M7P A;  3ZRZ A;  2CG6 A;  2A55 A;  5FO8 C;  2XQW C;  4B2S A;  1H04 P;  1PPQ A;  4AYI A;  1VVD A;  3CAL A;  1KS0 A;  4LOS A;  1J7M A;  4DJZ A;  1QGB A;  3NFP I;  1CXW A;  4AYE A;  3KXV A;  1GXD A;  1U5M A; 
#chains in the Genus database with same CATH topology
 2W81 A;  4J38 B;  3ZLE A;  1W1V A;  2RKZ A;  1E88 A;  1OK2 A;  2CKU A;  3EJH A;  1E5G A;  1G4F A;  1OK1 A;  1YUE A;  3L28 A;  2QY0 A;  1TPG A;  3GXE A;  4APL A;  1HFH A;  4PO7 A;  2KRI A;  1QO6 A;  3RJ3 D;  2Y2G A;  4IBE A;  2RLP A;  4JHS A;  2JGX A;  2RKY A;  3NJA A;  4OJP A;  4GHA A;  4YIZ A;  1H2Q P;  3OXU D;  1GKG A;  4Z2K A;  1FBR A;  2YRA A;  1HCC A;  4GH9 A;  3L2A A;  3IX0 A;  1E6N A;  4K12 A;  3TVJ A;  4IBF A;  2B5I D;  3WX7 A;  3FGT A;  4OUI A;  1E6R A;  1O9A A;  3OP8 A;  4MUC A;  4IBK A;  4CSY A;  4IJF A;  1W1Y A;  2ZYC A;  4NY2 A;  2RL0 A;  1O6I A;  2RTS A;  4B2R A;  3SW0 X;  4AYD A;  4FXG G;  1GPF A;  1Z92 B;  4QNL A;  1GPZ A;  3WD3 A;  5I0Q B;  1ED7 A;  4GHL A;  2MCY A;  3L89 M;  4WJG 2;  4AYM A;  4TX8 A;  3FGR A;  4IJE A;  4NZ4 A;  2V8E A;  4LG2 A;  2UWN A;  4KKD A;  1W1T A;  4IBB A;  2Y2L A;  1MD7 A;  1OGB A;  3L29 A;  2EHF A;  5DN4 A;  1SS2 A;  2MCZ A;  1CKL A;  2RLQ A;  1EAK A;  1UR9 A;  3L26 A;  1QUB A;  3INB C;  4F4O C;  2ERJ A;  1H0G A;  2FFF B;  2UWX A;  1E6Z A;  4IBG A;  1OK9 A;  3WSX A;  3R62 A;  1GKN A;  1H0I A;  3KS4 A;  2EC3 A;  5HZP B;  1E8B A;  1OJY A;  4ONT D;  1OJV A;  1OGG A;  3FKE A;  1GHQ B;  2XRB A;  2Y8T A;  3KZJ A;  3O8E B;  1OJW A;  3IU3 I;  4MB3 A;  4NZ5 A;  1H2P P;  1H8P A;  4A5W B;  1YU1 A;  3KS8 A;  1G4G A;  1NWV A;  3OED C;  3T5O A;  3ZD1 A;  4IBJ A;  4PZ5 A;  1Q3X A;  1VVC A;  4BWC A;  1HFI A;  1E15 A;  3ERB A;  4Z2G A;  4ZH1 D;  4LOT A;  4N7E A;  2XWB F;  2Y2N A;  2Y2K A;  5BPV A;  5HYT B;  4MB5 A;  1L6J A;  3HON A;  2WII C;  4Z2I A;  4C16 A;  1ELV A;  2Y2H A;  4Z2H A;  2YBY A;  3HSH A;  3L25 A;  2IZ4 A;  4OJL A;  2D49 A;  4HMD A;  4IBI A;  4OJ6 A;  2IZ3 A;  3ZLD A;  4Z2J A;  2Y2M A;  4MB4 A;  3WD2 A;  1ZJK A;  2O39 C;  1YU0 A;  2IOU A;  2XD1 A;  4Z2L A;  5HYP A;  1YU2 A;  1GOI A;  3N3F A;  2KMS A;  2CG7 A;  2LOJ A;  2XWJ I;  1OK3 A;  2JCH A;  3CI0 J;  2Y2I A;  1H03 P;  1RLH A;  5HYU B;  2V5O A;  4MSL A;  1CK7 A;  2G7I A;  2JGW A;  2W80 A;  1TPN A;  3L27 A;  3WSY A;  1C1Z A;  3K3T A;  1TPM A;  2Y2P A;  4NZ3 A;  4NYY A;  2JRA A;  1LY2 A;  3GOV A;  1YU4 A;  2XRD A;  3VWO A;  5JPM G;  2Y8S A;  3MQL A;  3WD0 A;  3WD1 A;  2XD5 A;  2FN2 A;  4OJO A;  1W1P A;  3WD4 A;  2BZM A;  1SRZ A;  1MD8 A;  4IGD A;  1PDC A;  1UOT P;  4YNX A;  4IBC A;  3F6K A;  1UR8 A;  3ZD2 A;  3M7P A;  5DN5 A;  3ZRZ A;  2CG6 A;  2JE5 A;  1AIW A;  2A55 A;  5FO8 C;  2XQW C;  2Y2J A;  4B2S A;  2Y2Q A;  4HME A;  1H04 P;  2Y2O A;  1PPQ A;  1E6P A;  4AYI A;  1VVD A;  3CAL A;  4IBD A;  1KS0 A;  1J7M A;  4LOS A;  4DJZ A;  1QGB A;  3NFP I;  2I2L A;  2BG1 A;  4HMC A;  4NZ1 A;  1CXW A;  4OJ5 A;  2X2Z A;  4AYE A;  3KXV A;  1GXD A;  4NYU A;  2Y8R A;  1YU3 A;  1U5M A; 
#chains in the Genus database with same CATH homology
 2W81 A;  4J38 B;  2RKZ A;  1E88 A;  1OK2 A;  2CKU A;  3EJH A;  1E5G A;  1G4F A;  1OK1 A;  2QY0 A;  1TPG A;  3GXE A;  1HFH A;  2KRI A;  1QO6 A;  3RJ3 D;  2RLP A;  4JHS A;  2JGX A;  2RKY A;  1GKG A;  1H2Q P;  3OXU D;  1FBR A;  2YRA A;  1HCC A;  3IX0 A;  4K12 A;  3TVJ A;  3OP8 A;  2B5I D;  1O9A A;  4MUC A;  4CSY A;  2RL0 A;  3SW0 X;  4B2R A;  4AYD A;  4FXG G;  1Z92 B;  1GPZ A;  5I0Q B;  2MCY A;  3L89 M;  4WJG 2;  4AYM A;  2V8E A;  2UWN A;  4KKD A;  1MD7 A;  2EHF A;  1SS2 A;  2MCZ A;  1CKL A;  2RLQ A;  1EAK A;  3INB C;  1QUB A;  4F4O C;  2ERJ A;  1OK9 A;  3R62 A;  1GKN A;  2EC3 A;  5HZP B;  1E8B A;  1OJY A;  4ONT D;  1OJV A;  1GHQ B;  2XRB A;  3KZJ A;  3O8E B;  1OJW A;  3IU3 I;  1H2P P;  4A5W B;  1H8P A;  1G4G A;  1NWV A;  3OED C;  3T5O A;  3ZD1 A;  4PZ5 A;  1Q3X A;  1VVC A;  1HFI A;  3ERB A;  4ZH1 D;  4LOT A;  2XWB F;  5HYT B;  1L6J A;  2WII C;  4C16 A;  1ELV A;  2YBY A;  2IZ4 A;  2IZ3 A;  1ZJK A;  2O39 C;  5HYP A;  2KMS A;  2CG7 A;  2LOJ A;  2XWJ I;  1OK3 A;  5HYU B;  1H03 P;  2V5O A;  1CK7 A;  2G7I A;  2JGW A;  2W80 A;  1TPN A;  1C1Z A;  1TPM A;  2JRA A;  1LY2 A;  3GOV A;  2XRD A;  5JPM G;  3MQL A;  2FN2 A;  2BZM A;  1SRZ A;  1MD8 A;  4IGD A;  1PDC A;  1UOT P;  4YNX A;  3ZD2 A;  3M7P A;  3ZRZ A;  2CG6 A;  2A55 A;  5FO8 C;  2XQW C;  4B2S A;  1H04 P;  1PPQ A;  4AYI A;  1VVD A;  3CAL A;  1KS0 A;  4LOS A;  1J7M A;  4DJZ A;  1QGB A;  3NFP I;  1CXW A;  4AYE A;  3KXV A;  1GXD A;  1U5M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...