1E8JA

Solution structure of desulfovibrio gigas zinc rubredoxin, nmr, 20 structures
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
52
structure length
52
Chain Sequence
b'MDIYVCTVCGYEYDPAKGDPDSGIKPGTKFEDLPDDWACPVCGASKDAFEKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUBREDOXIN
publication title NMR Structure of Desulfovibrio Gigas Rubredoxin: A Model for Studying Protein Stabilization by Compatible Solutes.
pubmed rcsb
source organism Desulfovibrio gigas
molecule tags Electron transport
total genus 2
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2000-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1e8jA00
1S2ZA 6RXNA 2PVXA 1BFYA 1DX8A 1IRNA 4POFA 1IROA 1ZRPA 4AR6A 3PZAA 1IU5A 3RZ6A 1BQ8A 3SS2A 1LTLA 2QL0A 1RWDA 1RDVA 1T9PA 2PVEA 3KYYA 3QVDA 1LKPA 4ME3A 8RXNA 1E8JA 3RYGA 2GMGA 2PYAA 1YUZA 2M4YA 1JYBA 3KYXA 2LCQA 1IU6A 2V3BB 4YWLA 5IY0A 1BQ9A 4YWMA 1H7VA 1RYTA 1S30A 1T9QA 1VCXA 3MPSA 2KN9A 1RB9A 1DVBA 1R0HA 1SMWA 3PWFA 1B2JA 4AR4A 4AR5A 1SMUA 4TPUA 1R0GA 1BE7A 7RXNA 3A44A 5RXNA 2DSXA 1LKMA 1QYBA 1YK5A 3KYUA 1SMMA 2RDVA 1LKOA 1C09A 1CAAA 1NNQA 1FHMA 1CADA 1QCVA 1BRFA 1R0IA 4K9FA 5AI3A 1T9OA 1FHHA 1YUXA 2KKDA 1R0FA 3KYVA 1YK4A 1B13A 5AI2A 1S24A 3KYWA 1YV1A 2MS3A 4RXNA 1B2OA 2K2DA 2HR5A 1RDGA 1R0JA 3RZTA 4AR3A 2VL6A 1B71A 4POGA
chains in the Genus database with same CATH superfamily
4AHWA 3LNLA 1R9TL 5H1Sc 2A69D 4A3DL 2H12A 1DX8A 2AYJA 1IROA 4A3BL 3B08B 4AR6A 3K35A 4A3EL 3FDJA 1ODHA 2JI2A 4TVMA 2XJSA 1T9PA 2PVEA 1F4LA 4AI1A 3IU3I 3HOXL 3I4ML 4JAFA 3RZOL 2GMGA 2M4YA 5MFPA 1JYBA 2LCQA 3LWQB 2V0EA 4BY1L 5MLC3 4BBRL 2O5JD 4YWMA 1OWBA 1S30A 2B5ID 1T9QA 1VCXA 3LPEB 4A3JL 1RB9A 2PMZP 1PFWA 3M4OL 5MF6A 1I50L 1B2JA 4Y52L 1R0GA 1PZXA 2AQCA 3P8BA 4C2M1 5K2ME 3PO2L 2Y0SP 2PPTA 3S1QL 1LKOA 3RZDL 3LWVB 1I6HL 4C3JL 1BRFA 4K9FA 5AI3A 1TWCL 5EINC 3PIO1 2NVXL 1R0FA 4UY81 5GAHc 5M3ML 2A6ED 1YK4A 2MS3A 3WWNB 3LWRB 1B2OA 1RDGA 3RZTA 1S2ZA 6RXNA 2L0ZA 1BFYA 3QQCE 1PFUA 3S17L 3PZAA 2EY4E 1IU5A 3MQKB 5IP9L 3SS2A 3HJWB 2R7ZL 2QL0A 3P2AA 1RWDA 1RDVA 3HOWL 5M3FL 3LWOB 1E8JA 3RYGA 2PYAA 5DM71 1YUZA 3KYXA 2M4VA 5FLML 1IU6A 2JA7L 3PIP1 4JAEA 2XJPA 3HOYL 4GS7D 3MPSA 2KN9A 1PFYA 1DVBA 2JI1A 1VZIA 3PWFA 2XJTA 3K7AL 3GTQL 3H3VM 1WCML 3MSUA 3I4NL 3JR7A 3GTOL 1SMUA 4JADA 2PSMC 5IYDL 3ZG6A 2E2HL 2Z3QB 2E2JL 3H9CA 4JAGA 1C09A 4LHNA 4AHZA 5JVG1 3GTLL 1FHMA 3S1NL 5GAEc 3GTML 1QCVA 1R0IA 2M6PA 1VZHA 2HVYC 2A6HD 5AI2A 3HOVL 5AN9H 1TWAL 3J7Z1 2ERSA 2HR5A 2AUSB 3S1RL 5IP7L 2VL6A 3PL5A 2APOB 3HOZL 3GTPL 4AI3A 1PFVA 5MGNA 4A3FL 2PVXA 3PKJA 2NVQL 3NFPI 3LWPB 2WAQP 5M5XL 5EIOC 3RZ6A 3VPBE 4XXBB 3H9BA 1LTLA 4AYBP 2JA8L 3KYYA 1LKPA 4ME3A 8RXNA 2R93L 1K83L 4BBSL 2V3BB 5IY0A 2NVTL 4WFN1 1BQ9A 1RYTA 3M3YL 3H0GL 1R0HA 1SMWA 1NXEA 3HAXC 4AR4A 5GAGc 4LHLA 4AR5A 1SFOL 5M5WL 3S15L 1BE7A 1WJVA 3S2HL 2VUML 2JI3A 5FJ8L 3GTJL 4A3ML 4B8CD 2RDVA 4AHXA 2JA5L 1CAAA 2ERJA 1QQTA 2CKCA 1CADA 4X6AL 2XJVA 2B63L 1Y1WL 2BE5D 5IYBL 1FHHA 2C6AA 3FKIL 1TWGL 4AHYA 4U671 2C6BA 3KYWA 2ZIXA 4C3HL 4E6YA 4ZN3B 4C3IL 1YV1A 4RXNA 2K2DA 4AR3A 5IYCL 4V196 4A3KL 1B71A 3H97A 4POGA 1I3QL 4QIWP 1IRNA 4POFA 1ZRPA 2A68D 3HKZP 2JA6L 2CKAA 2V0FA 5C4JL 1BQ8A 4A3LL 4BXXL 3S16L 1VZGA 2NYDA 4G6BA 3QVDA 3S2DL 4Y7NL 3B0AB 1RYQA 2M6OA 5MFZA 2E2IL 4YWLA 4A3GL 3WWLA 2NVYL 2CR8A 1H7VA 1IW7D 3PO3L 5DM61 3S1ML 2R92L 4ZN1B 2XJQA 2YU9L 4A3CL 3S14L 5JVH1 2XJUA 1OWCA 4TPUA 5C44L 7RXNA 3A44A 5C3EL 5RXNA 2DSXA 1TWFL 1LKMA 1QYBA 3HJYB 1YK5A 3KYUA 4A3IL 1SMMA 1NNQA 2Z3RB 2J9UB 5M5YL 4BY7L 3HOUL 4AI2A 4XGHA 3PKIA 1P7PA 2XJRA 4A93L 1T9OA 1YUXA 4AI0A 2KKDA 1TWHL 1NXGA 3KYVA 5C4XL 1B13A 1S24A 3CQZL 2WB1P 5GADc 2RFKB 3H99A 1Z92B 1R0JA 3GTKL 3GTGL 1Y1VL 3J7Y1
chains in the Genus database with same CATH topology
4AHWA 1S2ZA 3LNLA 4AI3A 6RXNA 5H1Sc 2A69D 5MGNA 2H12A 2L0ZA 2PVXA 1BFYA 3PKJA 3QQCE 1DX8A 1IRNA 2AYJA 4POFA 1IROA 1ZRPA 2A68D 3B08B 3NFPI 2CKAA 4AR6A 3PZAA 3K35A 1IU5A 2V0FA 5EIOC 3RZ6A 3VPBE 1BQ8A 4XXBB 3SS2A 1LTLA 2QL0A 3P2AA 1ODHA 1RWDA 1RDVA 1VZGA 2JI2A 4TVMA 2XJSA 1T9PA 2PVEA 3KYYA 2NYDA 4G6BA 3QVDA 1LKPA 3IU3I 4AI1A 4ME3A 8RXNA 4JAFA 1E8JA 3RYGA 2GMGA 3B0AB 1RYQA 2PYAA 2M6OA 5DM71 1YUZA 2M4YA 5MFPA 1JYBA 2M4VA 3KYXA 1IU6A 2V3BB 4YWLA 2LCQA 5MFZA 5IY0A 2V0EA 3WWLA 5MLC3 3PIP1 4WFN1 2O5JD 1BQ9A 2CR8A 4YWMA 4JAEA 1OWBA 1H7VA 1RYTA 2XJPA 1IW7D 1S30A 2B5ID 4GS7D 1T9QA 1VCXA 3MPSA 3LPEB 2KN9A 5DM61 1RB9A 1DVBA 2JI1A 1R0HA 1SMWA 1VZIA 3PWFA 4ZN1B 2XJTA 2XJQA 1NXEA 5MF6A 1B2JA 3MSUA 4AR4A 5GAGc 4LHLA 5JVH1 2XJUA 4AR5A 1OWCA 1SMUA 4TPUA 1R0GA 1BE7A 1WJVA 7RXNA 3A44A 3P8BA 2JI3A 4JADA 5RXNA 2DSXA 2PSMC 5K2ME 1LKMA 1QYBA 3ZG6A 2Z3QB 2PPTA 4B8CD 1YK5A 3KYUA 1SMMA 2RDVA 4AHXA 1LKOA 4JAGA 1C09A 1CAAA 4LHNA 1NNQA 2Z3RB 4AHZA 5JVG1 2ERJA 2J9UB 2CKCA 4AI2A 1FHMA 1CADA 4XGHA 3PKIA 5GAEc 2XJRA 1QCVA 1BRFA 2M6PA 2XJVA 4K9FA 1R0IA 5AI3A 1T9OA 2BE5D 1FHHA 1YUXA 1VZHA 5EINC 4AI0A 2KKDA 2C6AA 1R0FA 3PIO1 4UY81 5GAHc 2A6ED 1NXGA 2A6HD 1YK4A 1B13A 3KYVA 4AHYA 5AI2A 1S24A 4U671 2C6BA 5AN9H 3KYWA 2ZIXA 4E6YA 5GADc 4ZN3B 3J7Z1 1YV1A 2MS3A 3WWNB 4RXNA 1B2OA 2ERSA 2HR5A 1Z92B 1RDGA 2K2DA 1R0JA 3RZTA 4AR3A 2VL6A 4V196 1B71A 3J7Y1 4POGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S2Z A;  6RXN A;  2PVX A;  1BFY A;  1DX8 A;  1IRN A;  4POF A;  1IRO A;  1ZRP A;  4AR6 A;  3PZA A;  1IU5 A;  3RZ6 A;  1BQ8 A;  3SS2 A;  1LTL A;  2QL0 A;  1RWD A;  1RDV A;  1T9P A;  2PVE A;  3KYY A;  3QVD A;  1LKP A;  4ME3 A;  8RXN A;  1E8J A;  3RYG A;  2GMG A;  2PYA A;  1YUZ A;  2M4Y A;  1JYB A;  3KYX A;  2LCQ A;  1IU6 A;  2V3B B;  4YWL A;  5IY0 A;  1BQ9 A;  4YWM A;  1H7V A;  1RYT A;  1S30 A;  1T9Q A;  1VCX A;  3MPS A;  2KN9 A;  1RB9 A;  1DVB A;  1R0H A;  1SMW A;  3PWF A;  1B2J A;  4AR4 A;  4AR5 A;  1SMU A;  4TPU A;  1R0G A;  1BE7 A;  7RXN A;  3A44 A;  5RXN A;  2DSX A;  1LKM A;  1QYB A;  1YK5 A;  3KYU A;  1SMM A;  2RDV A;  1LKO A;  1C09 A;  1CAA A;  1NNQ A;  1FHM A;  1CAD A;  1QCV A;  1BRF A;  1R0I A;  4K9F A;  5AI3 A;  1T9O A;  1FHH A;  1YUX A;  2KKD A;  1R0F A;  3KYV A;  1YK4 A;  1B13 A;  5AI2 A;  1S24 A;  3KYW A;  1YV1 A;  2MS3 A;  4RXN A;  1B2O A;  2K2D A;  2HR5 A;  1RDG A;  1R0J A;  3RZT A;  4AR3 A;  2VL6 A;  1B71 A;  4POG A; 
#chains in the Genus database with same CATH topology
 4AHW A;  3LNL A;  1R9T L;  5H1S c;  2A69 D;  4A3D L;  2H12 A;  1DX8 A;  2AYJ A;  1IRO A;  4A3B L;  3B08 B;  4AR6 A;  3K35 A;  4A3E L;  3FDJ A;  1ODH A;  2JI2 A;  4TVM A;  2XJS A;  1T9P A;  2PVE A;  1F4L A;  4AI1 A;  3IU3 I;  3HOX L;  3I4M L;  4JAF A;  3RZO L;  2GMG A;  2M4Y A;  5MFP A;  1JYB A;  2LCQ A;  3LWQ B;  2V0E A;  4BY1 L;  5MLC 3;  4BBR L;  2O5J D;  4YWM A;  1OWB A;  1S30 A;  2B5I D;  1T9Q A;  1VCX A;  3LPE B;  4A3J L;  1RB9 A;  2PMZ P;  1PFW A;  3M4O L;  5MF6 A;  1I50 L;  1B2J A;  4Y52 L;  1R0G A;  1PZX A;  2AQC A;  3P8B A;  4C2M 1;  5K2M E;  3PO2 L;  2Y0S P;  2PPT A;  3S1Q L;  1LKO A;  3RZD L;  3LWV B;  1I6H L;  4C3J L;  1BRF A;  4K9F A;  5AI3 A;  1TWC L;  5EIN C;  3PIO 1;  2NVX L;  1R0F A;  4UY8 1;  5GAH c;  5M3M L;  2A6E D;  1YK4 A;  2MS3 A;  3WWN B;  3LWR B;  1B2O A;  1RDG A;  3RZT A;  1S2Z A;  6RXN A;  2L0Z A;  1BFY A;  3QQC E;  1PFU A;  3S17 L;  3PZA A;  2EY4 E;  1IU5 A;  3MQK B;  5IP9 L;  3SS2 A;  3HJW B;  2R7Z L;  2QL0 A;  3P2A A;  1RWD A;  1RDV A;  3HOW L;  5M3F L;  3LWO B;  1E8J A;  3RYG A;  2PYA A;  5DM7 1;  1YUZ A;  3KYX A;  2M4V A;  5FLM L;  1IU6 A;  2JA7 L;  3PIP 1;  4JAE A;  2XJP A;  3HOY L;  4GS7 D;  3MPS A;  2KN9 A;  1PFY A;  1DVB A;  2JI1 A;  1VZI A;  3PWF A;  2XJT A;  3K7A L;  3GTQ L;  3H3V M;  1WCM L;  3MSU A;  3I4N L;  3JR7 A;  3GTO L;  1SMU A;  4JAD A;  2PSM C;  5IYD L;  3ZG6 A;  2E2H L;  2Z3Q B;  2E2J L;  3H9C A;  4JAG A;  1C09 A;  4LHN A;  4AHZ A;  5JVG 1;  3GTL L;  1FHM A;  3S1N L;  5GAE c;  3GTM L;  1QCV A;  1R0I A;  2M6P A;  1VZH A;  2HVY C;  2A6H D;  5AI2 A;  3HOV L;  5AN9 H;  1TWA L;  3J7Z 1;  2ERS A;  2HR5 A;  2AUS B;  3S1R L;  5IP7 L;  2VL6 A;  3PL5 A;  2APO B;  3HOZ L;  3GTP L;  4AI3 A;  1PFV A;  5MGN A;  4A3F L;  2PVX A;  3PKJ A;  2NVQ L;  3NFP I;  3LWP B;  2WAQ P;  5M5X L;  5EIO C;  3RZ6 A;  3VPB E;  4XXB B;  3H9B A;  1LTL A;  4AYB P;  2JA8 L;  3KYY A;  1LKP A;  4ME3 A;  8RXN A;  2R93 L;  1K83 L;  4BBS L;  2V3B B;  5IY0 A;  2NVT L;  4WFN 1;  1BQ9 A;  1RYT A;  3M3Y L;  3H0G L;  1R0H A;  1SMW A;  1NXE A;  3HAX C;  4AR4 A;  5GAG c;  4LHL A;  4AR5 A;  1SFO L;  5M5W L;  3S15 L;  1BE7 A;  1WJV A;  3S2H L;  2VUM L;  2JI3 A;  5FJ8 L;  3GTJ L;  4A3M L;  4B8C D;  2RDV A;  4AHX A;  2JA5 L;  1CAA A;  2ERJ A;  1QQT A;  2CKC A;  1CAD A;  4X6A L;  2XJV A;  2B63 L;  1Y1W L;  2BE5 D;  5IYB L;  1FHH A;  2C6A A;  3FKI L;  1TWG L;  4AHY A;  4U67 1;  2C6B A;  3KYW A;  2ZIX A;  4C3H L;  4E6Y A;  4ZN3 B;  4C3I L;  1YV1 A;  4RXN A;  2K2D A;  4AR3 A;  5IYC L;  4V19 6;  4A3K L;  1B71 A;  3H97 A;  4POG A;  1I3Q L;  4QIW P;  1IRN A;  4POF A;  1ZRP A;  2A68 D;  3HKZ P;  2JA6 L;  2CKA A;  2V0F A;  5C4J L;  1BQ8 A;  4A3L L;  4BXX L;  3S16 L;  1VZG A;  2NYD A;  4G6B A;  3QVD A;  3S2D L;  4Y7N L;  3B0A B;  1RYQ A;  2M6O A;  5MFZ A;  2E2I L;  4YWL A;  4A3G L;  3WWL A;  2NVY L;  2CR8 A;  1H7V A;  1IW7 D;  3PO3 L;  5DM6 1;  3S1M L;  2R92 L;  4ZN1 B;  2XJQ A;  2YU9 L;  4A3C L;  3S14 L;  5JVH 1;  2XJU A;  1OWC A;  4TPU A;  5C44 L;  7RXN A;  3A44 A;  5C3E L;  5RXN A;  2DSX A;  1TWF L;  1LKM A;  1QYB A;  3HJY B;  1YK5 A;  3KYU A;  4A3I L;  1SMM A;  1NNQ A;  2Z3R B;  2J9U B;  5M5Y L;  4BY7 L;  3HOU L;  4AI2 A;  4XGH A;  3PKI A;  1P7P A;  2XJR A;  4A93 L;  1T9O A;  1YUX A;  4AI0 A;  2KKD A;  1TWH L;  1NXG A;  3KYV A;  5C4X L;  1B13 A;  1S24 A;  3CQZ L;  2WB1 P;  5GAD c;  2RFK B;  3H99 A;  1Z92 B;  1R0J A;  3GTK L;  3GTG L;  1Y1V L;  3J7Y 1; 
#chains in the Genus database with same CATH homology
 4AHW A;  1S2Z A;  3LNL A;  4AI3 A;  6RXN A;  5H1S c;  2A69 D;  5MGN A;  2H12 A;  2L0Z A;  2PVX A;  1BFY A;  3PKJ A;  3QQC E;  1DX8 A;  1IRN A;  2AYJ A;  4POF A;  1IRO A;  1ZRP A;  2A68 D;  3B08 B;  3NFP I;  2CKA A;  4AR6 A;  3PZA A;  3K35 A;  1IU5 A;  2V0F A;  5EIO C;  3RZ6 A;  3VPB E;  1BQ8 A;  4XXB B;  3SS2 A;  1LTL A;  2QL0 A;  3P2A A;  1ODH A;  1RWD A;  1RDV A;  1VZG A;  2JI2 A;  4TVM A;  2XJS A;  1T9P A;  2PVE A;  3KYY A;  2NYD A;  4G6B A;  3QVD A;  1LKP A;  3IU3 I;  4AI1 A;  4ME3 A;  8RXN A;  4JAF A;  1E8J A;  3RYG A;  2GMG A;  3B0A B;  1RYQ A;  2PYA A;  2M6O A;  5DM7 1;  1YUZ A;  2M4Y A;  5MFP A;  1JYB A;  2M4V A;  3KYX A;  1IU6 A;  2V3B B;  4YWL A;  2LCQ A;  5MFZ A;  5IY0 A;  2V0E A;  3WWL A;  5MLC 3;  3PIP 1;  4WFN 1;  2O5J D;  1BQ9 A;  2CR8 A;  4YWM A;  4JAE A;  1OWB A;  1H7V A;  1RYT A;  2XJP A;  1IW7 D;  1S30 A;  2B5I D;  4GS7 D;  1T9Q A;  1VCX A;  3MPS A;  3LPE B;  2KN9 A;  5DM6 1;  1RB9 A;  1DVB A;  2JI1 A;  1R0H A;  1SMW A;  1VZI A;  3PWF A;  4ZN1 B;  2XJT A;  2XJQ A;  1NXE A;  5MF6 A;  1B2J A;  3MSU A;  4AR4 A;  5GAG c;  4LHL A;  5JVH 1;  2XJU A;  4AR5 A;  1OWC A;  1SMU A;  4TPU A;  1R0G A;  1BE7 A;  1WJV A;  7RXN A;  3A44 A;  3P8B A;  2JI3 A;  4JAD A;  5RXN A;  2DSX A;  2PSM C;  5K2M E;  1LKM A;  1QYB A;  3ZG6 A;  2Z3Q B;  2PPT A;  4B8C D;  1YK5 A;  3KYU A;  1SMM A;  2RDV A;  4AHX A;  1LKO A;  4JAG A;  1C09 A;  1CAA A;  4LHN A;  1NNQ A;  2Z3R B;  4AHZ A;  5JVG 1;  2ERJ A;  2J9U B;  2CKC A;  4AI2 A;  1FHM A;  1CAD A;  4XGH A;  3PKI A;  5GAE c;  2XJR A;  1QCV A;  1BRF A;  2M6P A;  2XJV A;  4K9F A;  1R0I A;  5AI3 A;  1T9O A;  2BE5 D;  1FHH A;  1YUX A;  1VZH A;  5EIN C;  4AI0 A;  2KKD A;  2C6A A;  1R0F A;  3PIO 1;  4UY8 1;  5GAH c;  2A6E D;  1NXG A;  2A6H D;  1YK4 A;  1B13 A;  3KYV A;  4AHY A;  5AI2 A;  1S24 A;  4U67 1;  2C6B A;  5AN9 H;  3KYW A;  2ZIX A;  4E6Y A;  5GAD c;  4ZN3 B;  3J7Z 1;  1YV1 A;  2MS3 A;  3WWN B;  4RXN A;  1B2O A;  2ERS A;  2HR5 A;  1Z92 B;  1RDG A;  2K2D A;  1R0J A;  3RZT A;  4AR3 A;  2VL6 A;  4V19 6;  1B71 A;  3J7Y 1;  4POG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...