1E92A

Pteridine reductase 1 from leishmania major complexed with nadp+ and dihydrobiopterin
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
283
structure length
268
Chain Sequence
VPVALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQADLSNVATAPAPVTLFTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLRNDGDREAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVWEGHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSLTRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pteridine Reductase Mechanism Correlates Pterin Metabolism with Drug Resistance in Trypanosomatid Parasites
pubmed doi rcsb
source organism Leishmania major
molecule tags Pteridine reductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 99
structure length 268
sequence length 283
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2000-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1e92A00
1BXKA 4FGWA 4CM8B 5DBFA 2HMUA 3SVTA 4FD3A 3ETDA 2OXIA 4CM1A 2EGGA 4NU6A 2R2GA 4UUMA 4HV4A 1VE9A 5TT0A 4MKXA 2HMSA 1EQUA 3QVSA 3GGOA 4GVLA 2DFVA 3ZU2A 3ZW9A 4RPKA 5G0TA 3DONA 3VH2A 3PHHA 1ORRA 4UVHA 1LC0A 4WEQA 4Q39A 4E32A 1ZW1A 2P9GA 1SAYA 4AJKA 1WP4A 3H7AA 1H6CA 2CD9A 3JYPA 1UZLA 2RCYA 1YS4A 3QWFA 1ADFA 5DN9A 5KVSA 1QR6A 1DEHA 3GHYA 1R4NB 3EUWA 1N1GA 4FPXA 2Q4BA 4IS3A 2NQ8A 4KUHA 3WFIA 4IJUA 3WNVA 4BV8A 3AI2A 3OETA 4W9NA 1E7YA 3DEYX 3MTGA 5CPBA 5U4QA 4M55A 3H6KA 2P9CA 4CMIA 4YAGA 4MVJA 3DHNA 1BVUA 2EW8A 4R01A 4RPLA 3L77A 5FYDA 4CQLA 2X23A 2YQ5A 4WGGA 1E3LA 1W6UA 1NHGA 3AOEC 4N54A 1MLDA 4XQCA 3UGKA 3UUWA 4BNNA 1P33A 1XEAA 4HWKA 1DHTA 4YJDA 3DOOA 2HMVA 4KWIA 1KY4A 5I7FA 2YHIB 2EW2A 2WTBA 2PZMA 5A05A 3K2BA 1P1JA 1Q7GA 3P19A 4MVJP 1LDEA 1PR9A 2YJZA 4L4XA 1WMBA 4FJ2A 3TPCA 3WSVA 3G1TA 4BNYA 4PLWA 2VNSA 1P1FA 2GZ1A 5L51A 3D4NA 4AJJA 2BGMA 1RJWA 3UICA 1E5QA 2YDYA 3DBLB 1PJBA 2HK7A 4LMRA 1ZVMA 4HBGA 2Y93A 4BV9A 3RU7A 3HN7A 4BVAA 3DZGA 5DP2A 1M67A 1LRKA 3VH1A 1P1IA 3FN4A 3KETA 1WZEA 2ZJ0A 4B8ZA 1XYGA 2B83A 1QORA 1WVGA 4KTTE 4YA6A 3D3EA 3NT5A 3VVBA 4QEDA 2IRWA 3E5MA 4E0BA 2I99A 1LX6A 2D5CA 4QO7A 2IE0A 4E4YA 4TZKA 3I83A 1GUFA 2HKIA 4Z9YA 1MV8A 4RO0A 4RVHA 4XZ3A 4WLEA 3RFXA 2PR2A 1E1KA 2EHDA 2VZ9A 3T7CA 3H9UA 1EVJA 3JQAD 3RASA 1OC2A 1VJTA 1N5DA 1V3VA 3OSUA 1QYWA 2X9VA 1QV6A 4NBWA 2HK8A 4XIJA 4GSLA 2BKAA 3KYCB 4BNXA 1I30A 4HFJA 2Q1TA 3PFWO 1GEEA 4YJHA 3H8VA 3WGQA 3E9NA 5JNLA 5L53A 3LDHA 1R4MA 3PJGA 2JKVA 1GV0A 1HSZA 1WWKA 3FBGA 3GN1A 1ZK1A 2BLLA 2IEDA 2FR0A 2PGLA 3QWIA 4XIYA 3V2HA 4JBGA 1ZNQO 4OO3A 1A72A 2HSDA 3NYWA 1O94A 3PZBA 3W4IA 4ND4A 3FR7A 3UHAA 1VI2A 4A0SA 2Q99A 1PWZA 1LEHA 1DAOA 2X86A 2X5KO 3KLMX 2ZK7A 4PLPA 4E5NA 5DF1A 2OHXA 4KWHA 4MPDA 1C1XB 5F5LA 1HKUA 2DBVO 1PR3A 2PD4A 3G49A 4FJ1A 3WSWA 5KKCA 5T64A 3PQEA 1B8UA 1GQ2A 4I9HA 3EYWA 4ZD6A 3WGOA 2P4HX 1V8BA 3JYLA 4DVJA 1U1IA 2EKQA 3PJFA 4Y9DA 4YACA 1LLQA 3U4CA 3HZZA 3EVTA 2IDZA 4DLBA 3QWBA 4RQUA 5AXBA 1I0ZA 1XR3A 5IN5A 1TT5A 2DTDA 3BIOA 1JVSA 4CM9A 2OGUA 5ILGA 5KKAA 3P7MA 4Q3AA 2WE7A 3FCOA 1Z73A 1SBYA 1MB4A 2EXXA 2Y1GA 3C1TA 3C1OA 4AJLA 1LI4A 3WIEA 1ADCA 3JD2A 2J6IA 3SEFA 4EUHA 1ZK2A 3ZWOA 3GLQA 1RYEA 2BI8A 2EGHA 5EERA 5F5NA 5JMWA 2BFAA 4WCFA 2EERA 1HDRA 3CINA 3BHJA 2Y68A 1GPJA 5KNLA 4MO2A 1FXSA 1N7HA 1ONOA 2FZEA 5JAZA 3OJOA 1VSUA 4NBUA 4J2OA 2Q46A 3DBHA 1AHIA 4FCCA 1DC5A 3DBVO 3PYXA 3L4BA 4NBTA 3ETGA 4DBVO 2OL4A 1C1DA 2YV3A 3V2UA 3LC1O 4DLAA 1GUYA 2CVQA 3GA0A 1CERA 4D3DA 2GNAA 4RGBA 3RU9A 4MIOA 1HE5A 4YJHB 1TA4A 3D3WA 1HT0A 3FD8A 3RVDA 4CLOB 3E03A 4CV0A 2PZJA 4QTZA 1QYCA 1KIFA 2FZWA 1HETA 3B20A 4GQAA 1X1EA 1DIRA 3WB9A 1ZO8A 1H0KA 2I3AA 1SOVA 2PNFA 4AFNA 2NADA 3ETEA 4MIEA 2G82A 3RKUA 4U7WA 1VKNA 3ANLA 4XYGA 1FDVA 5EPOA 5BNFA 4YQYA 1P45A 2AHRA 2IYOA 3GEDA 4AJPA 4E30A 4FC6A 5L40A 3TQHA 4FJ0A 3PQFA 2GF2A 3WGTA 4J7UA 1ISFA 5DBIA 2OBYA 1T1SA 3E8XA 3GNTA 3SLKA 4B7CA 4TZTA 4JP2A 3FBTA 3SXPA 4J1NA 2WD7B 1FK8A 1AUPA 4A7PA 4PLHA 2GRAA 1DJQA 1TT5B 4PG7A 1UUFA 5IDQA 1YH3A 4K6FA 1PS0A 2JAPA 5B4TA 1H9AA 1BVRA 2W2LA 4N5NA 4XYBA 3STHA 4JLWA 2D1YA 4B3HA 4YT5A 2VHVA 2XOXA 1LA2A 2PTGA 1T26A 5I7SA 3KSZO 2JL1A 5IZCC 4OMUA 1MG5A 2HRBA 2Q45A 4Z0HO 3DOJA 3KO8A 2J3KA 5JPIA 2E37A 1UZMA 2HO5A 3GEGA 1B3BA 4M87A 3PTZA 3OP4A 4CM9D 4DGSA 3O4RA 3ZU3A 2FWMX 2WE8A 4BNJA 2VQ3A 4J1SA 3GT0A 3I6QA 1MX3A 3CZRA 3KUXA 5GY7A 3W8FA 4OJNA 4CL8A 4RVSA 3PWKA 1NASA 3ICPA 4DLLA 1BMDA 3GNQA 3K30A 3JQAA 1IPFA 4DL9A 4MP6A 1JAYA 1KEWA 4UAGA 5AOVA 1TXGA 3HUDA 5THQA 4DBZA 3OQ1A 3TL2A 4R69A 5T5QA 3G17A 3D3WB 2NVBA 4MVJM 3ORFA 1XQ1A 3U5TA 3L9XA 3FNFA 2IZZA 2X4GA 3INTA 4LCJA 3UCXA 2W8ZA 3LT1A 1G0NA 3RSHA 4NJOA 2C5EA 3QVTA 2E4AA 3LF1A 2DVMA 4FGSA 4K28A 3ZWPA 3E9QA 4XGIA 4JIGA 1U4SA 2BELA 3QVXA 5F21A 1ADBA 5JO0A 1PX0A 2NM0A 2AEFA 5GZ1A 5C37A 5K6AA 5AQ1A 3R6DA 3MTJA 2ZIZA 1GEGA 1P31A 3DFUA 4ID9A 1BHSA 4W82A 3HB5X 1UDAA 3HG7A 1T1RA 2JCXA 1E7RA 2P68A 4B4WA 3ZZNA 5KJCA 1CQJA 1HL3A 4P4GA 4O63O 1PL8A 3I9LA 4HY3A 2X0RA 1ENZA 3E48A 3B6ZA 4QO8A 2GN9A 4TRNA 4XJSA 3MOIA 1OC4A 3V1YA 1TT7A 1U8XX 1ZXLA 2ZQZA 1PQUA 3GZNA 2PKQO 1UXIA 2AW5A 3UAGA 3VH4A 4BO6A 1DIAA 3F4BA 4LW8A 1VL0A 2YDXA 4RVUA 4WOKA 4KOAA 4HX5A 1KBZA 1XDWA 4NR0A 3IMFA 4IMPA 1I3KA 4DYVA 2OBNA 2VOJA 5KVVA 1KEVA 1QKIA 1T2EA 2OZPA 1B8PA 4DIOA 1D1TA 2WMDA 3Q11A 2C7VA 5T8KC 2VCYA 4PRKA 1EVYA 4B4OA 1YOVB 4PZDA 3OBBA 3HB4X 4I1IA 4YRBA 1H94A 4K9DA 1YB1A 1DC3A 2PFGA 3FNGA 1OMOA 4L0QA 1KETA 2CF6A 2I76A 4MVJI 4EJMA 2HAEA 3K8ZA 1O5IA 1KVRA 3I23A 3WGYA 4XWYA 1Q2XA 4E12A 3Q3CA 4R5MA 5TT1A 3DAFA 4U6SA 1B16A 4PVCA 2Z95A 3UOGA 1U3WA 1ENOA 4ZJUA 5JY1A 3VTFA 3DL2A 3LSYA 3U49A 5DT9A 4ZQHA 1ULUA 1ZJZA 2BFPA 4J91A 4TRJA 5G0VA 1R12A 2UYYA 3ZV3A 1KVQA 3VZPA 1R0LA 5ITVA 4S1VA 3GEMA 2BFMA 5I8WA 1TLTA 4BO9A 2VYNA 2C0CA 2GZ3A 3ZH2A 1NR1A 2Z1MA 4CM4B 2VWQA 3OJLA 2VNAA 1SO8A 1WZIA 5KOIA 2UVDA 4OOEA 1J0XO 2VOEA 1EZ4A 3S55A 1HEUA 1HE3A 4QECA 1P1HA 3AFNA 5KCZA 1I2ZA 3LT2A 2V7PA 3H9QA 4BNUA 3VTZA 1WAMA 3O9ZA 1PWXA 1JA9A 4BO4A 3JQ8A 1N2SA 3HDHA 1EFLA 5KJEA 3LYLA 3ZV4A 2A94A 1U3TA 2E6UX 5DCYA 5LDGA 4DXHA 1AE1A 3L4SO 1BW9B 1XHLA 5CEEA 1TI7A 3TN7A 1SOWA 4LVCA 2I65A 4WOJA 3H9GA 3KYDB 3KVOA 5C7LO 5A9SA 3AM4A 3RCBA 4II3A 3PLNA 2Q2QA 3WYEA 1S7CA 1JW9B 4J3FA 3MJCA 3CKYA 3B1KA 3L6DA 5A4DA 2Q50A 3L0DA 3RBXA 2DBZA 4N18A 3VZSA 1VL6A 3GZNB 3V1UA 3W8EA 3ADPA 1CIVA 2O2SA 2PGDA 2POQX 3IS3A 1NBOA 3D5TA 3AY3A 3FR8A 2V6BA 5C3MA 3ZHBA 4W7IA 2R6JA 3RUAA 4XX0A 1C0LA 3PK0A 4NIMA 3N74A 4J0FA 3IUSA 4YQZA 3W8DA 4BNMA 2GCGA 5CPFA 3PQDA 3HADA 2G76A 3RC7A 5JDIC 3RC1A 1VLLA 3DAPA 4LRTB 3OEWA 1XCBA 3EW7A 3HJAA 5GZ3A 3BTSA 2Y67A 2C82A 2ZTVA 2EEZA 4TVBA 3WICA 5B1YA 1D7OA 2J5RA 1UP4A 4DMLA 4U0KA 3ZI0A 3CEAA 4IXWA 2Y0DA 3ZHYA 4BMVA 1IZ9A 5EIOA 2RIRA 3TZHA 2NQTA 2VN8A 4ALLA 4DQVA 4R68A 3ZWMA 2C2YA 4YAJA 1TEHA 1DSSG 2QYTA 4FS3A 4E33A 3UW3A 1NYTA 2X22A 4GX5A 4M89A 4KQWA 5IXSA 2VHYA 4RF2A 2UUOA 3Q0EA 4CM4A 3GVCA 5I9NA 4WCFB 4N5MA 5IFLA 1C3VA 2FSSA 3TDKA 4XYMA 1BWSA 3PVZA 2H5LA 1RM5A 5C5IA 1EUDA 4XDYA 3AW9A 3RROA 5I7VA 3I9KA 4J2HA 5TQVA 1DXYA 2XF8A 2FRDA 1P0CA 2ET6A 4P4NA 5ICMA 3C7CB 1FDUA 1ZIDA 1VSVA 1OFGA 3B1JA 4J7CA 1O89A 1OZAA 3GMSA 5A9SB 1U7HA 3RD5A 2IXBA 4JK3A 5EQDA 4BNGA 4CLOA 4GLLA 3TZ6A 3ASUA 1QLHA 4IZHA 3RBZA 1V35A 2WYWA 5DCUA 1V3TA 4FC7A 1X13A 4PCVA 2V6MA 1DDOA 4XJTA 3GG2A 4ZA2A 4BNLA 3WGHA 1M66A 4E21A 1J4AA 4EGFA 1NWHA 3U62A 1NWCA 1HYGA 4CQMA 2UDPA 2CMDA 4UUNA 4WUVA 4IQ8A 4WLOA 3UKOA 1F0YA 4GX0A 2IEBA 2IODA 4L4RA 1B14A 1QRRA 4LISA 3WLEA 4YRAA 1HLPA 2GR9A 3AUTA 3PI7A 5A1TA 3AM5A 1EDZA 1JQBA 1XU7A 4R51A 1H9BA 1ISGA 3D4PA 5ENDA 2NU8A 3IKVA 3M2PA 1AXEA 3EMKA 3NDJA 4IM7A 1E3EA 2IZ0A 3GMDA 2PD3A 4XD2A 1IPEA 2B4QA 2BGKA 1C14A 3A4VA 4W4TA 4I8XA 3RUDA 5LC1A 1Y8QB 2Y1DA 4CR6A 2VTDA 1YB4A 4BUCA 3U4DA 3PHGA 1ZFNA 3HE3A 1GYPA 1EE9A 4UEJA 5ADHA 1E3SA 5C7IO 3FF4A 4BNFA 4D0RA 1LRJA 5HRUA 1CYDA 4ZQFA 2H6EA 1H93A 3ZV6A 4RVFA 4G65A 2B35A 2OFPA 2X9NA 4IDEA 1Z45A 2DPGA 3ZNNA 2H63A 4CM7A 2AA3A 5L7YA 3Q6IA 1P0FA 4CUKA 2PLAA 4H3VA 1CEQA 1E7SA 2WM3A 3JQFC 2O50A 4BKUA 3TSCA 2O3JA 4EDFA 2JFFA 3GG9A 3JYOA 5TLSA 3ZWCA 2EJWA 1GPDG 2GD1O 1LQUA 2NSDA 3TZQA 1ZZEA 2BI7A 1E5LA 1ZEJA 3RWBA 4IPTA 4ALKA 4XYLA 1UAYA 5AVOA 1H6BA 3GVXA 3JCZA 4GBJA 1R66A 2VT2A 4C7JA 3DDNA 4CMBA 4Z0PA 4RPGA 3WX0A 4OXKA 4OL9A 1YL6A 1SCUA 2Q1UA 1HXHA 3KTDA 2ZYAA 1NPYA 5BR7A 1A4UA 4YAIA 3OIFA 1A9YA 1KEUA 1NP3A 3E1KA 3OA0A 2B0JA 3JQBA 3JQ7B 4FFNA 1QG6A 1SZJG 4P4LA 1X1TA 5HWSA 4NJMB 4CMKA 3IKTA 4P38A 1U8FO 1VM6A 4HUJA 5AYVA 1LC3A 1GL3A 7ADHA 3C7DB 4UEOA 1FJHA 2YZ7A 3FNHA 3HFGA 4U5QA 4YT4A 1E0DA 1PJ4A 4QQRA 4RF4A 1E6EA 1QXSA 2NU6A 2XXJA 3B70A 4OAQA 3DBRA 1UZNA 4E5MA 2O4CA 5JO9A 2E82A 3QLJA 3INRA 4UEKA 1HZJA 3GUYA 2QZ9A 5HM8A 1HF3A 4EJ6A 3C24A 1PU2A 3K31A 2RHRA 4RZHA 5JE8A 5DBGA 1ONPA 4OXNA 5JAQA 1LUAA 5B4VA 3BMOA 4AVYA 1NXQA 2TMDA 3EHEA 4CM6A 5CDTA 3JD3A 4D46A 4XRGA 4YEDA 3NV9A 5A02A 1E7QA 1E92A 4XA8A 5CFZA 3QY9A 1DFHA 4J1TA 4I5EA 2C54A 4D3SA 1BXGB 2R00A 3AUSA 1I01A 4M1QA 1ZJYA 4I5FA 4JBIA 3EGOA 1NTOA 3ZNOA 3LC7O 1YOVA 1PGJA 3C85A 4OOFA 3L9WA 4INAA 3R3JA 1B8VA 3S8MA 4OKNA 4AJ1A 5CDYA 4ALIA 5JDCA 4WPGA 3I9MA 1HTBA 3Q9NA 3DMTA 1SC6A 1BTOA 4RLHA 2AQHA 3SC6A 4CR7A 4D79A 1AXGA 3AI3A 4CMHA 3GQVA 1LSOA 5T67A 3BMQB 1ZK3A 1FDSA 4OIMA 1X7GA 3QVOA 1L7EA 4IMRA 2P5UA 1F06A 4BL5A 2UV8A 1UR5A 3VH3A 2XPCA 2GYYA 2GPTA 3E82A 4D44A 4TRMA 3ZNQA 3IP3A 2X5OA 2Y0CA 3H3FA 1BG6A 3MWDB 3JQ7A 5JLAA 4R1NA 3JTMA 2ZCVA 4E6PA 5JAIA 1W73A 2QRKA 3ZWXA 1P74A 4CLRA 4ALJA 4D43A 1NQOA 3GDGA 4MVJD 4L8VA 3KEQA 1OAAA 1YL5A 1YWGO 4HFNA 4PG4A 2DTXA 2Y1EA 1GZ4A 2VWHA 4DUPA 5GZ6A 3Q2IA 4IS2A 1R0KA 2QRJA 5DOVA 4RDIA 3S1LA 1LDNA 4RVDA 4UREA 1NQAO 1PJCA 3OEYA 2NVWA 4BNZA 1U4OA 1XWFA 5C7OO 2VHZA 1GZ6A 2P5YA 3GFBA 4URFA 4RF3A 1E3WA 5CEFA 1WLYA 1XLTA 3ONEA 5ITWA 5BSEA 3MJ4A 2X8LA 4FDAA 4M49A 4Z3KA 5L7TA 1WDKA 2B36A 5EINA 3WGIA 1CQIA 3Q9UA 1QV7A 3QSGA 4CV3A 2B5VA 3I1JA 3QHAA 1IULA 4A26A 3W4JA 4L4SA 4OYRA 3C8MA 4B79A 1UXJA 3DBHB 2X6TA 4E5PA 1WW8A 5G0UA 1Q7BA 4WLFA 5HBRA 2NNLD 3WTBA 4C7KA 2CVZA 1DBVO 3TF5A 4D42A 2DUUA 3QA9A 3RUCA 2VT3A 4NZ9A 1OI7A 3RI3A 4WASA 2AEJA 3PXXA 5KJFA 3DTTA 3NT2A 1P44A 2QQ5A 4BO8A 1QMGA 3QWAA 3AUUA 3ROKA 4ALNA 1EBUA 2J3IA 4WE3A 6LDHA 1KS9A 2ZTMA 1K6IA 4D45A 3HWRA 3K5PA 3V2GA 4WCFC 2ZQYA 3I5MA 3PJEA 4MP8A 1JVBA 4PLGA 4WNCA 1A9ZA 3TWOA 3VDRA 2P2SA 4HFMA 4J6FA 1HDZA 3NTOA 4IIVA 4ND3A 4BO5A 1LSJA 3P5SA 4BNKA 3LQFA 2YV2A 5ILOA 1HYEA 3D7LA 1K0UA 1KVSA 1PS9A 1DIGA 3T7EA 4E2ZA 1KC3A 1SEVA 3PHIA 3PIIA 4LCEA 4RF5A 5ES3A 4O59O 3BHMA 1HDCA 1YE3A 1EFKA 3WTCA 4J43A 3CZMA 4ONEA 3JD0A 4CUZA 3GPIA 4IZIA 3ONDA 5F1PA 3FTPA 1XG5A 2EIHA 4PLCA 3CPSA 4Y8VA 3UCFA 5DZSA 5IG2A 4R1UA 5KJ6A 4RL6A 4YCAA 5BNIA 3CSDA 4BNHA 3AUAA 1XU9A 4Y67A 3SLGA 1X0VA 4J9VA 5FI5A 1GUZA 4MDHA 2I5PO 3F6YA 4IJWA 3GFGA 5L7WA 3WMWA 5A5FA 1WDMA 2WYUA 4FIZA 3BMCA 3NAQA 2O23A 3GDFA 4PLYA 4LRSB 1FDWA 1YQXA 3DC2A 2B4TO 2DPHA 4BQRA 3S2EA 3TFOA 3OECA 1LLDA 3V8BA 1ZH8A 4XR9A 4YT8A 2CSUA 4DYDA 4XQEA 2JHGA 1Q0QA 1YXMA 1LDMA 4Q3NA 3PDJA 3ENNA 2W2KB 1D1SA 4HNGA 2VRCA 4CMCA 1F8GA 2A9FA 4BGEA 3DTYA 5TGDA 3DBLA 2Q2VA 1UAGA 4KDFA 4W9NC 5A9RA 1YVEI 4NBRA 5HTOA 3FWZA 1PGOA 1ZCJA 3DZFA 2JJYA 2P4QA 2HUNA 1VRWA 2EV9A 1ISMA 4OQZA 2EF1A 7MDHA 4AJHA 1NVTA 1HDYA 4TROA 1YQGA 4WLUA 1V9LA 1PJ3A 4WKGA 4R1TA 4Q3EA 3W6ZA 4DIFA 4BGIA 3GHHA 2NWQA 2D59A 2Y1OA 3HQ4O 1T2FA 4FBGA 4ITUA 1GY8A 4IDBA 1MXHA 1E3JA 4G2NA 2H1SA 4YJFA 4ZGWA 2EG9A 4OH1A 4AJIA 3OA2A 1ADGA 2JFHA 4DMMA 3AI1A 3H9EO 1HE2A 1UDBA 2PGJA 3GOHA 4J4BA 4O6VA 1ENPA 5JMPA 4Q3CA 5EQFA 5L95A 3GGGA 1M76A 1EUZA 3NGXA 5F1OA 2GDZA 1P3DA 1UJMA 2D4AA 4PIVA 4YDRA 4YWJA 3LLSA 3M1AA 4GGPA 1Y9EA 2B69A 3H5AA 1BDMA 4ZQGA 3IAHA 3HDYA 4FFPA 3SJUA 4WJZA 3ZV5A 4A03A 2NV6A 1B7GO 1BGVA 2GLXA 1U2GA 2Q4EA 3AK4A 4WNIA 2YHUA 2HQ1A 3QIVA 4J9UE 1NX6A 4YYZA 5KJ1A 5T6BA 4GVXA 1JAXA 1R37A 3JD4A 1C1XA 5A3VA 1FMCA 3N7UA 1U28A 2GN8A 4CM3A 3K92A 1JLLA 4TVOA 3HDJA 1EVZA 1AGNA 2FSVA 2DBQA 2W90A 4KDEA 4NJMA 2AG8A 1LDBA 3H2ZA 1A27A 2FR8A 3BTVA 4E3ZA 2DUWA 2O3UA 5DDIP 2UAGA 4R54A 2NUAA 1T4BA 3ST7A 4JCOA 2JHFA 3WBBA 1ZBQA 3CH6A 3EK2A 1BSVA 4GGOA 4G5HA 4FFLA 1YKFA 4J90A 5T8KA 2V6FA 3K96A 4KMSA 5U1PA 2HJSA 2JD2A 3NKLA 1YQDA 1HZZA 1LSSA 2FR1A 5BSGA 4DREA 4AJNA 1P77A 1PL7A 4K26A 4FN4A 1PIWA 4ZICA 3UCEA 3WQSB 4CLXA 4B4UA 3BMNB 4R4JA 4L9RA 2E48A 2G0TA 2B5WA 4BIIA 3U4HA 5MGBA 4PFJA 3HFSA 3Q2KA 1YONA 3CTMA 3WNQA 4RCVA 1GQQA 2I6TA 2HJRA 3OHSX 1Y81A 1V0JA 5COBA 3KZVA 2RHCA 5TF4A 4IDGA 4AJOA 3IJRA 3WQQA 3GY0A 3L4BC 2C7GA 2O7SA 1NNUA 3KEOA 1LXCA 1Y8RB 1K2WA 1R4NA 5A04A 5L9AA 1H5QA 1PJ2A 4B7UA 1I10A 1JKFA 1DPGA 3ZHXA 3NGLA 1K5HA 4E13A 1DIHA 1JWBB 4JJFA 5F1KA 2PKQP 1U5AA 1E7WA 5G2OA 3WBFA 3LF2A 1I8TA 4F6LA 2CF5A 5I9MA 2W2LD 4JQCA 5L4NA 5ENVA 1YBVA 4BNTA 4XQGA 4KZPA 1Z7BA 2FPPA 1NR7A 1HDGO 3RFTA 2DQ4A 5TJ9A 1RWBA 1X7HA 4H7PA 3W6UA 3WWZA 1DC6A 1T24A 4KP7A 2VRBA 2O7QA 2WEKA 4Q3BA 1NVMB 1EBFA 3ZGYA 2C29D 2BD0A 3DB2A 5IZ4A 1ZXBA 3I4CA 1BRMA 2BMAA 4BKQA 8ADHA 1HWYA 3BA1A 1Z6ZA 4GL4A 1ULSA 3VPSA 2E49A 4CLRB 1Q0LA 4E2WA 3ZDFA 1A71A 4HFRA 3O26A 4ZHSA 3PP8A 3F4LA 1NM5A 4OHUA 3SJ7A 1DRUA 4E5KA 2ILTA 2NVUA 5DNAA 3S2FA 3F46A 3RC2A 2DKNA 2EWMA 4XDZA 5A9TA 4CMAA 1X7DA 3DZIA 1ISIA 4NK4A 1W8DA 1J5PA 3U3XA 1ML3A 4JROA 4CV1A 1EVIA 1ONNA 4RPHA 4BNVA 2H9IA 1ISHA 2NU9A 2JCVA 4J7XA 3K6JA 4M86A 3ZWWA 3JD1A 3S2IA 4BHTA 1WMAA 1SEPA 4EYEA 1DIBA 4MKZA 4O0LA 1TVEA 3WLFA 4MOWA 4PLZA 3NDRA 2WJPA 5JYDA 3TNLA 2Q2WA 2EP7A 4IDFA 4UULA 3G1UA 3BZUA 2CVOA 1ZKMA 1IZ0A 3EVNA 4OGWA 3TZCA 1HYHA 1NHWA 2OO5A 1NFFA 2ZCUA 4FB5A 1JDJA 1PJLA 3AY6A 1M6WA 4O5OA 1D3AA 3L6EA 4R9RA 5FI3A 1PGQA 2BGLA 1DLJA 3QV1A 4OQYA 5JCXA 4NFSA 3RKRA 3VPGA 3OIGA 3COSA 3JQAB 3QRWA 4AG3A 1I32A 4BO7A 5K6AC 3QE3A 3KOUA 1KOLA 3MJVA 1W4ZA 3MJSA 3NT4A 2J5KA 3F5SA 4RPJA 3X2EA 1GU7A 5JCJA 4CLHA 5CEJA 3MOGA 4CJXA 2DC1A 4PRLA 3OICA 4K6CA 3R1IA 1VPDA 4TSKA 1N9GB 2JAHA 1VKOA 3OIDA 2P91A 1JU9A 1PSDA 2D2IA 1Q7CA 1D8AA 4A27A 2C20A 3D1LA 4J16A 2WYVA 1N8KA 3UN1A 5CDSA 4A2CA 2NTJA 3DOCA 3RBVA 1SB9A 2LDXA 5DP1A 4EITA 1U7TA 4B8WA 5JS6A 3QW2A 1A5ZA 1WPQA 3GH3A 4JN6B 3AY7A 3FI9A 2C59A 3WWYA 4BO2A 3C3XA 2X1HA 1I2CA 4R16A 2HU2A 3VVCA 2G5CA 3LT0A 2C2XA 3D0OA 1ARZA 4E2XA 1LSUA 1ZMTA 5JC1A 4IDAA 2I67A 1BDBA 5FF9A 4H15A 5IXYA 1Z74A 2GERA 4R41A 2I9PA 2BFOA 4IDDA 2IYPA 4QX6A 2NVUB 4B3IA 3JYNA 1LLUA 4NMHA 3ABIA 3CMMA 5GMOA 1Y8QA 3VZQA 3GZ4A 3KRTA 1E6UA 4IIUA 1J49A 2AQIA 3OQBA 4D7AA 2PZLA 4YBZA 3I3OA 1KC1A 3DFZA 2PH3A 4IGEA 2A4KA 2GGSA 3IIEA 4XKJA 1A7KA 4D0SA 1NFRA 3MZ0A 1GYQA 4BQPA 2CZCA 3T4EA 3JQGB 1CDOA 5EESA 5L3ZA 3ZWVA 4JNKA 5FEUA 2W4QA 1ZSVA 2V65A 4DPMA 4XR4A 2D3TA 4J4HA 2O3SA 3H2SA 4UUOA 2D8AA 3F9IA 3OF2A 3CUKA 2PY6A 4R5HA 2QZZA 4PN3A 1CJCA 1C1DB 2AQ8A 3PRJA 3CE6A 2NTNA 2ZB8A 4S3MA 5BQFA 1Y9AA 4ZQBA 4NDNE 4U6QA 1N7GA 3VKUA 1A7AA 3DAGA 4Z3DA 3PJDA 4GMFA 3PWSA 4JX8A 2HK9A 3BAZA 4LMPA 3NX4A 1EK6A 1GCUA 4LSWA 5BSFA 1MFPA 4FR5A 1Z82A 1CWUA 1EQ2A 3QQPA 5BT9A 3JSAA 1R6DA 4ND5A 1P1RA 5THKA 1YBMA 4NNJA 3LU1A 1WXDA 3AWDA 1EK5A 4MVJG 2JFGA 2O48X 2R00C 5TSDA 2FOIA 3ITDA 1N92A 4IY1A 5HS6A 3AOGA 4NFHA 3ZWYA 4P8RA 4CODB 1JKJA 3U4IA 1Y1PA 3R3SA 1IE3A 4RQTA 3KLPX 4P22A 4DA9A 1B26A 3Q1LA 1Y5RA 4QFDA 1G1AA 3RUIA 2FN7A 3M6IA 4LK3A 2VYVA 5FWNA 1PJQA 5IN4A 3RUHA 3SC4A 1R16A 4CLEA 3F5QA 3DZJA 3VDQA 1DAPA 2JD1A 3U9LA 2PK3A 4CM5A 2FPIA 4MVJH 4ESOA 2HCTA 4A5OA 5JBIA 4PVDA 4PZCA 5CG2A 3ADOA 4CMGA 3VZRA 2WDZA 1EMDA 1W0CA 3WFJA 4CV2A 5KVCA 3FSRA 4BGVA 5LDHA 1MGOA 3V5NA 4IQ0A 4PLTA 2BF7A 5I9LA 4FOSA 2PKRA 3DHYA 2BH9A 2I66A 4FOOA 1E3IA 4GX1A 2GUGA 3FWNA 4RZIA 1IB6A 2FPGA 2B37A 1P9LA 2V6GA 1VC2A 3BMOB 1IOLA 2Z5LA 3DO5A 3M2TA 1PZHA 1LNQA 3F1LA 1ZMOA 2GZ2A 3ITKA 2VHXA 1EE2A 1I2BA 1OOEA 2AMFA 3EZLA 4XGNA 3GUCA 3JQGA 4ILKA 3ZCXA 3ZHZA 5DULA 4II2A 5G0SA 3OMLA 4B7XA 4MJLA 2F00A 4U8GA 4ZU3A 2SCUA 5TJHA 4AJEA 4U0JA 5I7EA 3GVPA 3IDSA 4BKOA 1EUCA 1IYZA 3O38A 1YGYA 1U9JA 2YY7A 4MVJF 1MXFA 2W98A 3I4FA 1YDWA 5TNXA 3U09A 1PTJA 1QYDA 1R0SA 3NEPX 1TB4A 5L45A 1EDOA 1XQ6A 4W99A 3WYCA 3O8QB 4N7RA 2VUUA 1ZK4A 4BB5A 3JQFA 1NPDA 1J6UA 3PEFA 2ZYDA 4OKIA 4BGUA 4AICA 1VJ1A 3BXXA 1C0IA 2RAFA 1HDXA 3GAZA 2ZTLA 4FFRA 2NLOA 3OH8A 3AOEA 9LDBA 4J1QA 3WYBA 3BMNA 3VC7A 5KVQA 5JY6A 1NAIA 4X54A 2C5AA 4NPCA 4Z9XA 1DFGA 5F3RA 2YV1A 1YRLA 5IJZA 4FQ8A 4DTIA 2O3TA 1F12A 1C0PA 5G4KB 4PG5A 2GN6A 1PGPA 4IUYA 5HS4A 2QW8A 2RH4A 1MFZA 5EMHA 3ROMA 1UXGA 3A06A 3LK7A 1VL8A 4OXYA 4FFMA 2NU7A 4HP8A 1Y8RA 4B3JA 2EKLA 3KYCA 4KTVE 1IHYA 4F6CA 4BOYA 4YAKA 3M1LA 3P2YA 9LDTA 3RUFA 3PYMA 1DRVA 2FMUA 3DMTC 3EAGA 4L75A 1ZSYA 2XAAA 2DAPA 3K9QO 3DZBA 3E6AA 5JDCC 1K3TA 3EDMA 4GAEA 3MWEB 4OSOA 1V6AA 5EN4A 4CUJA 2GASA 4BMSA 3GVIA 4ND1A 1H2HA 2Y1CA 3PDUA 4N5LA 4RV9A 5JDIA 4F45A 1JN0A 2HLPA 3EZYA 5JXWA 2VZ0A 4IQGA 3UH1A 2FY8A 1X0XA 3R0IA 4ZN6A 2OMEA 2X7HA 3C7AA 4XEHA 1KVTA 3W4KA 3I9OA 4CMEA 3G0OA 5BNTA 3UF0A 3VPHA 3PPIA 2YFHA 3GRPA 1HSOA 2Y66A 1UXKA 2PWZA 4CL3A 4UVEA 4DC0A 4WECA 2FHSA 3WG9A 1O95A 3KXDA 4PGFA 3JQEA 5JSFA 4XQ9A 2GO1A 3GNSA 2Q1WA 4XYEA 1WDLA 3ICCA 4TKMA 8LDHA 4GKBA 1YO6A 2B4RO 1YB5A 4CLDA 3O8QA 3KV3O 4PLVA 3VPFA 1NQTA 2ZKLA 1B15A 5IDWA 3TL3A 3TJRA 3H5RA 4QUKA 2ZB4A 1H6AA 3MEQA 2YFQA 1HDOA 5G0WA 1XSEA 2YUTA 2EP5A 2UUPA 2Q1SA 1T2AA 3IC5A 1CRWG 5CAEA 2VYND 1CF2O 1NAHA 4IBOA 2I3GA 5JCJD 2PH5A 3GK3A 4YT2A 2A92A 3CXRA 4FSHA 3CMCO 5KWEA 1I3LA 3HSKA 4I9NA 3QVWA 3E5RA 4MP3A 3VAZA 1EEHA 1MA0A 1NQ5A 4BMNA 4JXKA 4L73A 1O9BA 1SPXA 4UVGA 5HA5A 3QWHA 6ADHA 2X0JA 3NTRA 4J49A 3WDSA 5IF3A 3O03A 4EUEA 1GQYA 4QFCA 4MVJE 3ZWBA 4L74A 3JV7A 1BW9A 3E9MA 4B4VA 4W6ZA 4GMGA 4R3WA 4WK6A 4TKLA 2C07A 4TQGA 4BNIA 3ZWAA 2BRUA 2YW9A 3ULKA 4JJGA 5DOZA 1I5RA 1MP0A 1IY8A 2RBEA 3TOZA 4LSMA 3PFFA 2CDAA 3KM0A 3LT4A 3VKVA 4FFOA 2X0IA 4E5YA 5ER9A 1X14A 4CMEC 2A35A 1H2BA 2O3RA 3LLVA 1XELA 1CETA 3UFXA 2PV7A 3ROPA 2ZYGA 3WQRA 1G6KA 5K9ZA 3BMCB 1O8CA 3A9WA 4AJ2A 2OP0A 2LDBA 1PZFA 2Z1NA 3WGZA 2D5AA 2QX7A 4F3YA 2J8ZA 4I9UA 3ZU5A 3IQDB 2JCYA 3FPCA 3KB6A 3NTQA 4EJ0A 1F17A 1HRDA 1GADO 2W2KA 4Q3DA 1H6DA 1LDGA 2J3JA 4KQXA 5H81A 2AQKA 5CG1A 1LRLA 1PGNA 5JAMA 4UVIA 2YYYA 5AXCA 1AHHA 4EI2A 1X15A 3PGJA 1E77A 4CR8A 1E1MA 3DBRB 3NUGA 4EEZA 2CNBA 1HLDA 4CM8A 3MJEA 1RPNA 3K73O 5BSHA 3NDIA 4Y6SA 1LU9A 1T4DA 4PLFA 1YBAA 4GX2A 3JQ9A 1NVGA 5G4LA 3KHUA 2AXQA 2Q49A 5AXAA 3SX2A 3ON5A 3PGXA 4HADA 4BNWA 5COAA 1E6WA 2WD8A 2HRZA 1F8FA 3A1NA 3PZRA 5A5EA 1ZK0A 3GR6A 3BTOA 4YVFA 2J5QA 3EC7A 1LDYA 4LGVA 3AJRA 1U2DA 1DO8A 4DQXA 1C0KA 4RJTA 4DPLA 1LLCA 4EEXA 1YDEA 4HXYA 2EJVA 4YJGB 1MC4A 3WIDA 4LVUA 3UVEA 2GN4A 4D41A 3GDOA 3D5QA 4IXTA 4Z6KA 1U5CA 1DJNA 1Q1NA 2AE2A 3DZHA 4TMFA 3K2EA 4NH4A 4IDCA 1MG0A 3TRIA 4ZRMA 3GVHA 4QT0A 1QYXA 2JD0A 3LZ6A 4WLVA 1MUUA 2DT5A 2G1UA 1JTVA 1M6HA 4GSKA 4W7HA 1GCOA 4NK5A 4KUEA 4CMIB 2RH8A 4Y6RA 3WMXA 1YJQA 4CQLB 4JJIA 5TX7A 3MCVA 1XKQA 4CPDA 1UH5A 2CY0A 3ZWNA 1LBEA 4IINA 4ND2A 2VWGA 2CDCA 3N58A 2J3HA 1ZEMA 4GH5A 1OBFO 4AL4A 3D64A 3JQDA 2QG4A 3CIFA 3I6IA 3DQPA 2P9EA 3F3SA 1UP7A 2TMGA 4DQUA 2O3QA 4GWKA 4BO1A 2OUIA 4YXFA 1PS8A 2QYSA 3AFMA 3NRCA 1ZUD1 3B1FA 3HN2A 4GLOA 2PA3A 5CP8A 3LVFO 3IUPA 1DOHA 3OM9A 1O0SA 4Z0TA 2O4UX 3ONFA 1QLJA 3OQ6A 4Y6PA 3RUEA 4TRRA 2Y0EA 2FP4A 4ZVVA 3UXYA 1GTMA 1Z7EA 2QHXA 3GAFA 3BTUA 1ID1A 1PQPA 5IDYA 3P2OA 4BO0A 2HMTA 4M8SA 5KTKA 4BKPA 3V1TC 1RM0A 5JYEA 1F14A 4Q9NA 4YAEA 3TOXA 3RC9A 1A4IA 4DC1A 3RAJA 1SB8A 3ANMA 3I9JA 4MKRA 4Y98A 1BXZA 3RJ5A 5CDGA 2VWPA 2AE1A 1E3WB 4BB6A 1Y7TA 1M75A 2X5JO 4J0EA 3G79A 5JFOA 1N1EA 4EZBA 1GV1A 1UXHA 5L4SA 2NTVA 3GC6A 3DMYA 5KIAA 4YTEA 3AU8A 4WEOA 2WSBA 4NFYA 1IL0A 3FNEA 3H3JA 5AXDA 4YPOA 4MINA 2HMWA 3DXFA 4YR9A 5JC8A 4GPD1 1SNYA 4YJGA 4BO3A 3KBOA 5A06A 3U0BA 2ZATA 4NBVA 3GRKA 5LCXA 1NPTO 3DWFA 4L76A 2OOSA 3ASVA 1RYDA 1I3NA 1Z75A 4EUFA 3INGA 1JWAB 3IP1A 2VTEA 1I3MA 4K1LA 1R4MB 4NQZA 3A14A 3AM3A 2X9GA 4RVGA 3IJPA 4ALMA 2PD6A 1T2DA 1GDHA 5FFFA 3GPDG 1AN9A 3JYQA 1XA0A 1DLIA 2Y1FA 1FDTA 2O2YA 2F1KA 4OM8A 2DTEA 1QYVA 1M2WA 4HNHA 1FF9A 3OJFA 3IL2A 3RQSA 2IZ1A 5I8ZA 4Z9FA 5U9CA 1L1FA 5TIIA 4XB1A 1V3UA 1ISJA 4GKVA 2WWRA 4TWRA 3RFVA 2EKPA 5TRTA 4CQMD 1E1NA 3BYZA 5B37A 1L7DA 3G3EA 5EL0A 3FPLA 5CDUA 5G4KA 4QXMA 3NJ8A 3OJEA 4EW6A 5IZCA 4O1MA 5COQA 4WCDA 2DU8A 1DHRA 1MC5A 3LC2O 3TFQA 3JQ8B 3PHLA 5K0ZA 1KVUA 2DFDA 1PZEA 5T57A 4GI2A 3JQCA 4R3NA 5A3JA 4PZEA 3GGPA 1LQTA 3KYDA 5ER6A 2DLDA 1K89A 3RIHA 4IJVA 3KYBA 3TZKA 4I08A 1B3RA 4R9SA 3GF4A 3D4OA 3FHLA 2DBRA 3IOYA 4FW8A 1NFQA 3WS7A 1KY5A 3RJ9A 4OSPA 3S2GA 1R15A 1U3VA 2VHWA 2HDHA 3H5NA 3MJTA 4JBHA 2X58A 4YB8A 3ROQA 4CMJA 1JKIA 2XXBA 4A10A 4QSMA 3FTNA 1GD1O 3ENKA 4IGFA 4E2YA 3WOHA 4DWVA 2IXAA 1WNTA 3JQ9C 1SMKA 2DM6A 4IJKA 4JGBA 4RORA 5J23A 2BHLA 1DB3A 5A03A 3ZU4A 2QRLA 1DFIA 3HDQA 3ZN2A 1I36A 3I52A 1VJ0A 1BXGA 2ZTUA 3JQ6A 5CHEA 4GWGA 4F46A 4XB2A 1G0OA 2AG5A 2PZKA 1T2CA 3W1VA 4JP3A 1RM3A 1DC4A 2VUSA 1Y6JA 2AEMA 3JQBC 4XRRA 1PZGA 4NI5A 1GR0A 3AU9A 3HNPA 4AJ4A 3DZKA 1GFSA 3PLRA 2CDBA 4XCVA 2OP1A 4G81A 2QIOA 4YRDA 5H83A 1KERA 2D0IA 5TS3A 3WJAA 2VZ8A 2GSDA 1LTHR 1K6XA 1RKXA 1N9GA 2YQ4A 4BS9A 5DCWA 3BMQA 4ROSA 4J4TA 3F47A 3DHEA 1O6ZA 3KSUA 2CFCA 3NJ4A 4M54A 3QJ5A 1UDCA 4DIBA 5ICSA 1E7MA 1T25A 5L4LA 2Y99A 1XIVA 3ZW8A 4EBFA 3H9JA 5MDHA 3HHPA 3VOSA 1IUKA 1S6YA 3PYLA 1GZ3A 2ZB3A 3GN2A 4YJFB 1GAEO 2X0NA 1PJSA 4ZQEA 4NG5A 3WR5A 4E31A 1RM4A 3DR3A 4WLNA 3KSDO 3PIDA 5TC4A 5H82A 1DRWA 1E1LA 3PWZA 4ZRNA 4PG6A 4A73A 2WD7A 4I5GA 3T4XA 4D3FA 2NACA 5B12A 2OORA 3WJ7A 2ZB7A 1B0AA 2G17A 3ANNA 3WXBA 3BHIA 1GYRA 2CUKA 1I33A 3H65A 4DPKA 3L6OO 4R1SA 1HE4A 4NHEA 1Q0HA 1KYQA 4UUPA 3L07A 1ZSNA 4C4OA 1P1KA 1XGKA 1K6JA 1ENYA 1Y5MA 3OJ0A 4XGKA 1D4FA 3A28A 5IDXA 1QP8A 1KEPA 3C1AA 2Y05A 1PEDA 3PHJA 4DRYA 4MIYA 2VYVD 3H4VA 3OFSA 3ZNPA 4CQMB 2YHIA 3E18A 4UVDA 1B2LA 3VPXA 1LJ8A 4RDHA 3SBOA 5EJ2A 3WGGA 1PQWA 4NU5A 5B4UA 5JW6A 4I5DA 5IAAA 2VRCD 4HKTA 4RLSA 4PG8A 3VHRA 1U3UA 2Q3EA 3EY4A 4KUGA 1YL7A 1QSGA 2ZJ1A 3I9NA 1UP6A 3F1KA 4H16A 1IHXA 3X2FA 3FRJA 1I24A 4LN1A 3QP9A 2VUTA 1PJTA 1YJ8A 4BKRA 1PL6A
chains in the Genus database with same CATH superfamily
3LQ1A 1QU3A 1W581 3LA6A 1IHOA 5EHNA 4ZZ0A 5GTDA 1DTWB 5GP1A 5BWBA 3A70A 1NOIA 3PKIA 1CZLA 5HQTA 2I8LA 3WWDA 1J2EA 1QCZA 3K32A 5K03A 1OR8A 2HSJA 1Z08A 3ZU2A 3QYFA 2KW5A 1AKWA 2ATVA 4YROA 4F8YA 4WJLA 4WHMA 5JSZB 3EY9A 2IBMA 5K6TA 1Q7TA 3EMDA 4ZMBA 3VH2A 2IHVA 4KDRA 4UM9D 3SFTA 2WWWA 4LNUB 4A0HA 2UUCB 1Z25A 2C98A 2JFWA 3TJMA 2IPXA 3E3LA 4Q39A 1B0PA 3A1VA 2K7ZA 1KOJA 1MPXA 1T9ZA 5WRFA 3S1AA 4E32A 1ZW1A 1S8FA 4IDQA 1ILEA 5KDDA 2OZLB 4X61A 1WY7A 3H7AA 1GIAA 2YFYA 4OK5A 5D6NA 4ZT4A 3ERCA 1Q1AA 2PYZA 4LDAA 3T9DA 5EIAA 2RCYA 1YS4A 4LNAA 5KVSA 3Q3EA 3GHYA 3TH5A 3H86A 1R4NB 3V8QA 4WKOA 4FCWA 4MTLA 4EJSC 4FPXA 1QPZA 1TU4A 2BBOA 2NQ8A 1M3SA 5B57C 2K7FA 4KUHA 2EBWA 3GROA 3G7SA 4IJUA 5EXDA 3AI2A 4RCYA 2NGRA 3U1VA 2ZUBA 4JVMA 1QHYA 2GD2A 3NHYA 1E7YA 5BUZA 4MDFA 2Z4TA 5U4QA 3ER9A 4RKYA 2AF4C 2DHRA 4CMIA 3JATB 4YAGA 1AN0A 4MVJA 2WF6A 1OW3B 1VLQA 2ZT7A 4HF7A 4JBNA 3VNSA 3RRJA 1Y0BA 4MW6A 3Q5GA 2YQ5A 4FDTA 1W6UA 2I1LA 5BRNA 2ECFA 4YP1A 5D00A 4BNNA 1Z4LA 2W0SA 1WPXA 4EHBA 1QE0A 1MZVA 1J8DA 1XEAA 2XQKA 4HWKA 4O4LA 3ED5A 2F90A 3DOOA 4RAQA 2CUZA 4OLBA 3OLYA 2HMVA 5BMOA 2EW2A 1P2BA 3J81A 3B9QA 3IODA 1PT7A 1P1JA 2SCUB 1V8ZA 5F78A 4MVJP 1PR9A 3TCXB 1LBSA 2BT4A 4CGYA 2VK2A 4RQAA 1EUYA 4EL0A 3C3YA 4QXAA 2VH5R 3NKVA 3OG9A 5D3KA 3F6PA 1P1FA 1C7QA 1A50B 2BBSA 4EEKA 1S3FA 4BGDA 2NG1A 1ZDMA 2OCGA 1YU6A 4INOA 3EQ7A 1RJWA 4O2AF 1C9EA 3UICA 4BEWA 5EZQA 4P80A 4C14A 2ZSJA 3QNWA 1NN1A 2Y93A 4DDUA 4MEJA 4EH1A 2AZXA 1ND6A 2ZRPA 3HN7A 1JHOA 2PH7A 3OKAA 1ORHA 5IAEA 2GFHA 3VH1A 1NQWA 5LZ5A 5B7GA 1P1IA 2P78A 3ISTA 4RHUA 1CUBA 2Y1LA 2PZ8A 4QUJA 3G8CA 4S24A 3IVCA 4B8ZA 4LDPA 1I2DA 2HCBA 1QORA 1WVGA 3G85A 3F7OA 4YA6A 6REQA 1X38A 3K09C 5JG7A 1Z2EA 1V5IA 4QEDA 2ORIA 1HT2E 1U2ZA 3A6HA 3RRZA 2I99A 2XUKA 3SQOA 2D5CA 2GBLA 4E0BA 4E4YA 4TZKA 3SWWA 3KAKA 1MV8A 2P5TB 3IDAA 5FOSA 4IJ6A 4MB2A 4RVHA 1XNJA 2PG3A 3LOPA 2R2AA 4CIDA 4ZKDA 2EHDA 1XO1A 4QGGA 2JLBA 3H9UA 4ZFNA 4R8RA 3D5EA 5G1OA 1EVJA 3JQAD 4QUHA 4EHNA 4M1EA 1J0CA 1OC2A 1N5DA 4YECA 1V3VA 2YC2C 3OSUA 1QYWA 2BFDB 4NBWA 1B0ZA 1MQ8B 1C3JA 1K88A 3A4IA 2QUHA 1HMYA 2C4VA 4P4SB 1PHPA 4XIJA 4ZYTA 2BKAA 1KQOA 2Z2XA 5TARA 2Q5CA 1PTKA 2RG7A 3V55A 1GEEA 1A1VA 4DHEA 5J4HA 4EZEA 2EFYA 3W5DA 4BVHA 2JKVA 3FMOB 3TLEA 3EVAA 3OQIB 1GV0A 1HSZA 2H1VA 1WWKA 2IIBA 4RABA 3JU3A 2GCEA 1F2TA 3FBGA 3KR0A 3L4EA 4U6NA 1NGSA 2ZRJA 4HDNA 2QLJA 3GN1A 2BLLA 4YY3B 5E0OA 3V2HA 1DEAA 1ZNQO 2IOFK 2ZT6A 2DFLA 4OO3A 2PUFA 1JT9A 1D2MA 3PXAA 2GO7A 1PJAA 4BMDA 2H17A 1O94A 4AF8A 1CE8B 1X7YA 1QX4A 1AURA 4KFCA 4OHMA 1MA3A 2Q99A 1TADA 1LEHA 1VTKA 1DAOA 1OQAA 3MW8A 5GJWC 2X86A 3A1FA 1I4DD 2DQZA 4LPSA 1DV1A 3B82A 1H2XA 4HVLA 4E5NA 5DF1A 2EDAA 2OHXA 4G9BA 1IDN1 1BD3A 2CHVA 2H5JA 2FEPA 3NM6B 3V9PA 4ZDJA 1QTQA 2EC5A 4GOND 2J9YB 3EVZA 1UFQA 2PRIA 4LMBA 4AZTA 4EMBA 3G7NA 3PQ4A 2QE7D 5T64A 2RB5A 5IHXA 1C9DB 3BEDA 1AMNA 3T3MB 4LC0A 3JYLA 3GLIE 1U1IA 1ADYA 1KDVA 4JI0B 3RTAA 2OOKA 1R1DA 4XD7D 3HZZA 4UTXA 1U0SY 2VJLA 3JQQA 4FBMA 4ZC1A 1I0ZA 1FOEB 1PUJA 2C8VA 3M83A 5IN5A 1G8MA 5I45A 1DKNA 2POCA 3BIOA 1FU7A 3GP3A 1YFJA 1HG0A 2OGUA 5ILGA 2GK6A 1OH6A 2IIVA 2ROQA 3P7MA 2CMGA 1IM8A 2WE7A 5K8TA 3KPYA 2DWQA 2FI1A 3FCOA 4JCCA 5DBEX 5AVKA 1JFVA 2EXXA 2O2IA 5KX5B 2H5IA 3B5JA 3DMHA 1EG2A 2PXHA 2V4UA 2XIQA 1AK9A 4MJ7A 3TD2A 3WIEA 4FHDA 1BH2A 5FUYA 5AHXA 2BE9A 2J6IA 2XUFA 3RVLA 1CSEE 1K9SA 3KLOA 4URYR 5HFAA 4O4JF 5LKRA 1ZK2A 3DLBA 1NY6A 2W11A 3GLQA 1TM5E 3KZXA 3RGWS 2JGIA 3O2NA 3QYAA 4LNHA 1C7IA 2VHTA 3ACDA 4URUR 4X20A 3BHJA 2YHAA 3JY6A 3OOHA 5DM70 2YZNA 1OLSB 3AR3A 4MO2A 1ZWLA 2NNWB 3HXLA 4F1WA 5CBKA 2ZWMA 3WO0A 1TMKA 1FFAA 1U2GC 3PUHA 2V5VA 3HBLA 4B82A 3JALA 1C1DA 3Q7QA 2H48A 4NDZA 4NFLA 1GUYA 3IPLA 3R3WA 4ZC8A 4U1RA 4DLAA 1CERA 1C2YA 5C9ZA 3Q12A 3UMSA 1M0SA 1E2IA 4KRGA 4ZOLA 4AIIA 6Q21A 5MF6A 1QGUB 4K7JA 4IRMA 1EVEA 1HE5A 4MIOA 2RKOA 4DLVA 3FD8A 3KUDA 2CNNA 1FSPA 4OHXA 2O2JA 3ZCTA 1Y6ZA 2I62A 1R9JA 1DPFA 1L7BA 2O1XA 2PZJA 2WZQA 3WZLA 6CHYA 4AKIA 1GNPA 3I2HA 1TGVA 1FQKA 1YR7A 4MPPA 5FBQB 5CB0A 4K9LA 1JYEA 2REQA 1G20B 2VF5X 3IIJA 1KE2A 2JIRA 3IOCA 1QUFA 1SOVA 2I3AA 2XMPA 2J7KA 1B8NA 3H2HA 2NADA 2XE6A 2CJWA 4V02A 4HPJB 2G82A 1K9VF 2FYTA 3IAS1 1EVLA 5F5XA 2IOQA 3H1AA 2LWIA 4QLOA 1R6VA 1WMDA 4YQYA 4BVEA 3GEDA 1CQWA 4E30A 4R7TA 5L40A 2YV4A 4LYJA 4ZVNA 3TQHA 1CLUA 4J7UA 3PF9A 2CNOA 4KBGA 4PC2A 1ISFA 2OM6A 3FFXA 3ONVA 3WDLA 3E8XA 4WXYB 3GNTA 5ALKA 5TPWB 4RLQA 1XKXA 4BC0A 1Z17A 5KU7A 3PEWA 2JGRA 4BEBA 1JLMA 2AZMA 1SXQA 3UQYS 4ZJPA 3HBJA 3HUFA 3GLHE 5JZSA 1UCFA 1H2WA 3A3PA 1UMCB 4MRPA 3AP1A 2CEKA 3P9KA 4ND8A 3FA2A 3Q5EA 4K6FA 1N4AA 1PS0A 4MA5A 1H9AA 1KFKB 1S2GA 1ONBA 4IHJA 3TQOA 2DZDA 4XVCA 5LWQA 2Z2ZA 1LA2A 2XEDA 2XOXA 3AL2A 5L6LB 1YQQA 2AC2A 4IUDS 2W2PA 2A33A 4ICIA 1RIFA 4RHYA 1SXHA 2Q6LA 1N6OA 4BN4A 3DW3X 5IZCC 1A76A 1CUZA 2Q45A 2HRBA 4Z0HO 3KO8A 4IRUB 2J3KA 1GRNA 3IFSA 1U28C 2XGSA 4OFZA 5BR1A 2Z2KA 1WKCA 1VLVA 4HH3C 2B4YA 3BCSA 1JS1X 3G8BA 4KXUA 4C1NA 3JTEA 3O4RA 4CM9D 4GMDA 3UWMA 4OK6A 4AUMA 4PO9A 3AWIA 3HP7A 4G37A 1MRSA 3GT0A 1O03A 3SHOA 3VQTA 4R2WA 3V1LA 3W8FA 5GY7A 1A9PA 5IVDA 2FEKA 1MOQA 4TYPA 5AH0A 2FFQA 3WLIA 4RXUA 2WC1A 1QG2A 5AKEA 3GNQA 4U2FA 2D0OB 3I30X 1QAMA 3JQAA 4WBNB 5BW8A 1FRVA 1BMFD 2MSNA 4JVOA 4MP6A 4DL9A 1E0KA 2DJ5A 2PCJA 2R66A 3SS8A 1QFYA 4CCYB 5THQA 5C53B 5TPZD 3ZOZA 1T9AA 5DBOA 1E4EB 4ZMSA 1JEQB 1P62B 3N8KA 3L7MA 4C0JA 3LCVB 1THZA 3ORFA 3U5TA 1RZVA 3VO2A 1YZVA 3L9XA 4YUYA 1RU3A 1BHQ1 3D31A 2QZJA 3U44B 1WETA 5LD2B 4NCHA 4RE5A 2BFBB 3VR6H 2W8ZA 3TSZA 3F8SA 2Z9DA 3QJYA 5A7GA 3H6GA 3RS5A 1YQWA 4FGSA 3SQDA 3T3EA 2ON6A 2PTHA 5AW1A 1JXQA 1NXSA 2ZSHA 4RUKA 5KHAA 3GX1A 3M5DA 1XTSA 3KE8A 1TZBA 3ZXSA 5HK8A 3IA7A 1PX0A 1NIPA 1I7LA 4WACA 5TQ0A 5BXQC 1UXOA 4OJYA 4CIXA 1YIOA 2DCMA 4BFSA 4P3PA 4W82A 1KAEA 3RK1A 1E62A 3PUZA 3PEYA 3G0CA 4WWHA 3K9NA 1GDDA 3TECE 3OI7A 3ZZNA 4TMYA 3GZJA 3CKLA 2QYHA 6ABPA 4P4GA 3S68A 4DV4B 4O63O 1PL8A 1W9MA 1G2PA 3STXA 4X7MA 4V0RA 2WD9A 2H65A 4QO8A 4TRNA 2F48A 1FSSA 4G5OA 1TT7A 1ZXLA 5CFPA 4QXPA 5JI2E 2VPWA 4OREX 3GZNA 2PKQO 3G68A 3TIGA 1UXIA 1GNTA 1OH5A 2AW5A 1V26A 2YNMC 2XR1A 4JLOA 4G36A 2ZVDA 3UAGA 3UHOA 3F4BA 4LW8A 1VL0A 4ZOBA 2QSZA 3HY3A 1DS6A 4Y1GA 3FRIA 4X8OA 4ZAFA 1KBZA 4DANA 4DYVA 1G42A 4RH1A 4XX0B 5DB4A 5KVVA 2QROA 4HYQA 4EY6A 5K3BA 1GL6A 1I80A 1NBEA 2C2HA 2WMDA 1KRWA 1SH7A 3STUA 4OP3A 3VXKA 7ABPA 1B23P 4U7PB 1TVKB 4LYAA 1JLLB 2VJBA 4QDKA 4AYTA 1JEYB 4PZDA 3C8HA 3CUWA 1TKBA 1QB7A 4YRBA 2G07A 4XFJA 4DLZA 1RRGA 4ZDKA 1VSBA 1DC3A 2C2KA 3EF3A 3UBMA 1OMOA 3K0AA 2CF6A 2WYOA 4EDHA 5BV2P 4BFCA 1WB4A 5CA0F 4ISCA 5FQOA 1Z2PX 2JCSA 2K87A 3HLYA 3HB1A 1CDZA 2NSJA 3K8ZA 5FBKA 1KVRA 2WNIA 3U17A 5ALMA 4EPVA 3WGYA 1IOVA 4HDRB 3GT7A 1ZI6A 5TT1A 4EKDA 5JH7F 3DAFA 1YDGA 1X8LA 3VMFA 2LZ0A 3CH7A 1D4AA 2IOFA 1YB2A 4ZJUA 5HM6A 4QT4A 5C81A 1Y6RA 4IUCS 4KDCA 3VTFA 1XZKA 4O0MA 1BEZA 3K35A 3HVJA 2WPNA 5DT9A 8ABPA 1ZJZA 1S96A 1UBKS 5CTAA 5JRJA 3UTCA 4KLAA 5AT1A 1K7CA 3T1HB 1LBIA 3AYXB 4UBJA 1ZI8A 5I8WA 1TLTA 2O8EA 5DI3A 4BO9A 1P9OA 2WP0A 2CFRA 2C0CA 2XHEA 3M33A 4OAPA 1ZOLA 4KQIA 1NR1A 1Y4AE 1HQCA 1BCSA 1R88A 1UC8A 1V1MA 4QHYA 1TZKA 3V7WA 4CCWA 3VYTB 1J0EA 1SO8A 4B4KA 3DVLA 3RSLA 3ICOA 4RD0A 3PX2A 5H8WA 1RYMA 5IS2A 2V7PA 1KP3A 2PDAA 2OA0A 3V7NA 4JUCA 4PXSA 1PWXA 4YCSA 1P7YA 4BO4A 3JQ8A 1N2SA 1WCWA 3WBFA 3P2MA 2P40A 3LYLA 5DRYA 1F2VA 2G4CA 3CUEF 4JQOA 2JFYA 2Y9PB 4AY5A 4EPWA 5CEEA 3L4SO 2ZUWA 2F8MA 4OKSA 3TN7A 3NNNA 3PI6A 2H06A 2XWJI 3T5BA 1OGIA 3KYDB 2YZKA 3NORA 1CUHA 1EAYA 1SUEA 3WYEA 3CNOA 1AKNA 5AVVA 3RVPA 4J3FA 1G64A 5ALRA 2IEGA 5EXXA 3OQIA 4C2BA 4KFUA 4AY4A 5C4MA 1GLNA 4NSNA 1Y9ZA 1YS6A 1E8NA 1O54A 1F2TB 1Q0RA 4N18A 1KH2A 5DM1A 2WTUA 3TX6A 3THSA 1T9HA 3L40A 2UZ0A 3QELB 3V1UA 1ZWKA 2AI1A 4QGBA 3AKYA 2TMYA 5CFLA 2QM3A 4IR7A 1GGNA 5ILQA 4HEA6 5ADVA 5K4HA 3A3YA 3FR8A 2OSVA 1ORDA 3TLZA 5C3MA 2OTCA 3HZHA 4W7IA 2ZDGA 4HWPA 4PHCA 2J46A 1NJGA 3AKZA 1MO2A 2R7AA 1X1AA 3PK0A 3H6HA 5T41A 1HT1E 2ID8A 3HB9A 2HXGA 3UFXB 3AZOA 4M6WB 3HFJA 1MGPA 2J6HA 3IUSA 2XCSB 2A0XA 4PQRA 4BNMA 1S5PA 3PQDA 4OTZA 4EVRA 1U1EA 3EOBI 2G76A 4QM7A 4L8FA 2I4MA 4BU0A 5JDIC 5B2ZA 4QBGB 3RC1A 3O90A 4AMUA 2GZDA 3TAXA 3EW7A 5GZ3A 3L0ZA 2C82A 4V1CA 3VM6A 1NBHA 4GOLD 1KSJA 6NULA 3UT0A 1WU7A 3NNSA 4XH9B 3D3JA 3OZEA 5LM3A 1IAVA 1BD4A 1LD3A 4IXWA 2B1GA 1U7PA 3VNQA 2APJA 4B3MB 4G1UC 2RIRA 2YWFA 4LGYA 1JDZA 3IAXA 4YXWD 4WZBB 4ARZB 5T4BA 1JHMA 4ALLA 2IH2A 4R68A 5EWJB 4YR7A 2RE8A 1U9YA 3IURA 3UG7A 2QYTA 3WGKA 2QE6A 1MC8A 2V7WA 4KQ2A 4UZFA 5ESRA 3BXOA 3BGVA 1NYTA 4E33A 2YVAA 3IBSA 2ZJ6A 1MW9X 4JI1B 4A82A 1A8SA 1PJRA 3BE6A 3RYHB 1F2DA 4CZ2A 2OXFA 5TS2A 5I48A 2IHZA 4CM4A 1ZGAA 3N39C 1N78A 2FSSA 3UC5A 4XYMA 2O8VA 5K1ZA 2RDMA 3LHIA 3PVZA 4JC0A 4PSAA 1QGYA 3M3PA 5KYVA 1R5JA 2FQ1A 2ZYHA 3C74A 3MJFA 2OFFA 4LZPA 5CLJA 2QEQA 2W00A 4GRDA 3SZMA 4D8XA 4YP7A 5C46F 5C5IA 1RYZA 4IDNA 4B80A 1CQPA 2QUBA 1TAQA 2I6FA 3LHKA 2X41A 3RROA 4NEGA 4BJ5A 4PONA 3RWOA 2MSLA 3EVCA 3I9KA 5TQVA 1QGDA 4QIHA 2XF8A 3M89A 2DOKA 1P0CA 2FRDA 3HJHA 5ICMA 1W5TA 1TD1A 4XWWA 1FDUA 3S29A 1OFGA 1L0BA 1Y8AA 1GVHA 1XL1A 4IOKA 2I34A 4JK3A 5EQDA 3WKCA 4GLLA 1Q0SA 4AT1A 4NZYA 2I2XB 1QLHA 5JZMA 3CCCA 1V35A 1PVDA 2OV8A 4RIHA 3OTGA 2DY0A 2OAGA 1AD2A 3RSZA 5DWVA 1DDOA 4XJTA 3EXIA 1KBOA 2QSYA 3JXEA 1KZ1A 5LSAA 3RU2A 4DGQA 3G0GA 5L3SB 2G83A 4EGFA 4JENA 2YICA 4R2KA 5E7JA 4KHPB 1HYGA 2ZUCA 3QX9A 2GRUA 5DM4A 4LHSA 3W8RA 4FWIB 1O9GA 1GA6A 1G60A 2GBPA 1B14A 2PAAA 3WYFA 2ISCA 1DQNA 2OKCA 1OXMA 3L7KA 4MCIA 2GR9A 2H2AA 5AKXA 3V32A 3AUTA 3PI7A 1U0JA 4LXXA 3U39A 3VOTA 4DJDC 4PN7A 1W5FA 2C2MA 5ENDA 4N0QA 3KEMA 2QLFA 5FOXA 1ST3A 3KOMA 1K0FA 2AOUA 1ZD2P 3KWFA 4ECAA 1OY1A 2OCXA 3EMKA 2EBFX 2ZPAA 1OD6A 4KGZA 4LJ5A 4BYMA 1AZSC 4DM3A 5K8IA 4R1MA 2QVZX 1E0AA 4ZCTA 3WXMA 2ORYA 4R9UC 4XD2A 2F62A 2VR1A 3QXHA 1C14A 2IHNA 4IVPA 3K70C 1E3MA 3RUDA 4JDPA 4LXHA 3KU4A 4J0GA 4UJ3A 3C2QA 4GM4A 5AK0A 2BDEA 4BUCA 5KTNA 4K9SA 1SRRA 4MRMB 2OHGA 4NS4A 3RFUA 1COWD 1GYPA 1JR3D 1JHDA 2PZGA 1X8KA 2WSLA 3ES9A 4UEJA 4F6RB 5ADHA 2R751 2X8AA 2A14A 2ZSAA 5C7IO 4D0RA 3G9XA 2XGOA 4ZODA 1KO4A 3AEQB 4M0CA 2AFVA 3TIVA 1XQYA 4JS0A 3IESA 4TN5A 2AWOA 1F4VA 2XNDA 1H93A 4M9CA 4P7GA 3ZD7A 4LWPA 4N5IX 4MV1A 3N6XA 4C4TA 2FRDC 2HHCA 4RM2A 1I1NA 5J4LA 1FLDA 2IP1A 1Q95A 3Q6IA 3QVVA 4HDMA 4LWQA 2XGGA 4CUKA 3QU7A 4ZT2A 1WZNA 4G6ZA 5HKLA 3S99A 1CEQA 3T3PB 4H7JA 3RLFA 3URMA 3N8GA 4GE0A 5GVRA 2MINA 1WMFA 1XFDA 3THRA 2CHUA 4AZSA 1CQXA 3SS9X 1QHIA 2O3JA 4FK8A 4YO8A 5EMJA 3GIWA 5I4KA 2I4OA 2JFFA 2IL1A 3E4DA 2IIPA 4OI0A 1DX4A 2XDQA 5THXA 1WCIB 4MV9A 3QMVA 521PA 1GPDG 1N8TA 1LQUA 2PFSA 4YV0A 1VE7A 2R7LA 5IKEA 3N1UA 1ZEJA 2YX1A 4ZCSA 1JBQA 3JPWA 2R6DA 2AFRA 2O7VA 2O9JA 3AJEA 5AVOA 3U44A 3OQMA 4B45A 3D2LA 4B33A 1R66A 3MA0A 4YJKA 1G7RA 1XK7A 1R3DA 2XCRB 3WX0A 3VNVA 2VYQA 2GAOA 2VBCA 4OL9A 1PJZA 1J5EB 2WIBA 2WWTA 5TGZA 1SCUA 1E18A 2Q1UA 4F38A 5D51S 1WX1A 3R9XA 4Z4QA 3ML1A 3ZY2A 1ISPA 4C6TB 1JKJB 1KEUA 1NP3A 2YWJA 3NOOA 1NRIA 4FP9A 4FYKA 4HB3A 4R9VA 4A1FA 1YS1X 3C8ZA 4FFNA 3WL7A 1SZJG 2EX0A 1ODTC 1X1TA 3GRYA 3HI4A 2B92A 4P38A 1N3IA 5D01A 1U8FO 3VOAA 2HWUA 1GL3A 3HVKA 2PZFA 3E0XA 4TXHA 3ZVRA 4URXR 4R2IA 3NAMA 2DUMA 1H23A 2FUCA 4HS4A 1FJHA 4QE3A 4K9OA 3TK1A 1M0EA 1U7ZA 2IYTA 4G86A 3B48A 4JP5A 5J2TF 4JEMA 1FVFA 1T29A 4KSBA 3K0FB 3PRHA 2H7YA 3L8GA 3WA7A 1TMOA 2WSSA 3RRMA 3NG1A 4OAQA 5F2OA 4G4JA 2REBA 1MB2A 4WY5A 4A6DA 5LJIA 4E5MA 2XOEA 4OB8A 4DV2B 2ALJA 3WKDA 4FFSA 4WFKA 4XTRA 3Q3IA 3GUYA 2ADFA 3IA2A 3KFXA 4L51A 3SZOA 1ODIA 1XLTC 3ELUA 3ITNA 2VF7A 4G5GA 4Z54A 4K6MA 4RZHA 4KQKA 5JE8A 1GNSA 5JAQA 3THWB 5TMBA 4PTLA 3I09A 4NZNA 2RHGB 4P58A 1NXQA 3JD3A 4G8BA 3EQ9A 4ZYZA 5E4YA 3WK4A 4YEDA 3NV9A 1XNGA 1KJ9A 1E92A 3W3AD 5JV5A 3OU7A 4NQRA 4A16A 2C1EA 1DFHA 1M34B 2R8ZA 1KZ6A 2OCDA 2A9QA 1XN1A 2C7OA 1I01A 2C9ZA 4R83A 5J47A 2C9BA 4QPNA 3SOZA 3CURA 1YOVA 1KDPA 2AYXA 3BOSA 3RYTC 1PGJA 3W90A 2QG6A 2CV2A 1FXWF 3L9WA 3CEHA 4QOGA 4INAA 4MGYR 2VF2A 3R3JA 4G5XA 5BNWA 2Q29A 1E9AA 4HVTA 4M53A 2QNIA 2JC3A 1PLJA 4EECA 3STWA 1OFTA 1OASA 4QYSA 1U7UA 2ODWA 4QNNA 4RMGA 2EKBA 3KZMA 1NX9A 2XQGA 4RLHA 4DSUA 3SC6A 3L4KA 4NPHA 2JGKA 4OB6A 4CMHA 4ZU1X 1LSOA 3BMQB 3IAUA 4P92A 1ZK3A 2AMVA 3G5TA 1A9XA 5UKDA 1PQYA 1T6BY 4OIMA 3ZCPA 2C8KA 1F2UB 3RHZA 4J0JA 4IMRA 1L7EA 1FRNA 3UWKA 1FFGA 2W7TA 4F3KA 2JEZA 4KW7A 2P5UA 1QE5A 1U2RA 4KAXA 5C4GB 2LD4A 2XI4A 3RYFA 3WLTA 4WI1A 2FTKE 2ZI7A 5DI3B 2JGFA 3UJHA 4MVWA 4CDNA 4MDYA 4E7OA 5C8VA 2QUIA 2AX3A 3ZY5A 4UXIA 5J63A 5L7TA 3TXAA 1W4AA 4BFXA 3JQRA 1TJ4A 3E82A 1Z0UA 5DKFA 4WKPA 1IY1A 3A58B 3IP3A 3G5AA 1IQPA 4UBLA 1GGJA 3AP2A 3JQ7A 4G09A 5JLAA 1QK3A 1RBMA 3THOA 3OLCX 2ZCVA 1XRRA 1Y63A 4PX2A 2J0QA 5GAJA 1P74A 5I7HA 4ALJA 2CMHA 3L49A 2AI3A 2WUVA 3GDGA 1IEVA 1W44A 3JSXA 1X7ZA 2HWWA 4BX2A 3ZZ1A 1GZ4A 3P20A 4DEVA 3QGMA 4DUPA 1Z7GA 2V7QA 2J3DA 3KOXA 4R0MA 4RDIA 2V0GA 1WZUA 3ADDA 1WXGA 3D6TB 1FTNA 4P9NA 1LPSA 1NXTA 1FS6A 1FP1D 2X7XA 3NFYA 1EXMA 2WU8A 3ZYZA 4BNZA 2V1UA 1GO2A 2ZJ3A 4X90A 1GZ6A 2B4KA 1R50A 1KL7A 4RF3A 2HA6A 2PBZA 2YRWA 1P80A 4CCSA 1WLYA 1XLTA 1XTPA 2Z9BA 2H85A 4MAAA 2FN8A 5BSEA 3W6NA 1IB0A 2Z8YA 3IE2A 4LXQA 3RSQA 1KQ3A 1X70A 2NXCA 5FHRA 4M49A 4Z3KA 1ZN7A 3F6CA 3MELA 4JX9A 5EINA 4YCMA 3Q9UA 3RS3A 2A5LA 2B5VA 3K20A 3O0DA 1WMEA 3AVOA 4DXAA 4M6WA 2G9QA 1B6SA 2X2PA 5HJ2A 3W4JA 4B79A 4ESVA 3ZJ5A 3JZAA 2NZXA 2W93A 3RABA 3AFHA 4TL7A 5K3CA 3TOVA 4CTMA 2V7TA 4GGMX 1YHNA 2PLWA 3FVWA 4GPEA 1WXEA 1QANA 1AKMA 1U8UA 3SIWA 2I54A 5FA8A 4GC9A 4C7KA 5B3JA 1KYWA 3GRZA 2WWHA 3L1UA 1OUMA 3QBEA 4UTPA 3TF5A 1PR6A 3ZOKA 2GF9A 2GXUA 2A2ZA 3KKOA 2E87A 2GN2A 1JQEA 3AUXA 1QIKA 3E7DA 4PPGA 5KJFA 2HDNB 2FSIA 2CFOA 3DTTA 3N2LA 2ZVJA 4S1OA 3R3XA 1P44A 3PU6A 2TS1A 3QVJA 4X1KB 2XUIA 5CNIA 1EBUA 3THXB 1RP1A 6LDHA 4NBSA 4P3OA 4WE3A 3S1SA 3FNBA 1KS9A 4E09A 4MI3A 2ZTMA 4AZ3A 4D45A 3CUVA 3HWRA 3ELBA 1NR5A 1VIMA 4WCFC 3K9WA 5JRDS 3IEVA 3VDRA 3TWOA 1W4BA 1E20A 1XA3A 4QU0A 4UAVA 4WNCA 4ND3A 4J6FA 4XLZA 1NVXQ 5AI0A 5C0OE 4ABYA 2C3PA 4FUQA 4BNKA 5ES4B 1LPMA 3EEIA 1QCCA 4WZAA 1LVGA 1S3SA 2CDNA 1PS9A 2JJQA 3COZA 3H13A 4HB2A 1Z0SA 2F59A 2ZG6A 3T7EA 1KC3A 3PHIA 5FBVB 5LQSA 4AURA 3CZ9A 3PIIA 4L27A 4RF5A 4O59O 3BHMA 1W25A 1XAGA 2V7BA 5TQ2B 1T3TA 4OVKA 3S3TA 1LF5A 4WD3A 4QVGA 5F1PA 3J81k 1XG5A 3B8HA 3CPSA 3T8YA 4I1UA 4YHHB 3UCFA 7GPBA 5KNDA 3BWYA 5IG2A 4R1UA 2IY8A 3SC3A 4YCAA 5SYMA 4RTNA 3AIMA 3IEUA 5C8ZA 2JVJA 5DNUA 3GFRA 2P2GA 2QPTA 3D6UA 3DCNA 1GUZA 2I6UA 2OFXA 4MDHA 1N5LA 1WBDA 5F7XA 4ASUA 2I5PO 4K81B 3TFWA 3PL5A 1JIQA 2BHSA 2IV3A 1FYXA 4D9EA 4YV2A 5L3SA 3DE4X 2VBIA 1SULA 2CCGA 5A5FA 1P9NA 2P0YA 1GPBA 3IRVA 3NAQA 3QFTA 4JJZA 4PLYA 4PYLA 5EG5A 3ZXYA 5CA1B 2WVGA 1T34A 1JFRA 3FZQA 2B4TO 4HH0A 4RSMA 1CUEA 1X7XB 1NBIA 1XRMA 1S8NA 2N47A 3FLAA 2GYVA 3V8BA 4KU4A 4YT8A 4DYDA 4GXNA 1YDHA 2P75A 2JHGA 1K5PA 4OQ4A 4G4IA 1LDMA 4DG5A 3C5EA 3ENNA 1KSHA 4F3TA 4EY8A 3MAAC 1WUTA 2A9FA 3CEMA 4ZPJA 1SZCA 3IMEA 2E4XA 5FTLA 4ENPA 2Q2VA 4KLCA 1P0QA 1VHTA 4EJSB 4MAFA 2F3UA 1JEOA 2OAP1 4KIJA 1YVEI 4NBRA 4W9NC 1CF9A 4XM0A 3FWZA 3I5UA 4X8LA 3UJPA 3QVGA 1QBGA 1ZCJA 5REQA 2P4QA 5A5GA 1VRWA 3NANA 3TQCA 2XQVA 1XAIA 1Y3FE 2L17A 4EPRA 5KNCH 1N9ZA 1WJGA 1D1QA 3AEKA 3AMVA 4RA6B 3ZW7A 4B47A 1JDSA 1GLGA 4WKGA 2C78A 4DSAA 4Z8YA 4H7HA 4BGIA 1CUDA 1OAOC 4OH7A 5U4XA 3VBCA 5KYUA 2V3WA 5LYJA 2NUPB 1GM5A 2VYCA 2HADA 4EOGA 4YIHA 4PZAA 3FVQA 4L16A 1MXHA 1E3JA 1IPHA 4G2NA 5EA2A 2H1SA 3UJCA 3RVKA 1KU0A 4XJXA 2WAOA 4O4IB 1HE2A 4LBZA 2PGJA 5JD6A 4HDSA 3AG5A 5BURA 4C4ZA 4IIJA 4O6VA 1HC7A 2PBRA 3O93A 4Q3CA 2CKDA 3GGGA 1VRVA 7REQB 3CHYA 1XEXA 3ESQA 3IXQA 3RW9A 1GG5A 2D2FA 1FFXA 1UJMA 5DXJA 1X1QA 1MABA 2KLHA 1MOSA 2XDQB 4FW9A 3M1AA 4IFIA 3IBTA 2JJ1D 1Q77A 4TTPA 4OCZA 3QPUA 3ZDZB 4RJIA 4WJZA 3ZGOA 3ZV5A 4ZEXA 4QA9A 5BSMA 3RF7A 4Z4CA 2ZRGA 1P6QA 1DBQA 1M83A 1FQOA 1P18A 2WKWA 2NV6A 3O73A 1SKMA 1J24A 2OQ2A 2A1TR 1U2GA 2FP3A 4GG1A 2HQ1A 3QIVA 2A3RA 4J9UE 4YYZA 2VL7A 2V8OA 1FTGA 1AVTA 4GLFA 3UK1A 3L0OA 3RVQA 1C1XA 3VTKA 4X8HA 1FMCA 2IY7A 3LZDA 1W5SA 2RH9B 2JCBA 2B8EA 1H3NA 3K92A 4J3JA 4OHZA 2PFKA 4CM3A 2FHPA 4IZOA 4UD2A 1YA8A 2FSVA 1G3QA 1O5TA 3CXUA 3LUBA 2DBQA 4KDEA 4IL5A 5FI1B 4TPKA 4A4DA 3H2ZA 4OMFG 3LKBA 3IV6A 4N5HX 3EDYA 1EK1A 3R5SA 3WV4A 3ACCA 1QIIA 2O3UA 5DDIP 2UAGA 3I04A 3WL8A 4R54A 1HFEL 2QRQA 5L3QA 3HY4A 3NH6A 4JCOA 3WDKA 3EZ2A 2JHFA 4J6EA 1F6WA 3RB8A 5EMMA 3WBBA 3CH6A 4GSYA 3GLKA 3F5DA 3NHAA 2R8RA 2CBZA 1W5AA 4BN5A 4FFLA 2OE2A 4MNTA 1T1EA 3K96A 5U1PA 1N75A 2HJSA 4TYWA 2CYCA 1UPUA 4YRRA 4I1OA 1BNCA 2ZYTX 3H19A 1J1UA 2XD4A 3PNVA 3GFOA 2ETVA 2XD9A 3SGLA 4AJNA 1PL7A 4Q4CA 2C2BA 5IPFA 3SHWA 1U0BB 3I8OA 1VXRA 1WXHA 4YALA 4DWJA 1DE0A 2II6A 2MMGA 1Z6XA 5LZ9A 1ATZA 4LQDA 4B4UA 2BDTA 1CR2A 4MYRA 4PNZA 4NYJR 2PSHA 4PWZA 3K1YA 5MGBA 1W29A 2B5WA 1JNXX 1N0WA 4PFJA 3QITA 3D43A 4HRAA 2HTFA 3WNQA 4DG9A 4EGJA 1WVMA 2EJTA 5DIFA 2FPRA 2KS6A 3JASB 1A2BA 4FHFA 2FZGA 3JYHA 4YRQA 3SCZA 4Q19A 2RHCA 1SU4A 4FYXA 3SMQA 3VGJA 3EGCA 4IDGA 5JD4A 5K5EA 2W6OA 1DG9A 1XL0A 2H31A 3IJRA 1Y1LA 2NUTA 3WQQA 4TTJA 3VU0A 3JWPA 4MCAA 3GPLA 4EIWA 1F4PA 5K3AA 5IJ9A 2CV1A 1WUIS 1R4NA 4P6VF 3Q5DA 1E2LA 2W6IA 3VR4D 5BQ3A 1OPXA 1DPGA 3QVLA 4Q4AA 3ICQB 3VVLA 3RYCA 1BJTA 4L9WA 2G04A 4EJFA 5JXGA 1RQ7A 1DIHA 4CVNA 2WZBA 3ZZTA 1E7WA 3MLEA 2GEDA 4F6LA 1RRPA 3GFSA 4XGRA 1VIDA 2W2LD 1D07A 1UEJA 3BDVA 1OWPA 3BXHA 1QFSA 3I72A 3Q1KA 4HWOA 3ABSB 1XRPA 4XQGA 5ENVA 2OBLA 1MOZA 2W42A 4CEJB 3P9XA 1DJPA 1F2UA 1UKAA 1QB8A 2DQ4A 3UMFA 4EVIA 4N3AA 5TJ9A 4TX1A 5FLYA 1J56A 3BWBA 1XVVA 2FUEA 4BQEA 4UC0A 4RPCA 2ES4A 4B0PA 4DR3B 4KP7A 2ZS9A 1V43A 1M1XB 5JASA 3T94A 4XIFA 1EBFA 1BJKA 2WFLA 2C29D 2QD3A 1NVDA 2BD0A 1NYLA 3DB2A 2Q8QA 1IJBA 5JI3E 3QY0A 4OP2A 4GNRA 3KG2A 4YRNA 5EP1A 4NCBA 2O5VA 1PG2A 2C77A 8ADHA 3NIFB 2V7XA 3MSCA 1C9KA 3MS4A 3K15A 3VPSA 2E49A 4JUAA 3D4BA 1RAAA 4JWTA 3KQUA 1FUIA 2IITA 1M34E 1AK2A 4G5FA 1BMFA 1NM5A 5J5CA 1O97C 4R6WA 4RD1A 2HDOA 1HQDA 2NVUA 3F46A 1NV9A 4EW1A 3RC2A 1USGA 2Q0XA 1H0SA 5EQTA 5EGSA 3EIUA 1XCOA 2BBWA 1W8DA 3ZDYB 5CCEA 4U2BA 1ONNA 3OQOA 2PRSA 2NYUA 1VPLA 3FOZA 1SXJD 4OJMX 4DMGA 4M86A 3JD1A 1U04A 2GN1A 2WJ3A 1DIBA 3SX4A 2W71A 1TVEA 4C0QC 1SHJA 2CJYA 1T4GA 2YUIA 4RIFA 2ZFUA 1L7PA 3LHDA 4IDFA 4UULA 1REQB 1PFUA 3PQ3A 3BZUA 5AVQA 2QF7A 1D1PA 3BSWA 1HYHA 1NHWA 3CZ4A 2OO5A 3DE7X 1NFFA 1T0UA 3EPLA 2P0EA 4RSGA 1D3AA 3N53A 5K05A 3TB4A 2RHMA 3DCYA 2BGLA 1H1LB 4K6HA 4XCXA 4OQYA 5FUVA 2O8FA 3IMKA 1LTKA 4W1PA 3JQAB 3DS8A 3FGNA 4IX1A 1A2OA 1GTVA 3RTGA 4LPKA 3DAYA 5DXAA 1QCDA 3GPBA 2EDCA 1I1QB 1EGMB 1I6MA 2GEJA 2J5KA 1GU7A 1N6HA 3MOGA 4FFVA 1I4TD 3COJA 4BE7B 1FJ2A 2P2ZA 4FCTA 4R2MA 1EGHA 1VPDA 4CF5A 2G80A 2JAHA 3I2FA 4HLDA 3NVAA 3OIDA 1SHTX 1QOPB 1JU9A 2IX9A 3T99A 2D2IA 3U4MA 4ZV9A 1Q16A 2VPIA 1ESDA 5CFRA 2ODEA 1JA0A 3THXA 3VHLB 2FWNA 4DFDA 3C7TA 4GLJA 4A2CA 2DP4E 2HA2A 3OZUA 4ZOQI 1TO6A 2XH8A 1ANKA 4MA4A 4LRUA 1A5ZA 2O52A 5DGCA 3S7ZA 4CBVA 4YRMA 1GKYA 2C59A 5EJAA 3WWYA 4ZO9A 4GP6A 4J3NA 1XZBA 2X1HA 1Z8HA 3DQZA 2G5CA 3D0OA 1ARZA 1HY3A 2VXYA 3BD8A 3MTDA 4ZJZA 4X1YB 2H59A 1L1QA 1E60A 4LWOA 3AL0C 4H15A 5IXYA 3H8SA 1Z74A 1QH1B 1KZGB 3MTQA 2F8LA 3T5PA 2W0MA 2BEUA 4HQLA 1X39A 4GWLA 3ABIA 3CMMA 2COKA 1Y8QA 5GMOA 4D8VA 5EOVA 1I5OA 5AVZA 4TWZA 1V5EA 4F4FA 4QTUB 3KRTA 4EFDA 1OLUB 2K4MA 3NB0A 1OXKB 5JNVA 2O2CA 2PZLA 1HDEA 3VX3A 2JDID 4YBZA 2AXPA 4IGEA 2GHIA 5EPEA 1WUJS 4NTZA 3LY7A 1DQRA 2RKBA 1U02A 3K6SB 3WK9A 3ZHQA 1NFRA 1HNWB 4MEBA 4RFSB 1RLMA 1RLUA 2IPOA 3CW8X 1UWVA 2BR5A 2IHKA 4LHWA 5L3ZA 3ZWVA 4E08A