1E92A

Pteridine reductase 1 from leishmania major complexed with nadp+ and dihydrobiopterin
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
283
structure length
268
Chain Sequence
VPVALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQADLSNVATAPAPVTLFTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLRNDGDREAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVWEGHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSLTRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pteridine Reductase Mechanism Correlates Pterin Metabolism with Drug Resistance in Trypanosomatid Parasites
pubmed doi rcsb
source organism Leishmania major
molecule tags Pteridine reductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 99
structure length 268
sequence length 283
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2000-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1e92A00
3DR3A 1UDAA 4QFDA 2FR1A 1CF2O 2ZQZA 4XIYA 4IJVA 1KEWA 2GN6A 3W8FA 1GYPA 2VRBA 3JQ7B 3K73O 4XB2A 3CUKA 3TN7A 4IPTA 1HSZA 1MUUA 5I9MA 1C1DA 3K96A 2PKQP 1UP7A 1UP6A 2ZK7A 4CQMB 1U8FO 1N1GA 4ID9A 3TWOA 1NPTO 5CPBA 1I01A 3G0OA 4ZQHA 3TPCA 5EQFA 3PRJA 1ZCJA 3AM5A 4M49A 1N1EA 1KY4A 2BGMA 2EGHA 3AI2A 4MP6A 1LLQA 5CEJA 4XJSA 2ZQYA 4LISA 5TLSA 1LDEA 2NADA 3NTQA 2D1YA 5ADHA 1NR1A 1DJQA 3ANNA 3AW9A 2O7SA 4XKJA 3SC4A 3PDUA 3RUFA 3A14A 3F4BA 4E33A 3H9GA 3L07A 5TRTA 5L4NA 1DIHA 4J91A 1GEEA 4JBHA 3ROQA 5I7SA 1Y8QA 3PHGA 2JD1A 4BNLA 4R69A 4D44A 4NIMA 1NFRA 1LDBA 3TL3A 4I5DA 5AVOA 4XDYA 1EEHA 2HRBA 2JKVA 4BUCA 4FW8A 4HXYA 4P8RA 3K30A 3AOGA 1IOLA 1T2AA 3C1TA 4LSWA 1L1FA 3ICCA 8ADHA 3PFFA 1EE9A 4FFPA 1IPEA 4L4XA 2PV7A 4JJGA 3D3WA 1QLJA 1IY8A 2B5VA 4GVXA 4JX8A 2OP0A 4ALJA 3BIOA 1GAEO 1HDXA 4RF2A 2VRCA 4GGPA 3GF4A 2EG9A 3I6QA 4EZBA 2LDXA 5JLAA 1Q7BA 3OA2A 1XKQA 5IDXA 1PIWA 1Z82A 2NWQA 3E48A 4D41A 3BA1A 4MPDA 2GRAA 3UHAA 4R9SA 3EC7A 1KEUA 3WMWA 2YV2A 2WYUA 1ZJZA 4TVBA 4RVSA 3TZQA 2C5EA 3QVTA 3E8XA 4BO5A 1GTMA 1W4ZA 3OETA 3HADA 3R3SA 4YJGB 4LRTB 4B3HA 1NR7A 3HQ4O 3JCZA 1H6BA 3HDJA 3D1LA 1LBEA 4OO3A 3DMTA 2ZTVA 1Y8QB 1YQDA 4J0FA 2TMDA 4IZHA 1KEVA 1U3VA 4ALLA 1E5QA 5HM8A 1VL0A 3WYEA 2YFHA 3WSVA 4TQGA 1ZBQA 3O38A 5TGDA 4DLBA 1O6ZA 1SB9A 3GC6A 4P38A 1GYQA 3WGGA 3KEQA 3KEOA 2Y66A 2PH5A 2GN9A 4UUOA 3DBHA 1JKJA 1JQBA 1UXHA 1E7SA 2JHFA 1UAGA 4JGBA 4GKBA 1P33A 5K6AC 3INGA 1VI2A 4YT8A 2WM3A 1E1KA 3O8QB 2O4UX 1U8XX 3L4BA 4GWGA 1YL7A 1SBYA 1I3NA 1EDZA 2EP5A 1QYCA 1CEQA 2VOEA 1R66A 2YDXA 3N58A 3H3FA 1XYGA 4XR4A 5ES3A 1PJSA 1ZVMA 4GX5A 2HK9A 4Q3EA 3ANLA 3JD1A 1X0VA 2NVUB 3QVWA 2RBEA 2Q46A 4NBUA 2F00A 2DTEA 1UXGA 1ENOA 2O2SA 3ZWNA 5FI5A 1I2ZA 3WFIA 1I3MA 1ZNQO 1LEHA 1FDVA 1I3LA 2FHSA 2X0JA 3D5QA 4FIZA 3GR6A 1DRWA 1GUYA 2EKQA 4TRJA 3RBZA 1G0NA 1LX6A 3VPGA 1DC5A 2P91A 3K8ZA 2YQ4A 3U4DA 1W6UA 2H9IA 3ROPA 1U3WA 3AUAA 4YBZA 4CR7A 5IXYA 1BDBA 4F45A 2AEMA 4WCFA 3H6KA 1LQTA 6LDHA 4Q39A 1PSDA 4R68A 4A26A 1T4DA 4P4LA 4GI2A 4IDBA 2V6BA 3CIFA 2RH4A 1B3BA 2ILTA 3B20A 2DT5A 1AE1A 2FPPA 3JQGA 4XQGA 1FDWA 1SO8A 3ZU2A 1ONPA 4ZQGA 4DLLA 3ZV6A 3GRKA 1ZZEA 2WJPA 4XGIA 4CQLB 4M89A 3JD4A 2C2YA 4WNIA 3OICA 2HMUA 3FR8A 3PGJA 4MVJD 5THKA 1WZIA 3JQ8A 3ZN2A 5K0ZA 1PL7A 1SMKA 2OBNA 2E48A 4GH5A 2E49A 2DBRA 3U5TA 2Z95A 5CG1A 1P9LA 5T64A 5DBFA 1YBAA 1Z75A 1TT7A 2G5CA 3DHYA 2IEBA 4J4HA 1UXIA 2Q2VA 4G5HA 1EDOA 4NDNE 4BS9A 4FR5A 1NQOA 2ZTMA 1LDYA 3DTYA 3RC9A 2BMAA 3DMTC 5JYEA 3RSHA 1ZSYA 4M87A 2BKAA 1G0OA 3JYOA 4MIEA 4A0SA 5BQFA 3H2ZA 4TSKA 4PVDA 4EDFA 4EITA 3ZGYA 4PZEA 3ZI0A 1YXMA 5T57A 3KTDA 1ONNA 1WPQA 1E3WB 4ZD6A 1R4MA 3AM4A 1Z7BA 2DFDA 1GZ6A 4K1LA 3SX2A 2X5OA 1Z6ZA 2B0JA 4R01A 4BGIA 2GASA 5DULA 4W99A 1VJ1A 3KZVA 4Z9FA 2C2XA 4DTIA 1EVYA 3OP4A 5C5IA 2Q4BA 1H9BA 3KLPX 7ADHA 1FF9A 4AJEA 3RFTA 1EUZA 2DKNA 2ZB7A 3MJVA 4JJFA 5U9CA 3FTNA 3F3SA 2I5PO 4AJIA 5KCZA 3OJOA 4WLOA 3C7DB 3HUDA 3K2EA 4IBOA 3KYDB 4ALNA 4WCDA 1R0KA 2O3UA 1IE3A 4YACA 4XD2A 4OIMA 3EK2A 2IXBA 5A05A 3WIDA 3ZNOA 1KETA 4OQYA 4AVYA 4D45A 5A04A 5JAZA 2C5AA 2XXJA 3W6ZA 2CY0A 1X7HA 4HUJA 2GN8A 1Q0LA 1LLDA 4WEOA 5ER6A 4IDCA 3E82A 4CLHA 5AQ1A 1Q2XA 1KVTA 2EV9A 3PDJA 2VT2A 1L7DA 4Q3DA 5AXBA 1IHXA 1NQAO 3QWHA 2VHXA 2JFHA 4FOSA 1X1TA 3PIDA 5THQA 4I08A 2FP4A 4LW8A 1JDJA 4PCVA 2VOJA 1QYXA 3OJFA 4W4TA 4XQ9A 8LDHA 1SAYA 3DMYA 3RUAA 1TEHA 1M2WA 3GEDA 4RPLA 4XZ3A 4O1MA 1CIVA 4GX2A 4XQCA 1YJ8A 4RDIA 5EN4A 3GAFA 2FSSA 3T4XA 1J49A 3JQDA 3EUWA 3MZ0A 3OQ6A 4PZDA 3LZ6A 1LLUA 2FOIA 3RUEA 3N74A 4E3ZA 3OSUA 3ZHZA 4CLOA 4KUEA 4YJFB 4BNNA 3TF5A 1JVBA 2BFAA 3OEYA 5HBRA 3FN4A 4CLRA 2I3GA 3AI1A 2O3RA 4FJ2A 4TRNA 1GZ4A 5KTKA 1IULA 4JXKA 4CMCA 1TLTA 1ISHA 1JA9A 2BLLA 3AY7A 3DFZA 4DQVA 4BKQA 1P0FA 3CPSA 3ETEA 3OJEA 1HDGO 1B14A 1HEUA 2EF1A 4Y6SA 3ORFA 2YUTA 2D8AA 4ND5A 3WGOA 3BTUA 1YO6A 3I9KA 5JFOA 2ZJ0A 1T4BA 1CDOA 4JJIA 4WECA 3DC2A 5FEUA 3H2SA 4MVJF 3PZRA 3NGLA 1V9LA 4L8VA 1VRWA 2P9CA 1C1XB 5BSHA 2J8ZA 4GX0A 4D0SA 4I8XA 5AXCA 5L40A 2OBYA 1NAIA 5ILGA 1N5DA 4IJWA 4OXKA 4IIUA 3WWYA 3OJ0A 2TMGA 1ZK3A 1K3TA 5KVVA 2HMSA 4PRKA 5AYVA 3Q9NA 4HKTA 2BELA 4QUKA 3WMXA 3GK3A 1E6EA 2Q2WA 5LDHA 5DF1A 1HZZA 3GMSA 3COSA 2CMDA 4TKMA 1LRLA 3HFGA 1Q0HA 3NTOA 3M6IA 3HG7A 4OKNA 3UUWA 2W4QA 5A9RA 2JFFA 4PGFA 3ZZNA 4ALKA 4FJ0A 1NAHA 3A9WA 1QYVA 4PG7A 4YJFA 3EDMA 1ADCA 1H6CA 2G1UA 4AG3A 2QQ5A 2X22A 1DC3A 1Z7EA 2HU2A 3NJ8A 3AOEC 4LSMA 1EBFA 4PG5A 3DZIA 4NI5A 3MJCA 1CJCA 3WQRA 5ENVA 3BMQA 2OZPA 5BR7A 3H9QA 2VZ8A 3B1KA 4YR9A 5KKAA 4WPGA 4BO7A 3V2HA 4AJNA 2RHCA 2FZWA 1G6KA 3AU8A 1DPGA 4WGGA 3P19A 3QLJA 4GLOA 4NH4A 3JQEA 4J9UE 3LC7O 4JLWA 1OBFO 4BNMA 1MLDA 4YAGA 4MVJG 1A27A 4KUGA 1EQ2A 2EEZA 3BTOA 1E3SA 4PRLA 2GN4A 3PJFA 4CLDA 5KVCA 4IDAA 5KKCA 4CUKA 2GUGA 3VPSA 5HS4A 3S2IA 1C3VA 1MX3A 1F17A 2G76A 4CMBA 4I5GA 5EPOA 2CFCA 2IODA 1H2BA 2YHIB 4NK4A 4OMUA 4Q3AA 5H81A 4Y6RA 3TJRA 1ID1A 1AUPA 1QG6A 4J6FA 2NU6A 2WMDA 3SJ7A 5JY1A 4BNIA 4BKPA 4RPGA 1C0KA 2P9GA 3PFWO 1YBMA 4M55A 1HE3A 1ZKMA 3GVPA 1JAYA 5IZ4A 1LTHR 1NPYA 4U6SA 5L7TA 3I9LA 3OJLA 4KDFA 4L0QA 2Q1TA 4LK3A 2NSDA 4E6PA 1DHTA 2C20A 1GD1O 3I9OA 3CZMA 4Y98A 3V2UA 3DAGA 4PLCA 4F6CA 1GZ3A 3KV3O 2ZYAA 2VWPA 2ZIZA 3ICPA 3L6OO 3OM9A 2WSBA 1IZ0A 3OIDA 1YKFA 2OORA 1E5LA 3V1UA 9LDBA 1PJ3A 1UDCA 3D5TA 5LC1A 1QLHA 2DU8A 1DB3A 3C7CB 4CM9D 3QWFA 1DIGA 1YDEA 3I9MA 1KVQA 4OOFA 1C0PA 5KJFA 1OFGA 4A2CA 4PN3A 3H9EO 3ULKA 1RJWA 4RVDA 3W8EA 5A5FA 4R51A 4Y6PA 3DEYX 4M8SA 3ZW8A 4YPOA 1PJQA 1U5AA 1E3IA 4JROA 4OOEA 3GN1A 4L76A 2CSUA 2QRKA 1MFPA 1PJ2A 2D5CA 3C24A 3LSYA 4L75A 5JDIA 3R3JA 3F4LA 2GYYA 4YB8A 5J23A 5JDIC 5EQDA 5L51A 1HTBA 1RM0A 1EVZA 4J4TA 4NMHA 4Z0PA 5L4SA 5IDQA 4MP3A 3UFXA 2BGKA 4FFMA 1R0LA 3NT4A 1HYHA 1X14A 2JJYA 4YT2A 1FJHA 2HDHA 3L6EA 5AXAA 2I76A 1XCBA 5IG2A 3ROKA 2B5WA 3TOXA 4J3FA 3H5AA 3WFJA 3EZLA 1MGOA 1P0CA 1P77A 3OECA 4FGWA 2OGUA 2I67A 3INTA 4E21A 3WIEA 2QX7A 1FDSA 3JQBC 4AFNA 1U1IA 3VVCA 3O4RA 5EESA 3IKTA 2VZ9A 4YRBA 1ULUA 5ER9A 3GNTA 3F1LA 3WX0A 3DAPA 5F1OA 4BNXA 4KWHA 1MG0A 4J7UA 1I10A 4ROSA 4J2HA 1OC4A 1EK5A 1AHIA 2NV6A 1ENZA 3H9JA 5JAQA 5G0TA 1O5IA 3JQAB 3PWZA 3GG2A 2AXQA 3T7CA 1ARZA 4IXWA 4CV3A 4BNTA 4BMVA 4URFA 1RYDA 1E3JA 2VNSA 2WYVA 5TX7A 3F5SA 5AXDA 4Z9YA 3ZWYA 3PEFA 3KSZO 3KYCA 2NVBA 1ISFA 3K31A 5A02A 4QT0A 4ZRMA 4R41A 3I5MA 3TOZA 2B83A 3OA0A 4WLUA 1ADBA 2E4AA 4QEDA 3RC1A 3I23A 5L9AA 2EW2A 2ZATA 4FD3A 5G4KB 3ENKA 1XEAA 1T1RA 4R1SA 4BHTA 4CM3A 2ZB4A 3PZBA 3OH8A 1BHSA 3FD8A 2ZYGA 4E2YA 1B0AA 5KJCA 1PL8A 1Y81A 1P1IA 1JLLA 4GPD1 5H83A 5ENDA 2HAEA 5CEFA 3BAZA 1DLJA 1XU9A 3QHAA 4YAKA 2VUTA 3CZRA 1GFSA 3F47A 5L53A 4RL6A 4AJKA 3OMLA 4D46A 2VZ0A 4GQAA 3HWRA 4Q3CA 3GAZA 2O7QA 2WD7B 2DBZA 4IQGA 3CEAA 5A9SA 2QYTA 3Q6IA 5C7OO 4AL4A 4CLOB 4W7IA 1VPDA 4IGEA 3SBOA 2C7GA 3ADPA 3M1LA 3PHJA 4ND2A 4WOJA 5TC4A 2CF5A 1Y8RB 3GT0A 3D64A 5EERA 4QECA 4OXNA 2PGLA 2UAGA 4BV8A 3L4BC 2HK7A 1E3EA 1LDGA 2FRDA 3AY3A 3TDKA 4F6LA 4HFJA 2IE0A 1XIVA 4XIJA 5JAMA 1IL0A 3AOEA 1PQUA 2EP7A 1EVJA 3DAFA 3HDYA 3IKVA 3QVOA 4JBGA 3S55A 5JS6A 5T5QA 2VYNA 1ENPA 2AQHA 3WLFA 4UEKA 3U3XA 1O8CA 4O59O 3VVBA 2VWGA 3BTVA 3RI3A 1LUAA 4Y8VA 3CXRA 3GDGA 4UUPA 4OYRA 2NU7A 2AQIA 4WOKA 3ADOA 1YL5A 3AWDA 1BXKA 4RGBA 1GCUA 3H5RA 2BFPA 1V0JA 3VTFA 5I8ZA 2OXIA 3UCEA 3CINA 3IOYA 4M86A 4E5MA 4AJ2A 2X7HA 2ZCUA 3DBRA 3KM0A 4OQZA 5DOZA 1K6XA 1LDNA 3GFGA 4MVJP 4AJPA 4WE3A 5C3MA 3HE3A 4ZU3A 1C1XA 5FYDA 2NLOA 3PWKA 2DBVO 3A4VA 2Y1DA 4Z0TA 2Q49A 3CE6A 5TT0A 3MWDB 5TQVA 2IXAA 1BXGA 1T2DA 4Z0HO 1JWAB 1DHRA 5DNAA 4BO4A 3G3EA 3Q1LA 2PY6A 3DWFA 2VT3A 4CPDA 2GPTA 2PGJA 1P1FA 3WTCA 3NJ4A 2GR9A 1JKIA 2J5QA 1UDBA 1XR3A 2Y1GA 2D5AA 2DM6A 4G65A 5EINA 2X9GA 4CUZA 3PLNA 4YJHA 1E7QA 1UZNA 1ZK4A 1ISIA 2Q99A 4Z9XA 3RBVA 3WB9A 1M67A 5GZ1A 3LLVA 2AQ8A 4I5FA 3PVZA 2O2YA 2P5YA 2QZZA 1IB6A 2AQKA 1M76A 2DVMA 3PHHA 3Q2IA 1K2WA 1QSGA 1VL6A 2E6UX 1JU9A 2VYND 2IRWA 4UUMA 3UKOA 5ICMA 1DIBA 1BSVA 1GDHA 2NTNA 1N92A 3IJPA 5JCJA 3FWNA 5F21A 4RV9A 4BNVA 3D4NA 1H6DA 1XHLA 1CYDA 1GYRA 3VPXA 4XYGA 4K6FA 4ZICA 1JVSA 1NYTA 4BOYA 4Q3NA 1CETA 3NUGA 3P2OA 1Y5RA 1YB4A 2AE2A 4U0JA 2RCYA 1FDUA 1HDOA 4KP7A 2FY8A 1YOVA 2YZ7A 1ISGA 3QV1A 4S3MA 1M6WA 3R6DA 3DZBA 4X54A 1CQIA 1NFFA 1LC3A 1ML3A 4EJMA 1WP4A 2X58A 3PJDA 1F12A 1D1TA 2ZJ1A 3JYNA 4P22A 5T8KA 3VH1A 4CMIA 1E7YA 1ZUD1 3RUHA 1YGYA 4UVHA 1V3VA 4HADA 5JCJD 4NBVA 1XELA 5U1PA 2A4KA 2GNAA 2J6IA 2A92A 4IINA 3L6DA 4PFJA 4RQUA 1Y1PA 3EHEA 3EGOA 1HZJA 1B26A 3FR7A 1ISJA 3RKUA 1HSOA 1FK8A 2ZB3A 2Z5LA 3AJRA 4AJJA 4BNZA 4YAEA 1BW9A 4CM7A 1I0ZA 1P74A 3GA0A 3RJ5A 4DMLA 2CF6A 4B3JA 4CM9A 1Y9EA 4IIVA 2O3TA 3ZHXA 3ZV4A 3JQ9C 3BHIA 2W2KB 3TQHA 3ZWWA 4MVJE 3D4PA 3ZCXA 1PGPA 2Y93A 3MJSA 1Y6JA 2HUNA 3KYBA 3VC7A 1LA2A 2D3TA 2P2SA 1P1RA 1GADO 1YB1A 5DZSA 4UVEA 4BGEA 1HWYA 1T2CA 2G17A 3I4CA 3GH3A 4CMAA 2NUAA 1X7DA 4CQLA 3ONFA 3S2GA 1FDTA 5JO9A 3FBTA 3WLEA 2CVZA 1YJQA 1MXHA 5DT9A 4XYMA 1I8TA 3LQFA 5BSGA 1IUKA 5LCXA 5B4TA 4YA6A 3DO5A 5JMWA 4RZIA 1HLDA 3K6JA 4HNGA 1I5RA 5A3VA 2POQX 3BXXA 2X9VA 1V35A 4YAIA 1B15A 1ULSA 3L0DA 3WYBA 3TFOA 4HFMA 1GQ2A 1E0DA 3MCVA 4O6VA 3F5QA 4BGVA 4E32A 2NTVA 3LYLA 4UVGA 4AJHA 1VSVA 3BMCA 7MDHA 2NACA 3DOCA 1YL6A 3M1AA 1GPDG 3RQSA 3IJRA 2XAAA 2R00C 4PLGA 4CL8A 2D0IA 4RF5A 4QTZA 5G0UA 4BO8A 3FTPA 2I65A 2J5KA 4CMIB 3QVXA 1E6WA 4UULA 4IUYA 5A9TA 4XX0A 4O63O 2P4QA 1LI4A 4FFRA 4RO0A 4J4BA 3BHJA 3GVHA 3PP8A 3JD3A 1MV8A 1WW8A 3JTMA 3I9JA 3K5PA 4FN4A 4XCVA 3UN1A 3V1TC 1AXEA 2VUUA 4RVUA 1NWHA 1ZSNA 1ZXBA 5A06A 2AEFA 3JYLA 3WJAA 2EHDA 3DTTA 3KYCB 1R37A 2CDCA 4GLLA 3P5SA 1A4IA 3GGPA 1H2HA 4R9RA 3TZKA 4INAA 1RPNA 1WLYA 1UZLA 5IAAA 3HDQA 2JCVA 3GUCA 4ZN6A 3PQDA 3QVSA 4JK3A 2CUKA 4LVUA 3S2EA 4D3FA 2X0IA 4JIGA 4R1NA 3D3WB 4FBGA 4D0RA 2RAFA 2CZCA 4NJOA 1F14A 2I99A 1LSJA 4NFYA 3QIVA 1DRVA 1ZMOA 3PIIA 3DDNA 4BV9A 5CDTA 5JCXA 1A7KA 3V2GA 2JL1A 3V1YA 4R1TA 3JQFC 4ILKA 1OMOA 4LMPA 1OOEA 3I6IA 4FFNA 5JC8A 4IMPA 4CMJA 1ZO8A 4J9VA 1T25A 1Y7TA 4NBTA 4A10A 4E2XA 1C14A 3FRJA 1CWUA 1D7OA 3AFMA 3IUSA 3RUIA 4G81A 1TXGA 3DONA 4C7JA 2Y68A 2QYSA 1EFLA 2CNBA 3NAQA 3I83A 1CERA 4BO9A 1RWBA 3IQDB 4BKUA 5K9ZA 3UCXA 4GMFA 4EGFA 3QY9A 3DB2A 2VNAA 5BSFA 3W4KA 4IS2A 3ZU5A 1XU7A 3BZUA 1M66A 1O0SA 2RIRA 2W2KA 5DOVA 2Y0EA 3V8BA 4BO6A 3QWIA 2Y05A 3FNGA 1L7EA 4BVAA 3PYXA 4XQEA 4WEQA 3JSAA 5HTOA 4DRYA 5C7IO 5B37A 5IFLA 1LQUA 3A1NA 4HY3A 1NM5A 3JQFA 3GDOA 3ITKA 4ZGWA 3MTJA 4BNGA 3G79A 2D2IA 4DC1A 1JTVA 5BNTA 2C59A 4H7PA 2BI8A 1P44A 2C54A 3LVFO 3E18A 3HDHA 4PLYA 4XA8A 5CP8A 1T26A 2UVDA 3RUCA 1BMDA 3V5NA 3VH4A 4A5OA 1I3KA 2ZTUA 1H93A 3L4SO 3RCBA 3RVDA 1QMGA 3W1VA 3GRPA 1N2SA 3SC6A 1B3RA 4EI2A 4OKIA 1KS9A 3MJTA 2NQTA 3IP3A 3IL2A 4HBGA 1HT0A 2X9NA 3P7MA 1ZEMA 4Z6KA 2DTXA 3BMOB 4BO2A 4NBWA 1PTJA 2PR2A 2QIOA 1ENYA 3UAGA 5KNLA 1U9JA 3DHEA 3U0BA 2VHZA 4EYEA 1M75A 1DXYA 1P3DA 1B8UA 5U4QA 3TZ6A 1MG5A 3OQ1A 4MINA 1GUFA 1C0LA 3DBHB 5L3ZA 4D3SA 5DCYA 1WDKA 3NV9A 3RU7A 1NTOA 5CDUA 4A03A 2CDAA 1EFKA 1ISMA 1I32A 4BB6A 3VDRA 1GV1A 3DZHA 1LC0A 4WK6A 4RLHA 4PLWA 1ZEJA 1SC6A 1U28A 1ADGA 1LXCA 2QRLA 3ASUA 1HE4A 2IZ1A 5COAA 2PNFA 1HYEA 1NQ5A 1PJCA 3JD0A 5JDCA 4LMRA 1PGNA 4CM4B 1XLTA 1BWSA 2DUWA 3ZV5A 1MB4A 4KOAA 4MDHA 2H1SA 3NT2A 4OAQA 1WMAA 1YS4A 1R0SA 1KY5A 4W82A 3E03A 5C7LO 3ZWAA 2Y0CA 1OZAA 1HL3A 3R0IA 1LRKA 3E9MA 4XRRA 1BXZA 2P9EA 3WTBA 4BL5A 2FR0A 4GL4A 4J1QA 2P5UA 3GEMA 4PIVA 1YH3A 5GZ3A 9LDTA 5I8WA 1WVGA 2EKLA 3F46A 4CMGA 3CSDA 1EQUA 1Y5MA 5T8KC 2YJZA 4BNHA 4ZQFA 2HK8A 4OHUA 1GU7A 4RPJA 2OUIA 3ZWXA 3KB6A 1YQXA 3ZNPA 1HXHA 2FZEA 1BRMA 1HLPA 4UVIA 3BMNB 5JPIA 5CHEA 2HQ1A 3QWBA 1K6IA 1ZSVA 2VCYA 2NU9A 5AOVA 3FHLA 1SZJG 5L45A 1O9BA 3JYQA 1UR5A 1NVGA 2EJVA 2EWMA 1K6JA 3D3EA 4DYVA 2NU8A 3JQ9A 3ROMA 1E7MA 1NVTA 4P4GA 3PK0A 1PJ4A 2J3HA 5KWEA 2FSVA 2B69A 3LC1O 4NJMB 1O94A 4HNHA 1SOVA 2R6JA 2PD4A 1XA0A 1Q7CA 2NTJA 4DIFA 4CM8A 3OEWA 1NVMB 2J3IA 3K9QO 1W0CA 4WJZA 1EVIA 2PK3A 2I66A 2EIHA 1E7WA 3SJUA 1GV0A 5F5NA 4DVJA 1JKFA 2WE7A 2QHXA 1Z45A 5COQA 3E5RA 3H7AA 4DYDA 1UP4A 1JAXA 1RYEA 1T1SA 2O3SA 1Q1NA 3SEFA 3X2EA 4HX5A 4XGKA 1R4MB 1NBOA 3HNPA 3NDJA 3LLSA 5EIOA 4MIOA 1XG5A 4PVCA 1HE2A 2SCUA 4CR6A 5L4LA 4EJ0A 3HB4X 4R5MA 3WXBA 2Q1SA 2V6FA 3AUUA 4CLRB 1SNYA 2V6GA 2ZTLA 4OGWA 2BRUA 4U8GA 1DAOA 4NQZA 1DC4A 3M2TA 3GZNA 1R16A 2PD3A 1UXKA 2QG4A 2PZMA 4G2NA 4J7XA 4IY1A 4YXFA 4DREA 4RORA 4KMSA 4JP3A 4LGVA 1F06A 3AY6A 4PG6A 4PLHA 3ZDFA 5A3JA 2A9FA 4NNJA 2WE8A 3A06A 3CMMA 1NFQA 1U2GA 3GDFA 5TS3A 2O3JA 3JQ8B 2CVQA 4XGNA 4DQUA 4QXMA 4BO1A 3LT2A 3B1JA 1NXQA 1WAMA 2WDZA 3H8VA 3PYMA 1X7GA 4R54A 3QE3A 3IC5A 4WLNA 2YV3A 4YJHB 2Q50A 2J3JA 3RC7A 1LU9A 2P4HX 4OJNA 5BSEA 2YQ5A 3IS3A 1BTOA 1QR6A 3GNSA 1IHYA 3U62A 4LRSB 4EJ6A 3JQAA 4OL9A 1VJ0A 3MJEA 3QW2A 5G0SA 5HWSA 1PU2A 1BW9B 3JD2A 3KO8A 5ICSA 1SB8A 4PLZA 5GMOA 3LF1A 1E1LA 5TNXA 5CFZA 4CQMD 3RWBA 5I7VA 2A94A 2E37A 4FC7A 4ND1A 4J49A 4DXHA 5IJZA 3A28A 3JQ6A 2X1HA 5COBA 1IPFA 1C0IA 4XB1A 1UH5A 4GMGA 4FOOA 2GZ1A 1VC2A 4IDGA 1PWZA 1GQQA 4CLEA 3ZW9A 4WUVA 4ZHSA 5EL0A 2WEKA 1PZGA 4QO7A 1LSUA 1AHHA 3PI7A 1XSEA 1O95A 2VTDA 3EVTA 3S2FA 2F1KA 2JCXA 5DBIA 5F1PA 4DL9A 2X4GA 3MWEB 4FB5A 2PFGA 4IDEA 3D7LA 4CL3A 3PXXA 4L4RA 4RPKA 2O48X 1OC2A 4IM7A 4OM8A 3GVCA 1QP8A 1GUZA 4JBIA 3ZU3A 3NX4A 2QW8A 3GNQA 3RJ9A 1B7GO 2VHYA 3CH6A 4R1UA 3RAJA 4RPHA 3WOHA 1K89A 2NQ8A 2QRJA 4WASA 5CEEA 2YYYA 2PH3A 2GZ3A 3C85A 1ZMTA 4OSPA 2GGSA 1KBZA 2J5RA 4WLEA 4DC0A 1V6AA 3DBLA 1YDWA 3SVTA 4IXTA 3AFNA 1C1DB 4CLXA 5H82A 2IYOA 1WNTA 5HA5A 2OOSA 1YE3A 3P2YA 3WNVA 4U0KA 1HDYA 3MJ4A 1VKOA 1PQWA 1UAYA 3C8MA 1T2FA 2PGDA 1KC3A 3TZCA 3BHMA 4ONEA 4N7RA 4K28A 1SEPA 4DPKA 1YQGA 2I9PA 3OFSA 4JCOA 4B4UA 5KVQA 2WD8A 3B1FA 2X6TA 5TJHA 4EEZA 4TRRA 4DWVA 4MOWA 1YONA 4DUPA 4L74A 3TL2A 5BNFA 4J7CA 4DBVO 4J0EA 3ITDA 2VTEA 4XR9A 3ANMA 4XJTA 2VN8A 2W2LA 4I5EA 4BGUA 1ZXLA 2AA3A 3KSDO 4HFRA 3QA9A 4KWIA 4JN6B 3WGIA 2IDZA 1DJNA 3CMCO 1XDWA 1Y9AA 2X8LA 1E1MA 5DCUA 3G1TA 4R3WA 3O03A 5IZCC 3RU9A 1LDMA 1NWCA 1E1NA 3DZKA 3ZWMA 5JO0A 1Q7GA 4ZRNA 3DHNA 2BFMA 3E6AA 1KYQA 4FQ8A 4E30A 4U7WA 3FCOA 1X15A 3VKVA 2PKRA 1BDMA 4A27A 2RHRA 2VWHA 2UUOA 3VKUA 1NHWA 5JSFA 3UH1A 1KVRA 3PJGA 5IN4A 3NYWA 2Z1MA 3AI3A 3ZHYA 5JAIA 2HRZA 2AEJA 2JCYA 4IDFA 4ZVVA 3ZV3A 4BB5A 5HS6A 5BNIA 2EGGA 1LNQA 4IQ0A 4TMFA 3ASVA 3U49A 5L7WA 3LT4A 1HDCA 2NVWA 1F8FA 1UUFA 2G82A 2OHXA 4ZQEA 1R12A 3WSWA 1AGNA 1U7HA 1EUDA 2JAHA 5L7YA 5GZ6A 1QV7A 1DRUA 3GGGA 4B79A 1DLIA 3WGZA 1P31A 4E4YA 3D0OA 1QORA 2Q2QA 4ITUA 1EE2A 4QQRA 3U4IA 3VHRA 1D8AA 1GCOA 3G17A 3DXFA 2IEDA 2VRCD 2AW5A 2XPCA 3IDSA 5JY6A 3HHPA 4D42A 4MKRA 4Y9DA 3VZRA 4XWYA 5TT1A 4Z3DA 3WS7A 2FN7A 2GLXA 3GUYA 2PZJA 2GO1A 4FGSA 4WCFB 4NHEA 4I9UA 4BQPA 3UVEA 4GGOA 2CD9A 3ZWOA 4DMMA 3GN2A 2C7VA 1BVRA 2P68A 4DIBA 4ALIA 4E0BA 3HFSA 3KBOA 3QJ5A 1PGOA 1I33A 4Y67A 3EAGA 5DDIP 4YWJA 2W98A 1ORRA 3KYDA 3WGQA 3KUXA 2BHLA 1P45A 1YBVA 5F1KA 3HN7A 1O89A 4IDDA 2Q1WA 2XOXA 2D59A 1MA0A 4MVJA 4NU5A 4R3NA 4L4SA 4N54A 3LU1A 2ET6A 1PGJA 3B6ZA 3GY0A 4BMSA 1E92A 3QP9A 3L77A 2XF8A 3GVIA 4I9HA 3WDSA 4CJXA 5CG2A 2W2LD 1VE9A 4JQCA 4TZKA 1ADFA 4S1VA 3GHHA 5JNLA 1GEGA 1EK6A 2DTDA 5DP1A 2NVUA 4ZA2A 3RBXA 4I1IA 4KTTE 4J1TA 5IDWA 2Q3EA 1I2CA 2Z1NA 4RVFA 4W6ZA 2DBQA 3KETA 2W90A 3CKYA 3RUDA 3WQQA 1R15A 4MVJH 1EUCA 2B4QA 4IMRA 3VH3A 5B4UA 3ZU4A 5I7FA 4WLFA 2VWQA 3Q3CA 4RVHA 2PA3A 3MTGA 1PL6A 1BVUA 2JD2A 3U4HA 2YHUA 4BNJA 4RCVA 4AJOA 3OIGA 1PEDA 1MC5A 1U2DA 2X5KO 2V6MA 1NASA 1LLCA 4JNKA 2HO5A 2OFPA 3FNEA 1M6HA 1GL3A 1QYWA 3WQSB 3HSKA 3I4FA 1T24A 3Q0EA 3W8DA 4E5KA 1LSOA 4UUNA 1SPXA 1X1EA 5EJ2A 4RF3A 4JP2A 5JBIA 1JN0A 5DP2A 5G4KA 1DFGA 3PGXA 3RROA 3WR5A 2A35A 1V8BA 1K5HA 4H15A 1WZEA 1F0YA 2GD1O 3QQPA 1KEPA 2ZCVA 1U3TA 1WMBA 3DBRB 4CV1A 3RIHA 4NJMA 1TT5B 2EXXA 5T67A 1H0KA 2J3KA 4WKGA 1H94A 1KERA 4GSKA 4A7PA 5B4VA 1YWGO 3LT1A 3DZJA 4FPXA 4CMHA 4EUEA 3JQ7A 1I30A 3KXDA 2VQ3A 3ON5A 4O0LA 2X86A 4HV4A 4R16A 3IUPA 4I9NA 4NFHA 3B70A 5JE8A 5G0VA 4E12A 1VSUA 3ETDA 2G0TA 3C1AA 4YCAA 3PPIA 3QWAA 5C37A 4W9NA 4LN1A 3TSCA 4BNFA 4GAEA 2OO5A 4N5LA 2DPHA 2PWZA 4MVJM 1PGQA 1A72A 1A4UA 1MFZA 2VHVA 4RDHA 1PJLA 5IXSA 3ZNQA 4CR8A 1I24A 4B4VA 3UCFA 5KOIA 4YQYA 3WBBA 1RM4A 2Q1UA 3EVNA 1PS0A 3GQVA 2OMEA 3ZNNA 3JQCA 5FWNA 3S8MA 3WICA 2Y1EA 4CMEA 5MDHA 3ETGA 4CM1A 2HCTA 4UVDA 3G49A 4CMEC 2VHWA 4CV2A 3ONEA 3WGHA 3M2PA 2XXBA 4H16A 2E82A 5IN5A 3Q2KA 2ZKLA 3QRWA 5CDGA 1F8GA 3KLMX 3TFQA 2B37A 2Y1FA 4QSMA 4F46A 3FBGA 3FWZA 2O23A 2ZB8A 4PLTA 1B16A 1U5CA 5A9SB 2H5LA 2FPIA 1ZIDA 4CM4A 1W8DA 2PD6A 3DBLB 2GCGA 3G1UA 3WYCA 2FWMX 1U4OA 4KUHA 3AU9A 1VM6A 3E9QA 2CDBA 3H5NA 4ALMA 1U3UA 1D1SA 2W8ZA 1X13A 4U6QA 4N18A 4TVOA 3SLKA 4YJGA 4YRDA 3DBVO 1DDOA 2FR8A 4E5PA 4UEJA 5I9NA 2Q45A 4RF4A 4DBZA 2DPGA 4RZHA 1GR0A 4OXYA 3SXPA 1CQJA 4J1SA 4IJKA 1VKNA 4PG4A 4EEXA 5KVSA 1A5ZA 3DOOA 3N7UA 5GY7A 1ZJYA 4TKLA 1E6UA 4D3DA 5B1YA 2HJSA 2IZ0A 3I52A 3VDQA 1TB4A 4TZTA 4J2OA 4IJUA 4W9NC 2R2GA 3H3JA 1MXFA 3IIEA 5CDSA 4WNCA 3VTZA 2NNLD 2YW9A 2LDBA 4L9RA 5EMHA 4OH1A 4MO2A 1DFHA 4KTVE 2EERA 3DZGA 2BFOA 3GLQA 4B7CA 1N7GA 4FS3A 4YQZA 1H6AA 2I6TA 1ZFNA 4BNYA 4B7XA 1YOVB 3PHLA 1WXDA 4DPMA 1Q0QA 3KVOA 1BGVA 3D4OA 1S7CA 5G2OA 2BH9A 4AICA 2YY7A 3AUSA 1GPJA 2VYVA 1DO8A 1PX0A 2BGLA 4FJ1A 1PR9A 1TI7A 4PZCA 1AN9A 3EZYA 3FPLA 4H3VA 3KRTA 3FNHA 3T4EA 4B3IA 2ZYDA 4B7UA 5L95A 3STHA 4AJ4A 1JWBB 3GFBA 4FC6A 4B8WA 4ESOA 4CUJA 4J1NA 4NG5A 2X0NA 2B36A 5B12A 4E13A 4YYZA 2EKPA 3VZSA 2C29D 2HLPA 4B8ZA 4EW6A 3GPDG 2X5JO 4YT4A 4BNUA 2BF7A 3FNFA 4XRGA 1N9GA 1XGKA 4NK5A 1VLLA 3S1LA 3GZNB 2Q4EA 2VYVD 3GMDA 5KJEA 3W4IA 1SOWA 4TWRA 5A4DA 1P1JA 3NDIA 2WYWA 3RKRA 1UZMA 1ZK2A 1WWKA 1IYZA 2JD0A 3JQGB 4GX1A 5KJ1A 3W6UA 1HETA 1YB5A 4BKRA 4CODB 1QRRA 4PLPA 4FSHA 3VPHA 4KQXA 2FMUA 3FF4A 1PWXA 4IGFA 1A9YA 3UICA 1VL8A 4CM6A 5CPFA 4B4OA 4CMKA 4ZJUA 4II2A 3AUTA 3KHUA 4XEHA 3H4VA 5FFFA 2O4CA 3WJ7A 2AMFA 4XYBA 4J43A 4AJLA 3O8QA 4XYLA 1KC1A 4WLVA 3HN2A 4BNWA 3NDRA 2JAPA 2AHRA 3ZHBA 4DGSA 1IZ9A 3ZWVA 4BQRA 1UJMA 3F1KA 5G0WA 1OAAA 4Q9NA 3NEPX 1N7HA 1ZW1A 3BMCB 3H9UA 3NT5A 4GKVA 3C3XA 3UW3A 4DQXA 3IMFA 3FI9A 2C82A 2YHIA 3GPIA 4IZIA 1UXJA 1LRJA 1KIFA 1NQTA 1OI7A 3DOJA 3Q9UA 3VZPA 3TZHA 5JXWA 1J6UA 4XDZA 2BI7A 3OBBA 3RFXA 1N9GB 2YV1A 2DC1A 4RVGA 4XYEA 3WNQA 1RM5A 5DN9A 4PLFA 3ST7A 3UGKA 2HKIA 4E5NA 1Y8RA 4D7AA 3BMQB 1Z74A 4NPCA 1KVUA 4BNKA 3I9NA 3JV7A 1PS9A 1LSSA 4KQWA 4W7HA 4GWKA 4ZQBA 2IZZA 3PLRA 5A1TA 3X2FA 1HYGA 4HWKA 3TRIA 1XQ1A 3PHIA 1A9ZA 2Y99A 1KVSA 3C1OA 4FDAA 4DIOA 4P4NA 4DLAA 3MOIA 5DBGA 2I3AA 3U09A 2CVOA 2UYYA 4QO8A 4R5HA 4BO3A 5HRUA 3MOGA 5JC1A 4DA9A 1J0XO 1FMCA 1DAPA 3RC2A 5IZCA 2UV8A 4EBFA 1G1AA 3JQAD 4PLVA 3BMOA 1NX6A 4HP8A 1PS8A 1V3TA 5TF4A 4CM5A 5JW6A 2B4TO 1QXSA 1DC6A 4AJ1A 1PZHA 3DZFA 1DFIA 3O9ZA 1U7TA 3LK7A 1DIAA 4QFCA 4LCEA 2B35A 1DEHA 2Y1CA 5I7EA 5A5EA 3SLGA 4OSOA 3GHYA 5A03A 3ZH2A 1S6YA 1TVEA 4UREA 1PZEA 4A73A 3BYZA 5CAEA 1JW9B 4CM8B 2HSDA 4NU6A 1A71A 3WG9A 3MEQA 3T7EA 1HKUA 3JQBA 3EW7A 4YJDA 4ND3A 2DFVA 4D43A 4J90A 4YDRA 1SEVA 3PWSA 2UUPA 3RASA 3NRCA 3NGXA 3PQEA 2NM0A 4E2WA 3PTZA 3F6YA 1TT5A 4KDEA 3U9LA 4MJLA 3UOGA 3E1KA 3ZWCA 4TRMA 1P1KA 3GEGA 1ZK0A 4NZ9A 3JYPA 2WWRA 3FPCA 4KZPA 4BO0A 3WWZA 5BT9A 4K6CA 3INRA 4DPLA 2GZ2A 5DCWA 2O3QA 4M54A 1YRLA 3HZZA 2OP1A 3HB5X 3AK4A 4IQ8A 1TA4A 1HDRA 1WDMA 1D3AA 2DAPA 1GY8A 2DQ4A 1H9AA 1XWFA 5F3RA 3QSGA 4UAGA 1QYDA 5KJ6A 3ABIA 3U4CA 2JHGA 3CTMA 3OF2A 4BMNA 2JFGA 1RM3A 4CV0A 3GGOA 3WBFA 5IF3A 2YDYA 5ILOA 2UDPA 1HF3A 4FFOA 4R4JA 1J5PA 4UEOA 1E77A 1PR3A 3DQPA 2BD0A 2D4AA 2V65A 3R1IA 2PKQO 3EY4A 4CQMA 4F3YA 5FF9A 1I2BA 3KSUA 5LDGA 5TSDA 3I1JA 1WDLA 5I9LA 3Q11A 5IDYA 1A7AA 4E5YA 1Z73A 4PG8A 1PJBA 4YVFA 3RFVA 3E5MA 4N5NA 5G4LA 4B4WA 1MP0A 3AM3A 1NP3A 4LCJA 1I36A 2OL4A 1BXGB 2X23A 3HJAA 1NPDA 4NR0A 4GSLA 3LF2A 2WD7A 1ZK1A 2HMTA 4Z3KA 1J4AA 3ONDA 3VOSA 3E9NA 4EUHA 4RQTA 1PJTA 2DLDA 4K9DA 1AXGA 3ENNA 4RLSA 3GZ4A 3WGYA 3GG9A 3C7AA 3LDHA 2Y1OA 1ZH8A 4C4OA 5MGBA 3IAHA 2IYPA 4YEDA 3GOHA 4QX6A 2VUSA 1PQPA 3W4JA 4RJTA 1U4SA 1E3WA 2B4RO 3NTRA 3DL2A 1DSSG 2Y67A 3OQBA 2GERA 1H5QA 1VJTA 2GDZA 1R4NA 1D4FA 2V7PA 2O50A 4NBRA 2AE1A 4J16A 1SCUA 3UF0A 1EBUA 3ZWBA 1FXSA 1RKXA 2PZLA 2R00A 2GF2A 4BKOA 1T2EA 3UXYA 3LT0A 1YVEI 4YAJA 5JMPA 4O5OA 1NNUA 1HDZA 4TROA 5K6AA 1BG6A 1W73A 1X0XA 3VH2A 5CDYA 3F9IA 3KOUA 4E31A 4BIIA 5TJ9A 3BTSA 3PJEA 3LC2O 4FFLA 1HRDA 1CRWG 4LVCA 1DOHA 3WGTA 1DBVO 5ITWA 3OHSX 4YRAA 2X0RA 4WCFC 1K0UA 3GVXA 1E7RA 1E3LA 4MIYA 4EUFA 2EJWA 4C7KA 4FCCA 2YFQA 4K26A 2AG8A 3PQFA 1B8VA 4GBJA 4MKXA 3TNLA 2HMVA 6ADHA 4MVJI 2DUUA 2H6EA 4U5QA 3VPFA 3ZWPA 1HE5A 4D79A 3O26A 1DIRA 1ONOA 2RH8A 1MC4A 2WTBA 3EMKA 4Q3BA 4L73A 1PZFA 3I3OA 4GVLA 1QV6A 1KOLA 2C0CA 2QZ9A 5TIIA 3FSRA 3VZQA 1EZ4A 2HMWA 4NFSA 2H63A 1QKIA 3K2BA 5T6BA 3PYLA 3VAZA 2AG5A 1EMDA 2PTGA 5KIAA 2C07A 2GSDA 3L9XA 1GQYA 2FPGA 4YTEA 3L9WA 4ND4A 4II3A 5JYDA 2PLAA 1LJ8A 1B2LA 1B8PA 3H65A 2EW8A 1R6DA 2PZKA 1P1HA 3NKLA 4HFNA 2Y0DA 4N5MA 5F5LA 5FI3A 3RD5A 3IP1A 4MP8A 5JDCC 2HJRA 3OIFA 3K92A 4YT5A 3EYWA 4MKZA 5ITVA 1NHGA 3DFUA 4M1QA 4E2ZA 1V3UA 3BMNA 1R4NB 1N8KA 4IS3A 1XQ6A
chains in the Genus database with same CATH superfamily
3EF1A 4PQFA 1QIGA 3GMTA 4XIYA 1T3SA 2RDMA 1KEWA 4BUZA 5JPDA 3W8FA 1NZJA 5AHKA 1MB2A 5CYFA 2B6HA 1T0IA 3X1MA 3NHYA 3UWSA 1T5BA 1UEIA 2W6IA 3M9XA 4IPTA 1YRAA 1MUUA 5DIZA 1HO3A 5K3DA 5KCMA 3VAAA 1UP6A 2YJNA 2JGEA 4LJ4A 4CQMB 2O8DB 1N1GA 1P8AA 3HKEA 5FTJA 1O1YA 5LR6A 1NPTO 2WHPB 3HVIA 4HATA 1E98A 3M9WA 4ABYA 1T3TA 4GL2A 3I2FA 2NUBA 4ER7A 1D2GA 1IJEA 4EMUA 3PPWA 4CE6A 5IYZA 1ZD8A 4DV2B 2XYPA 2DUJA 1BXRA 3IE0A 3JAKB 1XTZA 2G09A 1YZLA 1NJ1A 1V5GA 2A7QA 3WHPA 4BTVA 4HH1A 4YMTA 4M49A 2QJOA 3TOVA 4BLSA 4DV5B 2FEPA 2ZI4A 1ACMA 4GZLA 5HCIA 4EX7A 1N1EA 1KY4A 2EGHA 1N33B 4MP6A 3UJAA 1Z2DA 2F8MA 2PS3A 5CEJA 4XJSA 4I19A 3SQMA 3W2HA 3RYCA 2ZB2A 1LDEA 2NADA 3NTQA 1L4YA 2FXVA 2B8WA 3B38A 4HAZA 2HDWA 1S2MA 1DJQA 3ANNA 3KR2A 8GPBA 3L07A 5TRTA 2IIQA 2PGOA 4JEUA 3SQLA 3BIWA 3SQNA 5EYPA 4HWOA 2I55A 1NMEA 1TZCA 4BNLA 4LE2A 4R69A 3K0CC 4D44A 3BGSA 1U0BB 3TL3A 4QGAA 4IUDS 4XDYA 4G0OA 1EEHA 3GFSA 3IUYA 4BUCA 2PT7A 3OKPA 1V6SA 3AOGA 3U3KA 3UIEA 1L1FA 1PYOA 1TQ8A 3C1TA 3HB0A 4LSWA 3QPWA 1X74A 4OJQA 8ADHA 3U4MA 1E4EA 2FEXA 1NVDA 3IUMA 4B6FA 1L1RA 4ZKDA 1UIRA 2WIAA 4L4XA 1LKZA 2PV7A 2P2YA 4CCWA 4GVXA 3G5MA 2OP0A 1E4OA 1KH1A 2LWIA 3H5TA 4G4SP 4NOLA 3RJZA 4C08A 4GGPA 2CGEA 5BN5A 3K70D 4FFSA 4EKEA 4Q24A 1ZJ6A 4JVMA 1ST3A 1V26A 5CYOA 4BP9A 1Q7BA 4QKQA 4OQPA 4C7XA 2ZJ8A 2NWQA 3R7SA 1OV4A 3BA1A 5F4ZA 4OQEA 1SWWA 1KJNA 2HA4A 3UHAA 4KVFA 1UBSB 1KEUA 4KO4S 3BORA 1Z22A 1DOAA 1J99A 2J59A 3FPGA 3UENA 5B6PA 2WYUA 3KQWA 2CV1A 4F4IA 1D1QA 2YC4C 3MJDA 4TVBA 3SG0A 1DG9A 3M6AA 1DRJA 3KPUA 3OWXA 2C5EA 1E2FA 1II0A 3TRDA 4BO5A 3FNBA 1QAMA 1Z36A 2I2DA 4FFBA 2NO4A 1KI1A 3HADA 4HCJA 3VR3D 1E6KA 3MFQA 4DSOA 1SXJC 1W46A 2ILVA 5DLPA 3WADA 2VJPA 3GWZA 3D1LA 1CUCA 1LBEA 1N0WA 3TBKA 2Q8QA 3DMTA 5ECYA 4AYTA 4M22A 2VDOB 1UJNA 5TMPA 1BEZA 1FUYB 4EKYA 3MUNA 4KV9A 1LVUA 1Y8QB 1YZYA 3WLOA 5I5EA 1O95D 4J0FA 2L19A 2C1ZA 3V97A 4F3TA 4UJ3A 1C7QA 2DHRA 2Z5GA 1G3MA 1GQSA 2QVBA 4B1FA 5HM8A 1N4DA 2XNDD 3TD6A 4KBFA 2AN3A 1GZ5A 5LB4A 2GWHA 3U40A 1E9BA 3O3CA 1BHO1 1ZRSA 1E32A 4L8LA 1O6ZA 4J6EA 1L1QA 1PFGA 1HK7A 2HSEA 1L8QA 3K5IA 1VE6A 5DTRA 5FUVA 1SVNA 2PH5A 4B82A 2B30A 5M04A 1OFHA 1JKJA 1JQBA 3QEKA 3C3KA 3W0LB 2JHFA 1UAGA 1E9SA 2GD0A 2PRKA 4X1YA 4A15A 3QU2A 3QHPA 4K6KA 4WTOA 1KF0A 2ZUTA 4QYIB 1E1KA 1N2HA 2H1IA 3D8TA 4RJIA 3YASA 4BAGA 1NGSA 4LXHA 4D8UA 3G02A 1YL7A 3KWFA 2E9SA 2EP5A 2ZYWX 3PUXA 1USWA 3PD7A 1GN8A 4NRDA 5CGQB 5EHXA 4L8FA 4LF9B 2V5UA 3H3FA 4JB2A 1AKQA 3P2EA 2NT3A 4XR4A 3FHTA 3MGCA 3WB0A 3KE8A 3MT7A 3CZAA 1FTSA 2W6JD 5BWMA 5CB8A 2ATVA 1NURA 2KLBA 4Q3EA 2XA9A 1B6SA 4K6GA 1JQKA 3QVWA 2RBEA 2C04A 2Q46A 2IYTA 3NLLA 3SHQA 3HM2A 3LYUA 3B6MA 1TM1E 1UM8A 2OD9A 3DL4A 1BFDA 3IILA 3SFVA 2NZJA 1AQYA 1USGA 3OOEA 4YRNA 1I7LA 1I3LA 2OORC 5HK8A 3VR6D 3D5QA 4FIZA 1TZKA 1X7WB 3H1PA 4R7TA 4ZXFA 1GUYA 1UFRA 2FWNA 4BFZA 1Z7GA 4ZO8A 1DC5A 3CCBA 3UMYA 5GJBA 4ZO9A 2EZTA 3K4QA 1AKWA 4QLAA 3V8VA 1LLFA 3HRHA 3KLBA 2FUEA 1IN7A 2CFIA 3RT1A 4ZHSA 4W5RA 1BDBA 1Z0DA 4FDVA 4C88A 1W581 3EBPA 2AEMA 1Z08A 1ES9A 4HB3A 4M46A 3HJCA 4N49A 1SRQA 1KZ9A 3F6PA 5ADUS 4KR6A 3H6KA 2O8EA 4EY3A 1P19A 1PSDA 3R3VA 1XJ5A 4A26A 4OQNA 3FWHA 1W0JA 3KT8A 3AESB 1IAVA 1F4LA 2V6BA 2WFAA 5GWXA 5GJWC 3UG7A 1VQ1A 4UHJA 3OLCX 3B20A 1OREA 2FPPA 2XDYA 5JSKA 4F06A 5NULA 3GLIB 4DLLA 3ZV6A 4ZYUA 3U7FB 2DPXA 4XGIA 4TQAA 2ID9A 4WNIA 2C2YA 5T7BA 2HMUA 3FR8A 4PO9A 3WAGA 2O8FA 3PNLA 1NU8A 4OK3A 1HE8B 4XVUA 4ZCIA 4C6SA 1E66A 4YP5A 2E6KA 2E48A 1DBSA 3U5TA 1KGSA 1L4HA 4MRAA 1VHWA 2QP9X 5CG1A 1CY0A 1NMYA 1P9LA 2XITA 3DCIA 2GZAA 5KSZA 1YB6A 4WAUA 4TWAA 1E5DA 1YBAA 2N0SA 2XEXA 3AHEA 3E58A 3ESZA 2X8JB 2G5CA 1TT7A 2EJUA 3IJ5A 3A6DA 3P0RA 3WYDA 1RZRA 2Q2VA 4G5HA 3LBFA 4R2HA 1ZGGA 3H2HA 1T9GR 1NQOA 3KD2A 3PD1A 4CKXA 3RC9A 4BMPB 2B34A 1EUYA 2BMAA 2V1XA 3DMTC 3E53A 1J5EB 1S1MA 4E4TA 1UKEA 5CVTA 4DUYB 1ZSYA 1FQWA 2PX0A 3CNLA 3JYOA 4KQ2A 5BQFA 4MDFA 1OA0A 3BH7A 4HG2A 1JIJA 1QH8A 1YRBA 2ZUCA 3I5AA 3MM4A 3CPHA 4FYXA 4TWZA 4PXAA 1CJSA 3GELA 2BGUA 1FP4A 4NE7A 4QDOA 5J4LA 2VBFA 1SQGA 4J16C 5D6OA 8OHMA 1YXMA 1P9WA 3KTDA 1WMEA 4F5YA 1E3WB 1DOZA 5ADVA 5KX5B 4L4UA 1R4MA 1W1UA 3WMFA 1F20A 2EX1A 3L7OA 1Z63A 3OCWA 1R5JA 2R6R1 1QCDA 4DMFA 5G3YA 4A23A 5DULA 4LJ5A 2GF0A 1Z4JA 3CUSA 4CEJB 2JLZA 1GGVA 1DTEA 2ACWA 1TZ2A 2AKAB 3FDJA 3H3XA 1KR5A 3T15A 1FF9A 1T9CA 4AJEA 4C1NA 2MCFA 1R0WA 1EUZA 1JIVA 2HU5A 2ZB7A 3G85A 3MJVA 3QJGA 4HDRA 3WZ2A 4TOIA 2PPLA 3HXTA 4YREA 4G6ZA 4C4SA 1OYWA 1SA0B 2YYAA 5KCZA 3L5KA 2PVPA 3HUDA 5DHTA 3GFPA 1XN1A 1OGJA 1OA1A 3PVCA 5K45A 4ARZA 2BR5A 5BV2P 4IBOA 4C7VA 3EG9B 1JFSA 2Z5FA 2P40A 1F8YA 1IE3A 1RTKA 4YACA 2HLHA 2A78A 3W9SA 1M8PA 2UYHA 2EFCB 1AC5A 2KW5A 3W05A 4ZK6A 2B25A 4GHWA 1LNZA 3IMGA 3DDCA 4WK4B 2ORYA 3P4UA 4NBNA 1DBIA 1M0WA 1QHHB 1U7OA 2J7KA 2R1VB 2EDAA 4BBJA 1NZDA 4UHCA 4WEOA 4WERA 1J1IA 1MNQA 2FFBA 3EGXB 3PDJA 4U5XA 4WD3A 1IHXA 3QWHA 2W2NA 3N2LA 3RG8A 2VHXA 4BLWA 1WSDA 4PQEA 3IA2A 3REFA 1YCFA 3UFBA 4JVSB 5THQA 1RJ9B 5D1NA 4H1WA 4OUDA 3PNBA 4JGIA 3O8CA 2FP4A 3N87A 4Y1RA 1YUBA 3EPRA 3Q7IA 4C0JA 3FAKA 2L82A 2VQEB 1VDZA 2JIQA 3IBSA 2PUCA 4M9RA 1LV7A 1UKVY 3WYGA 5LJLA 4RPLA 2RGEA 4LWZA 3RYHA 4XQCA 4BXOA 1YJ8A 5IABA 2O0JA 2HNBA 3AZQA 3GAFA 2FSSA 3T4XA 4P9NA 3OQ6A 3LZ6A 2QTCA 4ZVUA 2FOIA 4Q7LA 2P27A 1BE6A 1J07A 1Q2UA 2WPDA 3OSUA 4B6OA 2ZAIA 1VZ3A 4ECAA 4MKHA 5K8IA 3F9CA 4BNNA 4M0DA 4AMZA 1P9OA 2TS1A 4BDTA 3FN4A 5CFQA 2I3GA 5PGMA 3ZGZA 2QN6A 3DMDA 2F17A 3T9CA 3RVMA 3AESA 4KSCA 3UB3A 5KTKA 1IULA 1G21A 4H59A 2OO3A 4JXKA 3D7KA 4QU0A 3MLAA 4WZBB 1YS2X 2VP9A 3NASA 2F3QA 4MAAA 4TMZA 2W93A 5J5VA 3TE6A 4EO7A 3GV0A 4LMAA 2BEVA 2H7VA 1SHJA 1RQ2A 1EWTA 5EHGA 2X19A 5TQ2A 4BKQA 3OJEA 4LRYA 5FBLB 1A2BA 2QMZA 4Y6SA 2B1QA 3JY6A 3O0DA 1VLZA 4G0ZA 2G04A 4H7DA 3I9KA 4LZZA 5KDLA 1G2QA 1TPZA 4S0ZA 3NHMA 1XROA 3KKEA 3R5JA 1Z6GA 1BROA 1P29A 3EFOA 3KQHA 2JLVA 2C9CA 4LPKA 5EIBD 3SVZA 2QTFA 4U39A 2WWGA 3EXG1 3D8HA 3IHWA 1M73E 3LY9A 3MFYA 1V9LA 1YDFA 1VJDA 4J0GA 2P9CA 1C1XB 5BWCA 1Q0TA 4HMOA 3ZDCA 3AF6A 1FDOA 4Q4JA 5AXCA 3MLBA 4F04A 3HJUA 5TGZA 1U4NA 1YNSA 4L78A 2RGWA 2G1KA 3IRVA 1S8OA 2C03A 4KGXA 3GARA 3UOWA 3WO1A 5AYVA 3WXMA 2RHGB 2X14A 1WUYA 4HKTA 3K9NA 2XQFA 3MSCA 1PW5A 1LVHA 4FKZA 2NU8B 5AVTA 3H5VA 4PONA 3I6MA 5DF1A 4HN4B 3E9RA 1YGPA 2BM1A 4D92A 3VJLA 1SHUX 2JS7A 3QPCA 3A6GA 3IDFA 4FYPA 1A1SA 4LMBA 4ZC8A 2IK8A 5DO9A 2OCAA 2QROA 2W4QA 3TGPA 2JFFA 3B1ZA 4O8ZA 4PGFA 1CY4A 1J0AA 1RYBA 2B21A 2I1QA 4IMJB 1VL2A 4CKZA 1AKTA 1AZWA 4YRSA 1G4AE 4Q47A 3RTCA 4AQ7A 5DWVA 1QV9A 4YJFA 4A0FA 2BJHA 3DV9A 2G1UA 2A9QA 4AG3A 2QQ5A 1S9HA 2PMEA 3GBPA 2WY2D 3DLHA 3T8YA 2IS6A 4FU0A 2YASA 4LSMA 1ZN9A 2ALJA 1EBFA 2FRDC 1K92A 2OPBA 3WQRA 2O20A 4QQ8A 4R2IA 4Y0VA 4TWBA 2OZPA 3SC2A 3FX2A 5CT4A 3REQB 4FNGA 4YR9A 2P9QA 4L50A 1U0SY 4CDMA 3DWGA 1CY6A 2INGX 3V2HA 1BGXT 4G0PA 5HQTA 1X86B 3ZXSA 1PI3A 2R8EA 2SCUB 3AERA 5LPNA 1W93A 1ZN7A 2ZIFA 4WGGA 2V9CA 4EHNA 4J9UE 1XZIA 3LC7O 4HGZA 4OHCA 5EIWA 2HRQA 4NG4A 4LWOA 4BNMA 4YAGA 1OVMA 4MWOA 3QE9Y 3PL1A 4Z4HA 1EQ2A 3W2FA 3CY6A 2BEUB 4IDPA 5AESA 5GOTA 4PRLA 2HNKA 1ISSA 3NHJA 2GPSA 4ZOEA 1R7RA 2YNMD 3PJFA 4L9WA 4CLDA 2BGJA 3AKYA 3D7MA 3HO1A 5A6VA 5E6RB 3S2IA 1C3VA 2I4OA 1MX3A 3T5GA 3ZGXA 3KFXA 2F62A 2GYVA 4Q3AA 2WSMA 3EB9A 1VYHA 4Y6RA 1B76A 1U1EA 1QHEA 2DT8A 4I8DA 4M9QA 1AUPA 3SJ7A 4F0JA 5JY1A 3VR6H 1D09A 4EY5A 1P73A 4B31A 1NI3A 2GRUA 1Y3AA 4DKJA 1CLUA 1HE3A 3D31A 1RAGA 3A1CA 4KVZA 4DIEA 5JYBA 2Q29A 3CNNA 1JAYA 1EX7A 4NENB 1WU8A 5BUZA 3LHIA 5IZ4A 1GTZA 3Q6MA 5L7TA 3ILYA 4D8YA 3HMKA 4L0QA 1J2JA 4LK3A 4F92B 3H2BA 1E64A 2QPLA 1AOXA 3C48A 4Y98A 2XECA 2ZE8A 2VAXA 4WFQA 4EMSA 2O2HA 2UUCB 3Q98A 3LCMA 3A9TA 2JGMA 3V1UA 1RMQA 4DZRA 3O4IA 5ETJA 3D5TA 1SIUA 5LC1A 3F3KA 3KAQA 3QPVA 1QKKA 2PGIA 3W5BA 3I9MA 1R0RE 2QVCA 4OOFA 4F6RB 5FH9A 1XL1A 4NATA 1N2EA 1YZUA 2I2AA 4R8RA 4A2QA 3WLMA 4PN3A 1TJNA 3ULKA 2JIZA 1I1QB 4GGMX 4GOXA 5BMVA 3W8EA 1A9PA 4C0SA 1KS2A 2OESA 2VHQA 4Y6PA 4RD4A 1TTQB 4CEHB 3DEYX 2P6PA 4M8SA 1WX1A 2AJTA 5E1OA 4YPOA 4ZYTA 1U5AA 1E3IA 4X84A 2VSXA 1J5XA 5IAGA 5G02A 5AVRA 3ER6A 3A6JA 3L8EA 3GN1A 1NX9A 1JEQA 3O7WA 4L75A 3NKFA 4HNAB 3QPAA 4Q82A 3LVBA 3WIBA 1CC1S 4YB8A 821PA 1G7CA 3STWA 2HXSA 1P62B 5L51A 3QX7A 2YBDA 3CBQA 2BFFB 4CDNA 4DIKA 1EVZA 1NUTA 2G6BA 3DD5A 4J4TA 2Q4TA 1VG0B 3BJZA 3JATA 4GVPA 4NMHA 2ZANA 1I7PA 5EEGA 3UFXA 1M5RA 1QPZA 3P27A 1TM4E 1HYHA 4MR8B 1GL6A 4ZQIA 1JFFA 5K4AA 5REQA 2HDHA 1EXMA 4O2BF 3VR2D 3HCNA 2XQJA 1JUDA 1CQZA 3TUZC 1CRPA 3EJ6A 4U8HA 1TUGA 3DBOB 1LBHA 5IWCA 5IG2A 4DSUA 4IP0A 2ICAA 2ZI6A 4J3FA 1PFUA 1ZAYA 1FXWF 4WXRA 4KKVA 1PVOA 1RYHA 2XDAA 1KZ1A 2JI9A 5KYKA 4DJ5X 4N6NA 4LOKA 1K63A 3BGVA 1TM7E 2Q3BA 5ECGC 1W0KA 1OH5A 2GNPA 4JVOA 1TYEB 4BMOB 5EGSA 3F78A 3NH6A 2G36A 3JWIA 3SYKA 2H1CA 1Q12A 3NI2A 4LFCB 1NLFA 1LS1A 3GNTA 4NICA 2Q62A 4Q1CA 4RMHA 2V0NA 3DAPA 2K87A 3IPRA 3TW8B 5EXPA 4J7UA 3VR4D 1J25A 3OPYI 5BW6B 2QIPA 2GK3A 4JI7B 3VO2A 1MNAA 2Q28A 4L51A 4LDNA 4F6RA 5KHOC 3LLMA 1V43A 2AS0A 2AXQA 1QNFA 4MZXA 4BLRA 1ARZA 3QUTA 3AEUA 1L7AA 1IN4A 2LKDA 3EXHB 4WZZA 2IEGA 4BNTA 1L5KA 1RYDA 1KI4A 4MA0A 3ANYB 2AEEA 5CD1A 5AXDA 2Z2KA 3W34A 4ARCA 1IOWA 2V7GA 2B4YA 1DJPA 2ZBUA 3KYCA 3PEFA 3SDBA 2NVBA 4ZEMA 1NI4A 2Y0BA 3I4LA 1I4DD 3BK2A 3K31A 3DC7A 4LJ9A 1IEQA 3INNA 4ZRMA 4Q9HA 1CJMA 3I5MA 3TOZA 4WLUA 1ADBA 3RC1A 5H80A 4BRWA 2EW2A 4B6RA 1BX1A 3LWBA 1XEAA 1T1RA 2C1XA 4KPFC 4HUQA 5HF8A 1QHXA 2QWXA 3SJZA 2BPOA 3OH8A 4GPIB 7REQB 2RGRA 1E2HA 3AW8A 3IQHX 4Q7KA 3STTA 4B09A 1IUNA 3VYUB 1AQNA 1N0HA 3TUJC 3ZCTA 2HAEA 5LZ8A 5CEFA 3QELB 1DLJA 1XU9A 1OB2A 5FEMA 2D1TA 5L53A 1NUSA 4FHDA 2HWKA 4HDCA 3VR4A 2A0FA 1TKRA 3JR3A 4RL6A 1GFZA 2B3DA 2IHVA 2IW1A 2MYNA 3PV0A 3U9SA 4BWGA 3CNEA 4KBGA 4JLSA 4K81B 2BFFA 3DLTA 1U6IA 2WD7B 1PV4A 5F98A 2DY0A 1SULA 3OBIA 3LDGA 3CEAA 2ZR0A 2NN3C 4LJ6A 4GZ5A 4U7HA 4A1FA 2PUBA 5A9SA 1AH2A 1PNOA 2WUEA 1AUXA 4LOHA 1A2KC 3G82C 2R8RA 3BH0A 3O75A 1WUKS 1VMKA 4Q0MA 4RTRA 2H7YA 2AC2A 4IGEA 2C7GA 4IG9A 1OB5A 1VJGA 4UTZA 3ZDRA 3LFHA 3PHJA 4M7PA 4F3KA 1L4GA 1XCOA 1Z16A 2I2XB 2Q7DA 2DY1A 3DGEC 2CF5A 3HJBA 3ZI4A 4M0MA 4KWEA 2PMWB 2J33A 3RG2A 1JYEA 1SCNE 3DA8A 3WK9A 4QECA 1M8GA 2O7RA 3SI7A 3KPVA 1G63A 2UAGA 4MPJA 4QDUA 2OWDA 4BV8A 2V55B 2X1MA 3AY3A 5B3AA 2ZAOA 1JVNA 3D0RA 3K9GA 4HFJA 4BDSA 4XIJA 2QTWB 3I53A 4Y1FA 4OHRA 1DARA 2EP7A 1NF2A 2XYGA 1IAQA 4UARA 3ASYA 1XTUA 1FVXA 1DAIA 1HT3A 4JBGA 3PDCA 5F5XA 3TLYA 1XD8A 4JLAA 1ENPA 3WLFA 3U7QB 4UEKA 1EHYA 1UBHS 3PT9A 4O59O 2YY5A 5B58C 1MO5A 3T12A 5C1DA 3EXHA 4ESHA 3AR4A 3T7IA 4DJJA 5E7IA 2GTPA 3CLUC 1U65A 1YL5A 3NBZC 1KZ4A 1P2BA 2DECA 4PF1A 3TLGB 3AWDA 5IJ0B 4U3JA 3TNFA 4C0BA 5HKAA 5D1HA 1CVRA 5CJ2A 4I4LA 1UBRS 3VTFA 3WK4A 1ZHHA 2WJVA 1G64A 1GXSB 3CINA 3CO0S 3Q7EA 4I6EA 4M86A 4OREX 2X7HA 4AJ2A 1FY2A 3IT1A 3T06B 1EP2B 4E5MA 1XZBA 3GJZA 3CLHA 2UZ3A 5DOZA 2Z8XA 1QWOA 1ID8A 4WE3A 3HE3A 3MUEA 3F2VA 4ZU3A 5EVCA 1QZTA 3UWDA 1DAHA 3PWKA 1QFSA 3QXCA 2CMKA 2OC4A 3KTFA 3MC1A 2Y1DA 3GZTB 2ZU0C 4M7RA 5TQVA 4JUAA 2RG1A 3FTFA 3QPBA 1T2DA 1CJTC 3S99A 2Q9CA 1XMQB 2OVBA 1MF7A 1YQWA 2DJIA 3DWFA 1AA9A 2WUDA 3A6PC 2QDXA 5AKGA 3B7PA 4MQ5A 4MUGA 5EKSA 5IVPA 2XD4A 3B48A 4UTVA 5DX1A 5F7OA 4HDAA 2X6RA 1Z7YA 2GTIA 2DM6A 1UDBA 2V54A 1O4WA 1QAQA 2Y1GA 3GRZA 3ZQ6A 3SYLA 3RREA 1UZNA 1XT6A 1ZK4A 3BD9A 4B44A 1KJ9A 1MW9X 4IUCS 1M67A 2BI4A 2DYKA 3KZXA 3HCRA 4RIGA 2YWEA 1CEYA 3NWBA 1U7DA 4LV8B 1DWOA 3T3IA 2WWXA 1JDNA 3CGGA 2RHHA 4OBEA 5C80A 3HA2A 3VHQA 2PKYX 1M76A 4Y7DA 5ALHA 5DTQA 3VNBA 1XD2B 4KXVA 3X1ZA 4GQBA 1HURA 1BMTA 4J94A 3SHWA 1AM4D 1MOQA 2E6UX 4KE8A 1D7AA 1NRWA 2FFRA 4PPGA 1ZD4A 2JIRA 4U2KA 4KU4A 4MV4A 3VKWA 1BSVA 1ZI6A 3UAXA 4AXBA 1JH9A 3LQRA 3EGDB 1FW8A 4OVKA 2L18A 3D4NA 2XJ9A 4MTCA 4G63A 2ENWA 1EZZA 3A9UA 1WEKA 5H16A 1TKCA 2IEZA 1XXHE 1IXKA 1CYDA 2ZLBA 4MQ6A 4ZICA 5TS2A 3HNOA 1IBLB 1T91A 4C7OB 2NZ8A 3RK1A 2Q3HA 2R7NA 1L7NA 1TYCA 1YB4A 2O8BA 3UV6A 4EB3A 1Z0SA 1JT2A 3R5FA 1HDOA 5K3AA 5CFPA 4GEKA 4XTRA 5HE8A 4INPA 4RV4A 1TF5A 1YOVA 1HC7A 2JJ2D 1QGYA 1ISGA 1M6WA 2JIBA 2A88A 4S2EA 1HORA 4Y30A 4PIMA 1JHPA 3KJZA 4Z1MD 3FSGD 4X54A 3FMPB 4D9KA 2E89A 1V95A 3A1UA 4F3NA 1FP6A 3R6WA 3W6OA 5B58T 1FP7A 3NM5A 5HDQA 3WLTA 3IXMA 1D1TA 2ZJ1A 4FMDF 3TB4A 1UQTA 3VH1A 4GU5A 3VSDA 5EUCA 2ADOA 5AI4A 3NHLA 5AVUA 3VU0A 4OHKA 1YKSA 5C9ZA 2QX4A 4MDEA 5IJAA 3QY0A 2FQWA 1AV6A 2A4KA 5WRFA 3DE0X 3DCNA 4PFJA 1RBMA 1PVVA 2FV8A 1HZJA 3FR7A 1WB6A 3QBDA 1QNLA 3LX5A 3IESA 1L5YA 3F6CA 2ZPTX 1ECFA 1F2UA 1Y48E 1PFKA 3L41A 4DSAA 4M6WB 2NZUG 4XPIA 2Z5LA 3OT1A 1TYBE 4I14A 3M3HA 4EABA 2WILA 4JEHA 1N2GA 4M1KA 1KAOA 3V1NA 4AKHA 1BW9A 4Y2TA 4TKZA 4D6YA 1SUCA 1JE1A 3I5UA 1RXUA 4AKEA 1QRAA 2A6PA 2FF5A 2OCLA 4CM9A 1UPCA 2DHDA 3VR6A 1AQLA 1Y9EA 4TTPA 4W8HA 2UZ1A 4HGQA 4MW7A 1JEYA 2PCLA 1R0ZA 3TQHA 1F8UA 1DEAA 5LZ7A 4MVJE 1BHJA 1T2NA 2O5CA 3NC0C 1PGPA 3N8NA 3P32A 4UMDA 2ZM6B 1IXYA 5FI1B 1TO1E 4AC9A 4CF3A 1JMYA 1USUA 4BVBA 4D56A 4J0CA 2FJUA 4IV5A 2BOVA 2PSEA 3MJSA 1Y6JA 3KYBA 4RSMA 2HA0A 1L6IA 3SS7X 3PNPA 2FZCA 4OU5A 2PJRA 1NT2A 1H0SA 3A2LA 1XZ8A 3OQMA 5GM2A 3AHGA 2HWYA 1X7DA 3B85A 4V02A 4ZK2A 1CFJA 1BD3A 1E69A 1TUEA 3ONFA 4FMPA 4RHUA 4M60A 1RXSA 3MQFA 5LZ9A 4X3PA 1ZMRA 4KR0A 1I6KA 2E4VA 3FBTA 4YMUA 3RB8A 1QOQB 4RHTA 4FFVA 4EO9A 2FMXA 2R4TA 5F2KA 3AV3A 4AKTA 1I8TA 3LQFA 5BSGA 3U44B 1JFVA 1NG9A 2Z6UA 3LHKA 4EBBA 5JMWA 1NJFA 1YRHA 1WOYA 3AF0A 3G5LA 5A3VA 5KNDH 2WOOA 2DJ5A 1JFFB 3R9WA 4G3XA 3HPRA 3TJZA 1D2MA 2XRFA 1IHDA 2ZVPX 2EC5A 1Q3HA 1V35A 3N0RA 2PZ8A 2IJGX 3OPYA 1EHIA 3WYBA 4ND8A 2IYUA 1Z8FA 1GQ2A 2NOAA 4O6VA 4P54A 3VI3B 5BNZA 2I0FA 5JZVA 1GTL1 1SBQA 2WKRA 3PKZA 4PC2A 4QOIA 4UVGA 3TTYA 3FVWA 1IM5A 4TQ9A 5T4HA 2WJYA 1CNFA 3L1IA 2QU7A 4QJIA 2WTAA 3ROTA 1E0AA 1GPDG 3IJRA 4CL8A 4PLGA 3F71A 1DX6A 4P2GA 1YR7A 3WRXC 4RF5A 4Z5XA 3FGPA 4QTZA 5G0UA 2F90A 5DI3A 1O7JA 4BO8A 3RS3A 3RVKA 2CLKB 2I65A 2XZOA 2J5KA 3OI7A 3QVXA 3QITA 4UULA 3RTBA 5DV9A 2ZUUA 5HZMA 1JIKA 1E9CA 2P4QA 4AY3A 4RO0A 4FNAA 3EEFA 3FSGA 3H86A 3JARA 3KB1A 1DPFA 1I6MA 4K2AA 5BT8A 3K6SA 3P5BA 4RYDA 2GEJA 2RAVA 4FN4A 5AUOB 5I4BA 5LMUB 4XCVA 3UN1A 2VUUA 1NWHA 4U2EA 3RYTC 3PXEA 4AECA 5KYWB 1EUQA 5J59A 1YA8A 2WHYA 1ZL2A 3ONWA 3ZZTA 4OQ4A 4LWQA 3L0CA 3KYCB 1R37A 3LPMA 1RCUA 2W6ID 5CVDA 5ALRA 2XCRB 4YRCA 3N2GB 4FUTA 4INAA 1U0EA 1D5WA 3F4KA 1PNQA 3CUWA 5IAAA 1IZ7A 4QOGA 3GUCA 1UKZA 4B3XA 1DAFA 2Q07A 4HNQA 2VNKA 5JXGA 2VVTA 2FW1A 3M81A 1RE0A 1QS0A 2CZCA 4HI0E 5JS1A 4FP9A 4DC9A 3SOPA 3N7AA 1DRVA 3PIIA 3VC3A 1F1JA 5JAOA 4Q4HB 3GI1A 1QE5A 5JCXA 1E79D 3K53A 3V2GA 5AVYA 1V2GA 3R77A 2B2NA 1RKQA 2J4CA 5BSRA 1YMUA 2RB4A 3NUZA 4ILKA 4ZGBA 1DBQA 1XXHB 3QXGA 5DGHA 5I3CA 5JBQA 1N6LA 4E2XA 1Y7TA 3Q40A 2BHRA 3DE5X 1VHDA 4OGFA 2ZYVX 1VSTA 3QUAA 1RWWA 2PMBA 4IL5A 3FUXA 3DFIA 4FWIB 4LEIA 3TINA 4C7JA 1XMOB 3V2IA 1VYUA 1PV1A 5EKXA 6AT1A 1DKUA 1EFLA 2CNBA 1JDUA 3I83A 4MYCA 4F4UA 5TARA 1QVAA 1ZC4A 3ZHVA 2I6UA 3RGWS 4TV9F 4GMFA 3I39X 4UHFA 3F74A 2G9QA 2V7UA 5BSFA 1M8FA 2ZJ2A 3HGTA 3ZBPA 1ZN2A 1RTTA 2GJAA 5AW6A 1UDWA 2DFNA 5CFOA 1XU7A 3TH5A 2GBLC 4BPBA 3EGVA 5DOVA 4OLAA 5AW3A 1Z4OA 2Y0EA 5HKKA 4BO6A 3RVQA 1SZPA 3TSOA 3KPYA 1YS7A 1R3DA 4BVAA 4DCOA 1D0IA 1P7PA 5CTAA 4WZAA 5A0TA 2VDMB 4LDRA 3VNVA 1MJNA 3NZEA 4HRXA 2ARKA 2H5IA 4HY3A 4L6AA 1YMQA 3IV9A 3R09A 4UM5A 3IOCA 1G20B 2H9AA 4X20B 3O4JA 2AOUB 1JTVA 1FFSA 5FA8A 2ZTSA 4H7PA 1AKEA 1UEJA 1P44A 2C54A 5CP8A 1VCHA 4WGFA 3FIUA 3VH4A 3G59A 3ZGOA 4E03A 3FROA 1BMDA 2DCMA 3SFTA 4IDQA 5CVUA 3C3YA 1ZICA 2OHOA 4V0NA 3GRPA 1N2SA 2B1GA 3IEKA 1B3RA 1YZFA 2W0MA 1L7OA 1Y89A 2C96A 1BVYF 2QR3A 5ITZB 1KK0A 1MRSA 4OKIA 3A70A 3WL6A 2J87A 4F5EA 3T52A 3IP3A 3IL2A 4ZOQI 3RU3A 1ZEMA 4EGQA 5ERXA 1K4KA 1DGQA 3ZQUA 2VK1A 3RV3A 2PX6A 4QYIA 2ODNA 1ML4A 2V6JA 3E81A 4FGKA 2AOVA 1CNMA 1RRKA 5KQMA 1X1QA 2KM1A 4R8MA 1NN3A 4Q9LA 2MR5A 1CP2A 2J0EA 2YICA 4ARSA 1TF7A 1P3DA 4KIUA 3W5CA 3LCCA 1C80A 2QLJA 4URXR 1EHCA 2IE8A 3EGCA 3L7AA 1EDDA 3TZ6A 4D8TA 2XUGA 2FWJA 1VKJA 1W4RA 4NV3A 4MUNA 1AB5A 5DI9A 3FMFA 3RU7A 3STVA 4GT1A 1ISMA 2AKYA 1BS9A 1I32A 2YHAA 1V11A 1ZD1A 3ZOKA 3WE7A 1NKVA 4KFCA 2OOKA 3JAWA 4U2FA 3UHFA 1ADGA 1LXCA 3UAYA 4EHHA 3KNZA 3L04A 3PI6A 1A9RA 2IHYA 2PNFA 1TZBA 2PZAA 3JPYA 1HYEA 3MMXA 4NYIR 4PCLA 1OZ0A 1Z0ZA 1W5FA 4KXYA 4NYMR 3OJWA 5HKOA 4LXTA 1XLTA 4P98A 4AZWA 2DUWA 1MB4A 2QVLA 3BDVA 4OAQA 1R0SA 1U7UA 2FG7C 1TAHA 2ZS7A 1XTQA 1UT5A 5C7LO 2PSDA 2C95A 2Y0CA 3IRUA 4KJZA 1LRKA 4HB0A 1EPUA 3E9MA 2OILA 1A88A 4C43A 2FR0A 1T4CA 1U8ZA 2RHJA 1OIXA 1B0UA 5DU2A 2JA1A 4PHTA 5KMGA 5F51A 1YH3A 2BFCB 1NVVQ 3NTVA 5AK6A 4MAMA 2EKLA 1Y5MA 2R86A 4XDHA 4Q7MB 2YJZA 4G9BA 1Z5ZA 3QA3E 4OHZA 4ARBA 3A1TA 4G5YA 4Z9AA 3WSWA 1KOFA 3A4LA 5DTIA 2OEPA 4Q4HA 3ZNPA 4RE5A 2O5EA 3CTPA 1GGHA 1G5HA 2FZEA 1MQ9A 4EQZA 5FWXA 2X4LA 2I6XA 3PT5A 4MRVA 1RVV1 1S4QA 1EU1A 2ZKIA 2VL7A 2YINC 4V1CB 3TIIA 2IZOA 2JASA 2VCYA 4YONB 1SZJG 3QMVA 1W94A 1O9BA 4X8HA 4E3WA 1M34B 1UR5A 1WXHA 1PZNA 3HBFA 2REBA 3FOCA 2NU8A 3GJTA 2G4LA 3ET4A 1E7MA 4DLUA 3PK0A 4N9WA 1X2EA 2IWRA 3TLAA 3KQQA 3IOEA 1Q1EA 4NENA 3VBCA 3X3HA 4DA7A 4DEYA 5KWEA 3C6ZA 4XFKA 2QYHA 3LC1O 5FWAA 4QXOA 4KPYA 2GCIA 1N5IA 4N8DA 2CHUA 5AI9A 4EI7A 1ZBDA 4BNDB 4KMOA 1NJSA 1CVLA 2ZWVA 5EPEA 3IPXA 3SMVA 3VV3A 1GGJA 2QKYA 2C8KA 1NVMB 1PWYE 1N2BA 1XMJA 1ZH4A 4I9FA 1TU4A 3EOBI 3UKJA 3QOWA 1CUEA 5TB5A 4HQOA 2WWIA 4K2HA 2JDID 4K6MA 1GV0A 3ZZUA 1T34A 1JKFA 1E9RA 2QHXA 1KI9A 4WH0A 1NW6A 1E2UA 1QG2A 3I09A 1SKYE 5JCOA 3U1VA 5IT4A 2A9OA 4Z4EA 2EKZA 1E0JA 2O3SA 2XT6A 2IXEA 1GKIA 2FDXA 3SEFA 3RYCB 4XGKA 1VZ2A 1R4MB 2FOXA 4GZMA 3H8JA 1NBOA 3NDJA 4RGQA 5AVQA 2ZM5A 4TV8F 3M3DA 2H18A 5EIOA 4MIOA 1HE2A 2SCUA 2HOQA 3AERB 3KZKA 2F59A 3ZHRA 1LPPA 1V1MB 1UF9A 1KY3A 3HB4X 1XRQA 4R5MA 1PJAA 4WDQA 3UJBA 3WXBA 4HL6A 4DW8A 1JEQB 3RS8A 3I45A 5BWOA 4DJEC 4JELA 3TX2A 5CBPB 3KJNA 4N39A 4OGWA 2UXDB 1KYTA 4U8GA 4ZGGA 5I01A 4NQZA 4DNOA 3GZNA 3T7DA 4WKOA 4J7XA 4JQOA 1I7QB 3BIJA 2PV0A 2NXWA 1WD5A 2VJAA 4X91A 2Z5VA 4DFDA 3C43A 2O2ZA 3KEMA 2C0PA 4EEKA 3B52X 2VC2B 4KMSA 4MUHA 1Y1QA 3MWDA 1G98A 1V4NA 4NVRA 3P0IA 4KO1S 3AIIA 2WTUA 4OI4A 2X8WA 5DTMA 2IY9A 1AGRA 4NNJA 4EG8A 3DCYA 5I6DA 5KTYA 3E9CA 2ERYA 4OU4A 1IY1A 1U2GA 2GUWA 3MIIA 4EHJA 3JQ8B 4BE9A 2PBLA 1TFRA 2QDKA 2QU8A 3LT2A 3OQVA 1NXQA 2P9ZA 4FWBA 3H8VA 1FSSA 4RIEA 1ZHOA 4KE7A 3NHBA 4DDHA 1YR8A 3FYUC 4WLNA 2YJ6A 3WLKX 2YV3A 4YJHB 3ICEA 3CUUA 1IH8A 3PCXA 4JYMA 3A0RB 4MWSA 2PT6A 2EYQA 4BVHA 3EAFA 2YQ5A 3K6KA 3O4FA 5B2FA 2EL9A 1QR6A 2WJ4A 2ZSKA 2DF8A 5E4JA 1DAGA 2P6OA 3O4GA 4OHFA 1EWRA 4UFNA 4OL9A 3AO0B 3MJEA 5KB3A 2R6DA 1KRHA 1NONA 4M7OA 4E5UA 5M2QA 1BW9B 1DT3A 3JD2A 5ADWA 5ICSA 3EARA 5J58A 5L3SB 4DLYA 1E1LA 3KWJA 4UBKA 4P7BA 1H66A 4FHGA 3F5MA 5IJZA 3LDUA 3GP8A 4H6XA 1TK9A 4YV1A 2Y9PB 2WNSA 5BUQA 1IJFA 2X1HA 1AS2A 3GCZA 4M38A 4HH4A 4TLMB 3IPLA 1DVRA 4LYEA 1CUGA 2XGJA 2WTNA 4YV2A 3R7FA 1JA0A 4FOOA 4IDGA 1YD7A 1K68A 1DQYA 2JFNA 3Q2OA 4UNRA 5I51A 2IUUA 1V5EA 4UTPA 3MRVA 1PZGA 3JZAA 3C14C 4QO7A 4W1SA 4E51A 1AHHA 5ALJA 5DRTA 1QCCA 5LQJA 1MMFB 3OPXA 2CYAA 3FSJX 2X4GA 3KJXA 5JARA 1AHNA 4KWTA 5CT8A 2G5GX 4QUAA 2Y6UA 1RPJA 4LC1A 4DHWA 2VSQA 3OFNA 1PR2A 1FXWA 4GEGA 4WW0A 5FUYA 1OC2A 4IM7A 5LL6P 2TMKA 4E7OA 1GUZA 2YN2A 2YMQA 4JBIA 2HADA 4I50B 2QW8A 3G9ZA 4UMFA 3VO9A 4E4RA 3ZD6A 1B7GO 4MICA 2RGAA 2PKXA 5EXEA 1KJ8A 3FDZB 1FS5A 1LCIA 3K2IA 2YYYA 5E0KB 3ND8A 1XEFA 3UW1A 3MBOA 1FMTA 1P61B 2Z4SA 3QE4A 2GGSA 3TCNA 1V6AA 1U94A 4BQIA 1QS0B 1RWMA 2GFHA 2FH5B 1PR6A 3TR5A 1ZIPA 3GAAA 4QDJA 5FV7A 1C3JA 3B2QA 2JRLA 1O97D 2AC7A 3BE6A 4H7IA 1KKUA 1RXVA 3EIQA 3ETLA