1E97A

Crystal structure of ketosteroid isomerase from pseudomonas putida ; triple mutant y16f/y32f/y57f
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
126
structure length
123
Chain Sequence
NLPTAQEVQGLMARFIELVDVGDIEAIVQMFADDATVEDPFGQPPIHGREQIAAFFRQGLKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STEROID DELTA-ISOMERASE
publication title Peudoreversion of the Catalytic Activity of Y14F by the Additional Substitution(S) of Tyrosine with Phenylalanine in the Hydrogen Bond Network of Delta 5-3-Ketosteroid Isomerase from Pseudomonas Putida Biotype B
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 28
structure length 123
sequence length 126
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2000-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1e97A00
2IMJA 3JUQA 3VSYA 4LGQA 3T8NA 1WQLB 4MJDA 3F40A 2W2CA 1NWWA 4HM7B 4KVHA 1NU3A 3GZRA 3ER7A 5IF6A 4ORLA 1JKGA 3EHCA 4L8OA 3E99A 1W00A 2B1XB 2GBWB 3GRDA 2CKFB 1ZX2A 1Q40A 3JUOA 5IG3A 5STDA 3NHXA 2RFRA 3EBTA 1OH0A 1STDA 3H3HA 5AIFA 3SEDA 3MHEA 1ASKA 3NBRA 3KE7A 3FF0A 1OHSA 4WWUC 2GXFA 4OVMA 3OWUA 2GEXA 1GY7A 3NM2A 5TGNA 3RGAA 2PZVA 3HX8A 3VGNA 6STDA 1OCVA 3OXAA 4FCMA 2BMRB 2YFLB 4R9KA 2HMKB 3JUPA 3M8CA 1TP6A 3DXOA 3FSDA 1DMQA 3FH1A 1UUWB 1ULJB 4XBTA 3UJMA 5D81A 1DMMA 3F9SA 3B7CA 3F14A 3WMDA 3GZYB 2QGUA 5IG4A 3F7XA 3IPTA 3SOAA 2UX0A 5JPPA 3FZWA 1OHPA 1VZZA 2R4IA 3MG3A 1OHOA 3CNMA 3A76A 1TUHA 2HMLB 3I0YA 1A2KA 3JUNA 3KZTA 5AIIA 1W01A 1E3RA 1JB2A 3EF8A 4I4KA 1O7MB 4XM4A 4K1VA 5IENA 2K54A 4STDA 3CPOA 4X2HA 1JB5A 3G16A 5JPUA 4H3UA 2YFJB 3MYTA 3OV4A 1ZO2A 2GEYA 7STDA 3LZAA 5FW5A 3FLJA 4WYKA 2Z77A 2GBXB 3B8LA 4OUQA 4RZMA 3BB9A 2XR8B 2STDA 3KSPA 5AI1A 4LMIA 4HZ9B 1JKGB 2Z76A 3STDA 3EN1B 1GY6A 3T8UA 5CK6A 5G2GA 4U13A 1Q40B 2I9WA 2BMQB 3G0KA 1JN5A 4HJLB 1E97A 1O7HB 3K0ZA 4R9LA 2F98A 3Q90A 4GB5A 5IEPA 4FCJA 1O7WB 1K41A 3H51A 1SJWA 4HM2B 3B4PA 1W02A 3S5CA 5BXQA 1QJGA 1IDPA 3OWYA 3NUVA 4HZBB 3NV0A 4Q53A 4L7KA 1EA2A 3F8HA 4PEJA 5CXOA 1EG9B 1OF5A 3FF2A 4XBXA 4K1UA 2HMJB 4HM4B 3ROBA 5BVBA 1O7NB 5CF2A 5AEWB 1Z1SA 3GWRA 1ULIB 3BLZA 8CHOA 3EN8A 2XSHB 3FKAA 4HVNA 1HKXA 2INXA 5CF1A 2A15A 3DM8A 1E3VA 2HMMB 3K7CA 3MKIA 1OGZA 1OUNA 3EQQB 4J8TA 5EVHA 5IG0A 3CNXA 4XDVA 3DMCA 1UUVB 1ISKA 3CU3A 4HM0B 1GYBA 3EX9A 2QIYA 4WYKB 3SOYA 1OGXA 5AEUB 2OWPA 4XB5A 4HM6B 4HM3B 1O7GB 3JUMA 1Q42A 3GZBA 5AIHA 1OPYA 4J9AA 3ECFA 3F7SA 5HGRA 5CLKA 3KKGA 3GZXB 3DZLA 4R1KA 4IIAA 4LEHA 5IEOA 5D82A 5AIGA 3EJVA 3G8ZA 5D83A 1JN5B 1NDOB 3D9RA 2XSOB 3B4OA 3NXJA 2CHCA 1CQSA 4N3VA 1W6YA 4CDLA 4HM1B 4HM8B 3OWSA 4HKVB 2RCDA 5KP1A 2HMOB 5IG5A 1GS3A 4XBYA 1U5OA 3MG1A 5IERA 4HM5B 2BNGA 2RGQA 1AR0A 3UNLA 3DUKA 1S5AA 4L8PA 1DMNA 2BMOB 3EC9A 3OX9A 3NV0B 4WP5A 2F86B 1C7HA 3LYGA 5KP3A 4XDWA 2YFIB 1OF5B 3F8XA 2XRXB 2B24B 1JB4A 1O7PB 2HMNB 3MG2A 2Z7AA 3HK4A 4X2OA 2F99A 5DRVA 2JQ5A 5KP4A 5DREA 1BUQA 1QMAA 3RGRA 1GY5A 3EBYA 3HZPA 3MSOA 3FGYA
chains in the Genus database with same CATH superfamily
4BTYA 2IY2A 1CYUA 2IMJA 3JUQA 1RN1A 3VSYA 4KT3B 4LGQA 2CK3H 3Q2PA 2CX0A 3T8NA 1WQLB 1LQGC 4MJDA 2H0GA 3WOFB 3F40A 2W2CA 3QRDA 5AYSC 1LOYA 3NX0A 4MMXB 1NWWA 4H61A 4HM7B 4KVHA 1SIIA 1NU3A 3GZRA 4JRFA 3CCV3 3ZG0A 2F5MA 1EKMA 3LTAA 3LTDA 3ER7A 5FGOA 2W56A 2WGQA 3V92A 3LTCA 1BNJA 5IF6A 4ORLA 3WOEB 3GAXA 3V98A 1JKGA 1FZUA 2E2VA 3EHCA 4MMZB 1ROVA 4L8OA 1M1XB 1I70A 1C54A 1LOWA 1QVG2 2OQEC 3E99A 1IQXA 1W00A 2B1XB 3PZWA 3D79A 2L4VA 2W0QA 2GBWB 1MWTA 3GRDA 1IVXA 3CC23 2CKFB 2W03A 1ZX2A 4EC6A 2BIRA 1Q40A 2GU3A 2W6JH 3JUOA 5LC7A 3G713 4N6MA 4CJNA 5IG3A 1MNLA 1GSPA 1R4CA 3QK9A 1VQ63 5STDA 1HU9A 3LT9A 1MWUA 3NHXA 1BVIA 4FMBA 1JBRA 1A2VA 2RFRA 4WHAA 1JJ22 4EYCA 3EBTA 1BGSA 1OH0A 1STDA 3H3HA 8RNTA 5RNTA 4BTWA 1IT7A 1QAFA 3U1WA 5AIFA 1W6GA 1GMPA 1ASKA 1PY3A 3MHEA 3SEDA 3NBRA 3KE7A 3FF0A 1HYFA 3WA3A 1MWRA 3Q1CA 3LH4A 5ELUA 4BTXA 2P0XA 3X40A 1Y4KA 1B2MA 3N54B 5I97A 1OHSA 4WWUC 4AEQA 2GXFA 4OVMA 3LT8A 1FW7A 1BSEA 1X1XA 3OWUA 4KFFA 1I0XA 2BO9B 2BHMA 2GEXA 3CCS3 1GY7A 3NM2A 5TGNA 1FYSA 2F4YA 3RGAA 2FGTA 3CMA3 2PZVA 3HX8A 1SIHA 3S27A 3VGNA 3N8BA 1F8NA 6STDA 5JBSA 1OCVA 1VQM3 3OXAA 4FCMA 2WOFA 2BMRB 2YFLB 4R9KA 2HMKB 4KFDA 3JUPA 3M8CA 2D42A 1TP6A 3DXOA 3FSDA 3CCM3 1DMQA 3G4S3 3KN4A 4CPKA 1GMQA 4ILFA 2Y73A 3FH1A 1VQN3 4JF8A 1UUWB 1ULJB 4MMYB 1KD14 3AMOA 4XBTA 3UJMA 1FGOA 1VQQA 4GHOA 5D81A 1DMMA 3F9SA 4FMDA 1W2B2 3B7CA 1B2SA 2R41A 3F14A 3WMDA 1N5HA 1TRQA 6GSPA 2C11A 3GZYB 1JV2B 2QGUA 2OTJ3 2P05A 2OOVC 1N9JA 5IG4A 3F7XA 1G96A 3IPTA 1BNIA 3KFQC 3SOAA 1YI23 1G0TA 2UX0A 2CX1A 1YJN3 1RJOA 1B27A 2FXTA 5JPPA 1L5GB 3FZWA 2GU1A 2IYJA 1PU4A 1UCLA 1NB5I 1OHPA 1B2XA 2XFTA 3FG4A 5AYRB 1VZZA 4MEIA 1RNBA 2R4IA 3ALAA 3MG3A 1RHLA 1OHOA 2OOVA 1D6YA 1G02A 4HYZA 3CNMA 1VQO3 3A76A 1TUHA 1YIT3 2HMLB 3I0YA 2L1SA 1LXEA 1A2KA 1DYUA 3JUNA 3CD63 3KZTA 1UGIA 4GL6A 5AIIA 1W01A 1E3RA 1JB2A 1AV4A 2KAAA 5GSPA 4KFEA 3EF8A 3NM7A 4I4KA 1RKYA 4BIRA 3V99A 1O7MB 4XM4A 4K1VA 3CC73 1STFI 1IV9A 3AGNA 4N6NB 5M1AA 5IENA 2K54A 4STDA 3CPOA 4O02B 1TJDA 4X2HA 1UI7A 1JB5A 3BU4A 3G16A 4HOHA 3WA2X 1X1WA 5JPUA 1K9M4 1RRLA 1MGWA 1JNQA 1HZ1A 4H3UA 1RNTA 2YFJB 4G1MB 1TFOA 3LXUX 4J5GA 3MYTA 4DKIA 3OV4A 3BNDA 1ZO2A 1YJW3 1LNIA 2GEYA 3K5TA 1Q864 1KC84 2P38A 5A0OB 1QVF2 1GOUA 2IUKA 1GD4A 2ZDJA 3L0RA 7STDA 3LZAA 5FW5A 3WR2A 3FLJA 2IUJA 4WYKA 1IQYA 3Q3FA 3DGYA 4R80A 2KF4A 2F5WA 1V58A 1FUSA 2Z77A 2GBXB 3B8LA 4OUQA 1K28A 4TX4A 1Q824 1B21A 1N8QA 3BIRA 3PCRA 1IQ8A 4RZMA 3BB9A 1BUJA 3NQZA 1YVBI 2XR8B 2STDA 1W4NA 2ZA4A 2ML5A 3KSPA 5AI1A 2W56B 4LMIA 1LOXA 1EUIC 2ML6A 1MOLA 1CH0A 1D6ZA 1GD3A 4HZ9B 1BNRA 1JKGB 3HIIA 1I3FA 2Z76A 1LOVA 3STDA 1RDSA 4O8SA 3EN1B 3DGNA 1GY6A 2W04A 5BU4A 3PYJA 4RNZA 3J7Yd 3T8UA 3FG3A 2MF7A 2JDIH 3CCU3 1YGEA 4K61A 5CK6A 1W6CA 5G2GA 4CCVA 2P09A 1K734 4U13A 2CG0A 1K8A4 1BNFA 3CCL3 1UCIA 2BU4A 2K0MA 2Z6BA 1Q40B 3T0UA 1WMOA 3CME3 2I9WA 2BMQB 3IJEB 3DY5A 3K9MC 4RNTA 4QWTA 2CH9A 2W9QA 3D3LA 3G0KA 1RGHA 2XEPA 1JN5A 3DGOA 1FUWA 1RGFA 1E97A 1RRHA 4HJLB 3KIIA 3SYUA 1LNHA 1O7HB 3PGBA 3CC43 4IT7A 3K0ZA 4R9LA 4NHFA 3D4AA 2XGNA 4FMAA 1IK3A 2F98A 3A5EA 1AY7A 5EQLA 2XGLA 4GSPA 1I0VA 3Q90A 3AGOA 2QEX3 2KF3A 1IYYA 4GB5A 5IEPA 1BSCA 1O7WB 4FCJA 1SQWA 1K41A 2CG1A 1YHQ3 1RSNA 1QALA 3H51A 3HI7A 1SJWA 1JRQA 2O9UX 4AKYA 1AVLA 4BL3A 3SVAA 4HM2B 3B4PA 1IVVA 1MWSA 1RGKA 2P0MA 3CCE3 2IA7A 1W02A 1PFPA 1JBSA 3BNBA 3S5CA 5BXQA 1JZOA 1UCJA 1VQK3 1B2UA 1QJGA 1IDPA 3DGMA 2SBLA 1A2PA 3OWYA 1VQ93 1I3IA 2GSPA 1DETA 3NUVA 1FGTA 1RCKA 2CFKA 4EXRA 1A90A 3HIGA 1YJ93 3AMOB 4HZBB 2SARA 2CFDA 3LOYA 3NV0A 2HOHA 1SPUA 4Q53A 2WGOA 1BRGA 3UL6A 2Q07A 1YIJ3 2M7OA 1JBTA 1T2IA 3BNEA 3EB8A 1YNVX 5IW9A 2J8XB 4L7KA 1EA2A 3F8HA 3WDGB 4PEJA 2KXGA 3D5GA 5CXOA 2CFWA 1BOXA 1EG9B 1OF5A 1RGGA 2E2UA 3FF2A 4O2HA 4RBNA 4XBXA 3WODG 3AHSA 3MPHA 4K1UA 4EW5A 2HMJB 4HM4B 4HAAA 3ROBA 2WOHA 1D6UA 1BANA 1UUGB 1V57A 1O7NB 1RTUA 3O8YA 5BVBA 5CF2A 1A67A 1VQ73 3SX1A 3CCJ3 2C4BA 2H0HA 3IMAB 2CIUA 1I8VA 5AEWB 3G6E3 1R4YA 2UUGC 1Z1SA 1BSAA 1WMNA 2K3DA 3GWRA 3S29A 1ULIB 1Q7HA 3BNCA 7RNTA 2ZL8A 3HOHA 1NJI4 1WTHA 3BLZA 1LVNA 3D5IA 8CHOA 2AAEA 2KRTA 3JVCA 3EN8A 2XSHB 5LC6A 3ZG5A 1S723 3FKAA 3MWZA 1HKXA 4HVNA 1Q814 2INXA 5CF1A 2A15A 1X1YA 3CPW2 1V74A 3DM8A 1IVUA 4WFOA 3FG1A 1E3VA 1NB3I 2HMMB 3K7CA 4IPBA 9RNTA 1VQ53 2OTL3 3FCSB 1IT8A 3MKIA 1OGZA 1ROAA 3DGLA 3GSPA 1M1K4 1KSIA 1OUNA 3K63A 1BNEA 3X3XA 1UDII 3SXXA 1RGEA 4FR9A 1N9EA 1GOYA 1MGRA 1IVWA 4OK0A 3EQQB 4J8TA 5EVHA 1M904 5IG0A 2RSXA 1NO3A 1CYVA 1U8CB 2H0IA 3CNXA 4XDVA 3UL5A 3NBJA 3DMCA 2OCTA 1BAOA 1WMPA 1UUVB 2AADA 1DVDA 1CEWI 1ISKA 1VQ43 3CU3A 4HM0B 4N6OB 1GYBA 1T2HA 4LYLB 2BT3A 2QIYA 3EX9A 4WYKB 3X3YA 3SOYA 2C10A 1OGXA 2CFLA 2OWPA 5AEUB 1OACA 4XB5A 4ZM8A 4HM6B 1W5ZA 2RBIA 1O7GB 3JUMA 3PCSA 4HM3B 1I2GA 4N6UA 1TTOA 3SLUA 1Q42A 1Q9EA 3CCQ3 3GZBA 3LTBA 4LSOA 2CFGA 3CCR3 1Q7Y4 4EV5A 3I563 1FGQA 4N6V0 1EEJA 3ZFZA 2CWUA 5AIHA 1OPYA 1TFKA 1JZDA 3NQYA 3ECFA 4J9AA 1I2FA 1AVKA 1FGRA 3F7SA 1YGWA 5HOHA 3RDEA 4RNYA 5HGRA 5CLKA 1YVSA 2ZHXB 4N6TA 1RCLA 3S67A 3KKGA 2RNTA 4NREA 1RLSA 3GZXB 1ZGXA 3DZLA 4R1KA 3RNTA 2PNCA 1DE3A 4IIAA 3X42A 3U97A 1FUTA 1KQS2 4K90B 4LEHA 1RGCA 5IEOA 5D82A 5AIGA 2OQEA 1N8R4 3EJVA 3NBBA 6RNTA 1T5YA 2W9PA 1RMSA 3G8ZA 1B2ZA 1BRSA 5D83A 3X3ZA 4BU4A 2YX9A 1JN5B 1NDOB 1TIJA 3D9RA 2XSOB 3VF1A 4FMCA 3B4OA 1FGMA 1AQZA 1PYLA 2CHCA 3NXJA 2CW9A 3WHOA 5ELJA 1I2EA 1CQSA 4R4KA 4N3VA 2V1LA 4J5KA 1VQ83 1W6YA 2QA43 2Y74A 4CDLA 1BNSA 3PXMA 4HM1B 4HM8B 3OWSA 4HKVB 1W7CA 1RN7A 2RCDA 3UB1A 5KP1A 2KF5A 3OW22 2D1WA 1TRPA 3LMLA 2MC8A 2HMOB 1VQL3 1BRJA 3KSED 5IG5A 2F56A 1BRIA 1GS3A 4XBYA 4FCZA 3I553 1U5OA 3URPA 3MG1A 3N9HA 4NPBA 5IERA 4HM5B 1QAKA 1US1A 1BIRA 1BRHA 1LQMB 1RGAA 2BNGA 2CWTA 2RGQA 7GSPA 1AR0A 5EEOA 1UI8A 1B3SA 3UNLA 1RGLA 3TDGA 1BSBA 1B20A 4O3VA 1LRAA 3DUKA 3KCHA 4HBRA 1S5AA 2LQVA 4L8PA 1VQP3 1GOVA 5BIRA 3DH2A 1DMNA 3X41A 2BMOB 3EC9A 1W2ZA 3NV0B 3OX9A 4WP5A 1WNHA 2F86B 1M9GA 1NNVA 1C7HA 3FGYA 3LYGA 3AHWA 1ZS7A 2XH9A 5KP3A 1TU5A 4XDWA 2YFIB 1OF5B 2KF6A 4BL2A 1BRKA 1KWIA 2LYXA 2O3OA 2XRXB 3F8XA 4KZ1A 1EQKA 1BSDA 5M18A 2B24B 2E2TA 5M19A 1BRNL 4EV2A 1JB4A 1IV7A 2FNQA 1FA3A 1O7PB 1X1UA 4AKZA 5G1LA 1UW1A 2HMNB 3MG2A 2Z7AA 1IU7A 3HK4A 1SARA 2XFSA 4N6LA 5G1KA 4X2OA 2F99A 1UCKA 1GMRA 2CWVA 5DRVA 1BU4A 1T3BA 1BNGA 2JQ5A 1N5PA 2XF3A 5DREA 5KP4A 1BUQA 3PS8A 1J2BA 1RN4A 2KCDA 1QMAA 3RGRA 3CXC2 1GY5A 1DVCA 1UGHI 2WO0A 3EBYA 2UGIA 3S28A 4EBGA 4I5QA 3HZPA 4LZIA 3MSOA 2CC3A 3EE1A
chains in the Genus database with same CATH topology
4BTYA 1CYUA 2IMJA 3JUQA 3VSYA 4LGQA 2CK3H 3Q2PA 3T8NA 1WQLB 4MJDA 3WOFB 3F40A 2W2CA 3QRDA 5AYSC 3NX0A 4MMXB 1NWWA 4H61A 4HM7B 4KVHA 1SIIA 1NU3A 3GZRA 4JRFA 3CCV3 3LTDA 1EKMA 3LTAA 3ER7A 5FGOA 2W56A 2WGQA 3V92A 3LTCA 5IF6A 4ORLA 3WOEB 3GAXA 3V98A 1JKGA 2E2VA 3EHCA 4MMZB 1ROVA 4L8OA 1M1XB 1QVG2 2OQEC 3E99A 1IQXA 1W00A 2B1XB 3PZWA 2L4VA 2W0QA 2GBWB 3CC23 3GRDA 1IVXA 2CKFB 2W03A 1ZX2A 4EC6A 1Q40A 2GU3A 2W6JH 3JUOA 5LC7A 3G713 4N6MA 5IG3A 1MNLA 1R4CA 3QK9A 1VQ63 5STDA 1HU9A 3LT9A 3NHXA 4FMBA 1A2VA 2RFRA 4WHAA 1JJ22 4EYCA 3EBTA 1OH0A 1STDA 3H3HA 4BTWA 1IT7A 1QAFA 3U1WA 5AIFA 1W6GA 3MHEA 1ASKA 3SEDA 3NBRA 3KE7A 3FF0A 3WA3A 3Q1CA 3LH4A 5ELUA 4BTXA 2P0XA 3X40A 1Y4KA 3N54B 5I97A 1OHSA 4WWUC 4AEQA 2GXFA 4OVMA 3LT8A 4KFFA 3OWUA 2BO9B 2BHMA 2GEXA 3CCS3 1GY7A 3NM2A 5TGNA 3RGAA 3CMA3 2FGTA 2PZVA 3HX8A 1SIHA 3S27A 3VGNA 3N8BA 1F8NA 6STDA 5JBSA 1OCVA 1VQM3 3OXAA 4FCMA 2WOFA 2BMRB 2YFLB 4R9KA 2HMKB 4KFDA 3JUPA 3M8CA 2D42A 1TP6A 3DXOA 3FSDA 3CCM3 1DMQA 3G4S3 3KN4A 2Y73A 3FH1A 1VQN3 4JF8A 1UUWB 1ULJB 4MMYB 1KD14 3AMOA 4XBTA 3UJMA 1FGOA 5D81A 1DMMA 3F9SA 4FMDA 1W2B2 3B7CA 3F14A 3WMDA 1N5HA 2C11A 3GZYB 1JV2B 2QGUA 2OTJ3 2P05A 2OOVC 1N9JA 5IG4A 3F7XA 1G96A 3IPTA 3KFQC 3SOAA 1YI23 2UX0A 1YJN3 1RJOA 2FXTA 5JPPA 1L5GB 3FZWA 2GU1A 1PU4A 1NB5I 1OHPA 2XFTA 3FG4A 5AYRB 1VZZA 4MEIA 2R4IA 3ALAA 3MG3A 1OHOA 2OOVA 1D6YA 4HYZA 3CNMA 1VQO3 3A76A 1TUHA 1YIT3 2HMLB 3I0YA 1LXEA 1A2KA 1DYUA 3JUNA 3CD63 3KZTA 4GL6A 5AIIA 1W01A 1E3RA 1JB2A 1AV4A 4KFEA 3EF8A 3NM7A 4I4KA 1RKYA 3V99A 1O7MB 4XM4A 4K1VA 3CC73 1STFI 1IV9A 4N6NB 5IENA 2K54A 4STDA 3CPOA 4O02B 4X2HA 1UI7A 1JB5A 3G16A 3WA2X 5JPUA 1K9M4 1RRLA 1JNQA 4H3UA 2YFJB 4G1MB 1TFOA 3LXUX 3MYTA 3OV4A 3BNDA 1ZO2A 1YJW3 2GEYA 3K5TA 1Q864 1KC84 2P38A 5A0OB 1QVF2 2IUKA 1GD4A 2ZDJA 3L0RA 7STDA 3LZAA 5FW5A 3FLJA 2IUJA 4WYKA 1IQYA 4R80A 2Z77A 2GBXB 3B8LA 4OUQA 1K28A 4TX4A 1Q824 1N8QA 3PCRA 1IQ8A 4RZMA 3BB9A 3NQZA 1YVBI 2XR8B 2STDA 1W4NA 3KSPA 2ML5A 5AI1A 2W56B 4LMIA 1LOXA 2ML6A 1MOLA 1D6ZA 1GD3A 4HZ9B 1JKGB 3HIIA 2Z76A 3STDA 4O8SA 3EN1B 3DGNA 1GY6A 2W04A 3PYJA 4RNZA 3J7Yd 3T8UA 3FG3A 2MF7A 2JDIH 3CCU3 1YGEA 4K61A 5CK6A 1W6CA 5G2GA 4CCVA 2P09A 1K734 4U13A 2CG0A 1K8A4 3CCL3 2K0MA 2Z6BA 1Q40B 3T0UA 1WMOA 3CME3 2I9WA 2BMQB 3IJEB 3DY5A 3K9MC 4QWTA 2CH9A 2W9QA 3D3LA 3G0KA 2XEPA 1JN5A 3DGOA 1FUWA 1RRHA 1E97A 4HJLB 3KIIA 1LNHA 1O7HB 3PGBA 3CC43 4IT7A 3K0ZA 4R9LA 4NHFA 2XGNA 4FMAA 1IK3A 2F98A 5EQLA 2XGLA 3Q90A 2QEX3 4GB5A 5IEPA 4FCJA 1O7WB 2CG1A 1SQWA 1K41A 1YHQ3 1QALA 3H51A 3HI7A 1SJWA 1JRQA 2O9UX 4AKYA 1AVLA 3SVAA 4HM2B 3B4PA 1IVVA 2P0MA 3CCE3 2IA7A 1W02A 1PFPA 3BNBA 3S5CA 5BXQA 1VQK3 1QJGA 1IDPA 3DGMA 2SBLA 3OWYA 1VQ93 3NUVA 1FGTA 2CFKA 4EXRA 1A90A 3HIGA 1YJ93 3AMOB 4HZBB 2CFDA 3LOYA 3NV0A 1SPUA 4Q53A 2WGOA 3UL6A 1YIJ3 2Q07A 2M7OA 3BNEA 3EB8A 5IW9A 4L7KA 1EA2A 3F8HA 3WDGB 4PEJA 2KXGA 5CXOA 2CFWA 4O2HA 1EG9B 1OF5A 2E2UA 3FF2A 4RBNA 3WODG 4XBXA 3MPHA 4K1UA 2HMJB 4HM4B 3ROBA 2WOHA 1D6UA 5BVBA 1O7NB 3O8YA 1A67A 5CF2A 1VQ73 3SX1A 3CCJ3 3IMAB 2CIUA 5AEWB 3G6E3 1Z1SA 1WMNA 3GWRA 3S29A 1ULIB 3BNCA 2ZL8A 1NJI4 1WTHA 3BLZA 1LVNA 8CHOA 3JVCA 2KRTA 3EN8A 2XSHB 5LC6A 1S723 3FKAA 3MWZA 1HKXA 4HVNA 1Q814 2INXA 5CF1A 2A15A 3CPW2 1V74A 3DM8A 1IVUA 4WFOA 3FG1A 1E3VA 1NB3I 2HMMB 3K7CA 4IPBA 1VQ53 2OTL3 3FCSB 1IT8A 3MKIA 1OGZA 1ROAA 3DGLA 1M1K4 1KSIA 1OUNA 3K63A 3X3XA 3SXXA 4FR9A 1N9EA 4OK0A 1IVWA 3EQQB 4J8TA 5EVHA 1M904 5IG0A 2RSXA 1NO3A 1CYVA 1U8CB 3CNXA 4XDVA 3UL5A 3NBJA 3DMCA 2OCTA 1WMPA 1UUVB 1DVDA 1CEWI 1ISKA 1VQ43 3CU3A 4HM0B 4N6OB 1GYBA 2BT3A 2QIYA 3EX9A 4WYKB 3X3YA 3SOYA 2C10A 1OGXA 2CFLA 2OWPA 5AEUB 1OACA 4XB5A 4ZM8A 4HM6B 1W5ZA 3PCSA 1O7GB 3JUMA 4HM3B 4N6UA 3SLUA 1Q42A 3CCQ3 3GZBA 3LTBA 4LSOA 2CFGA 3CCR3 1Q7Y4 4EV5A 3I563 1FGQA 4N6V0 2CWUA 5AIHA 1OPYA 1TFKA 3NQYA 4J9AA 3ECFA 1AVKA 1FGRA 3F7SA 3RDEA 4RNYA 5HGRA 5CLKA 4N6TA 3S67A 3KKGA 4NREA 3GZXB 3DZLA 4R1KA 2PNCA 4IIAA 3X42A 3U97A 1KQS2 4K90B 4LEHA 5IEOA 5D82A 5AIGA 2OQEA 1N8R4 3EJVA 3NBBA 1T5YA 2W9PA 3G8ZA 3X3ZA 5D83A 2YX9A 1JN5B 1NDOB 1TIJA 3D9RA 2XSOB 3VF1A 4FMCA 3B4OA 1FGMA 3NXJA 2CHCA 2CW9A 5ELJA 1CQSA 4R4KA 4N3VA 2V1LA 1VQ83 1W6YA 2QA43 2Y74A 4CDLA 3PXMA 4HM1B 4HM8B 3OWSA 4HKVB 1W7CA 1RN7A 2RCDA 3UB1A 5KP1A 3OW22 2D1WA 3LMLA 2MC8A 2HMOB 1VQL3 3KSED 5IG5A 1GS3A 4XBYA 4FCZA 3I553 1U5OA 3MG1A 3N9HA 5IERA 4HM5B 1QAKA 1US1A 2BNGA 2CWTA 2RGQA 1AR0A 5EEOA 1UI8A 3UNLA 3TDGA 4O3VA 4HBRA 3DUKA 1S5AA 2LQVA 4L8PA 1VQP3 1DMNA 3X41A 2BMOB 3EC9A 1W2ZA 3NV0B 3OX9A 4WP5A 1WNHA 2F86B 1M9GA 1C7HA 3FGYA 3LYGA 2XH9A 5KP3A 1TU5A 4XDWA 2YFIB 1OF5B 1KWIA 2LYXA 2O3OA 2XRXB 3F8XA 4KZ1A 1EQKA 2B24B 2E2TA 4EV2A 1JB4A 1IV7A 2FNQA 1FA3A 1O7PB 4AKZA 1UW1A 2HMNB 3MG2A 2Z7AA 1IU7A 3HK4A 2XFSA 4N6LA 4X2OA 2F99A 2CWVA 5DRVA 2JQ5A 5KP4A 1N5PA 2XF3A 5DREA 1BUQA 3PS8A 1J2BA 2KCDA 3CXC2 1QMAA 3RGRA 1GY5A 1DVCA 2WO0A 3EBYA 3S28A 4EBGA 3HZPA 4LZIA 3MSOA 2CC3A 3EE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IMJ A;  3JUQ A;  3VSY A;  4LGQ A;  3T8N A;  1WQL B;  4MJD A;  3F40 A;  2W2C A;  1NWW A;  4HM7 B;  4KVH A;  1NU3 A;  3GZR A;  3ER7 A;  5IF6 A;  4ORL A;  1JKG A;  3EHC A;  4L8O A;  3E99 A;  1W00 A;  2B1X B;  2GBW B;  3GRD A;  2CKF B;  1ZX2 A;  1Q40 A;  3JUO A;  5IG3 A;  5STD A;  3NHX A;  2RFR A;  3EBT A;  1OH0 A;  1STD A;  3H3H A;  5AIF A;  3SED A;  3MHE A;  1ASK A;  3NBR A;  3KE7 A;  3FF0 A;  1OHS A;  4WWU C;  2GXF A;  4OVM A;  3OWU A;  2GEX A;  1GY7 A;  3NM2 A;  5TGN A;  3RGA A;  2PZV A;  3HX8 A;  3VGN A;  6STD A;  1OCV A;  3OXA A;  4FCM A;  2BMR B;  2YFL B;  4R9K A;  2HMK B;  3JUP A;  3M8C A;  1TP6 A;  3DXO A;  3FSD A;  1DMQ A;  3FH1 A;  1UUW B;  1ULJ B;  4XBT A;  3UJM A;  5D81 A;  1DMM A;  3F9S A;  3B7C A;  3F14 A;  3WMD A;  3GZY B;  2QGU A;  5IG4 A;  3F7X A;  3IPT A;  3SOA A;  2UX0 A;  5JPP A;  3FZW A;  1OHP A;  1VZZ A;  2R4I A;  3MG3 A;  1OHO A;  3CNM A;  3A76 A;  1TUH A;  2HML B;  3I0Y A;  1A2K A;  3JUN A;  3KZT A;  5AII A;  1W01 A;  1E3R A;  1JB2 A;  3EF8 A;  4I4K A;  1O7M B;  4XM4 A;  4K1V A;  5IEN A;  2K54 A;  4STD A;  3CPO A;  4X2H A;  1JB5 A;  3G16 A;  5JPU A;  4H3U A;  2YFJ B;  3MYT A;  3OV4 A;  1ZO2 A;  2GEY A;  7STD A;  3LZA A;  5FW5 A;  3FLJ A;  4WYK A;  2Z77 A;  2GBX B;  3B8L A;  4OUQ A;  4RZM A;  3BB9 A;  2XR8 B;  2STD A;  3KSP A;  5AI1 A;  4LMI A;  4HZ9 B;  1JKG B;  2Z76 A;  3STD A;  3EN1 B;  1GY6 A;  3T8U A;  5CK6 A;  5G2G A;  4U13 A;  1Q40 B;  2I9W A;  2BMQ B;  3G0K A;  1JN5 A;  4HJL B;  1E97 A;  1O7H B;  3K0Z A;  4R9L A;  2F98 A;  3Q90 A;  4GB5 A;  5IEP A;  4FCJ A;  1O7W B;  1K41 A;  3H51 A;  1SJW A;  4HM2 B;  3B4P A;  1W02 A;  3S5C A;  5BXQ A;  1QJG A;  1IDP A;  3OWY A;  3NUV A;  4HZB B;  3NV0 A;  4Q53 A;  4L7K A;  1EA2 A;  3F8H A;  4PEJ A;  5CXO A;  1EG9 B;  1OF5 A;  3FF2 A;  4XBX A;  4K1U A;  2HMJ B;  4HM4 B;  3ROB A;  5BVB A;  1O7N B;  5CF2 A;  5AEW B;  1Z1S A;  3GWR A;  1ULI B;  3BLZ A;  8CHO A;  3EN8 A;  2XSH B;  3FKA A;  4HVN A;  1HKX A;  2INX A;  5CF1 A;  2A15 A;  3DM8 A;  1E3V A;  2HMM B;  3K7C A;  3MKI A;  1OGZ A;  1OUN A;  3EQQ B;  4J8T A;  5EVH A;  5IG0 A;  3CNX A;  4XDV A;  3DMC A;  1UUV B;  1ISK A;  3CU3 A;  4HM0 B;  1GYB A;  3EX9 A;  2QIY A;  4WYK B;  3SOY A;  1OGX A;  5AEU B;  2OWP A;  4XB5 A;  4HM6 B;  4HM3 B;  1O7G B;  3JUM A;  1Q42 A;  3GZB A;  5AIH A;  1OPY A;  4J9A A;  3ECF A;  3F7S A;  5HGR A;  5CLK A;  3KKG A;  3GZX B;  3DZL A;  4R1K A;  4IIA A;  4LEH A;  5IEO A;  5D82 A;  5AIG A;  3EJV A;  3G8Z A;  5D83 A;  1JN5 B;  1NDO B;  3D9R A;  2XSO B;  3B4O A;  3NXJ A;  2CHC A;  1CQS A;  4N3V A;  1W6Y A;  4CDL A;  4HM1 B;  4HM8 B;  3OWS A;  4HKV B;  2RCD A;  5KP1 A;  2HMO B;  5IG5 A;  1GS3 A;  4XBY A;  1U5O A;  3MG1 A;  5IER A;  4HM5 B;  2BNG A;  2RGQ A;  1AR0 A;  3UNL A;  3DUK A;  1S5A A;  4L8P A;  1DMN A;  2BMO B;  3EC9 A;  3OX9 A;  3NV0 B;  4WP5 A;  2F86 B;  1C7H A;  3LYG A;  5KP3 A;  4XDW A;  2YFI B;  1OF5 B;  3F8X A;  2XRX B;  2B24 B;  1JB4 A;  1O7P B;  2HMN B;  3MG2 A;  2Z7A A;  3HK4 A;  4X2O A;  2F99 A;  5DRV A;  2JQ5 A;  5KP4 A;  5DRE A;  1BUQ A;  1QMA A;  3RGR A;  1GY5 A;  3EBY A;  3HZP A;  3MSO A;  3FGY A; 
#chains in the Genus database with same CATH topology
 4BTY A;  2IY2 A;  1CYU A;  2IMJ A;  3JUQ A;  1RN1 A;  3VSY A;  4KT3 B;  4LGQ A;  2CK3 H;  3Q2P A;  2CX0 A;  3T8N A;  1WQL B;  1LQG C;  4MJD A;  2H0G A;  3WOF B;  3F40 A;  2W2C A;  3QRD A;  5AYS C;  1LOY A;  3NX0 A;  4MMX B;  1NWW A;  4H61 A;  4HM7 B;  4KVH A;  1SII A;  1NU3 A;  3GZR A;  4JRF A;  3CCV 3;  3ZG0 A;  2F5M A;  1EKM A;  3LTA A;  3LTD A;  3ER7 A;  5FGO A;  2W56 A;  2WGQ A;  3V92 A;  3LTC A;  1BNJ A;  5IF6 A;  4ORL A;  3WOE B;  3GAX A;  3V98 A;  1JKG A;  1FZU A;  2E2V A;  3EHC A;  4MMZ B;  1ROV A;  4L8O A;  1M1X B;  1I70 A;  1C54 A;  1LOW A;  1QVG 2;  2OQE C;  3E99 A;  1IQX A;  1W00 A;  2B1X B;  3PZW A;  3D79 A;  2L4V A;  2W0Q A;  2GBW B;  1MWT A;  3GRD A;  1IVX A;  3CC2 3;  2CKF B;  2W03 A;  1ZX2 A;  4EC6 A;  2BIR A;  1Q40 A;  2GU3 A;  2W6J H;  3JUO A;  5LC7 A;  3G71 3;  4N6M A;  4CJN A;  5IG3 A;  1MNL A;  1GSP A;  1R4C A;  3QK9 A;  1VQ6 3;  5STD A;  1HU9 A;  3LT9 A;  1MWU A;  3NHX A;  1BVI A;  4FMB A;  1JBR A;  1A2V A;  2RFR A;  4WHA A;  1JJ2 2;  4EYC A;  3EBT A;  1BGS A;  1OH0 A;  1STD A;  3H3H A;  8RNT A;  5RNT A;  4BTW A;  1IT7 A;  1QAF A;  3U1W A;  5AIF A;  1W6G A;  1GMP A;  1ASK A;  1PY3 A;  3MHE A;  3SED A;  3NBR A;  3KE7 A;  3FF0 A;  1HYF A;  3WA3 A;  1MWR A;  3Q1C A;  3LH4 A;  5ELU A;  4BTX A;  2P0X A;  3X40 A;  1Y4K A;  1B2M A;  3N54 B;  5I97 A;  1OHS A;  4WWU C;  4AEQ A;  2GXF A;  4OVM A;  3LT8 A;  1FW7 A;  1BSE A;  1X1X A;  3OWU A;  4KFF A;  1I0X A;  2BO9 B;  2BHM A;  2GEX A;  3CCS 3;  1GY7 A;  3NM2 A;  5TGN A;  1FYS A;  2F4Y A;  3RGA A;  2FGT A;  3CMA 3;  2PZV A;  3HX8 A;  1SIH A;  3S27 A;  3VGN A;  3N8B A;  1F8N A;  6STD A;  5JBS A;  1OCV A;  1VQM 3;  3OXA A;  4FCM A;  2WOF A;  2BMR B;  2YFL B;  4R9K A;  2HMK B;  4KFD A;  3JUP A;  3M8C A;  2D42 A;  1TP6 A;  3DXO A;  3FSD A;  3CCM 3;  1DMQ A;  3G4S 3;  3KN4 A;  4CPK A;  1GMQ A;  4ILF A;  2Y73 A;  3FH1 A;  1VQN 3;  4JF8 A;  1UUW B;  1ULJ B;  4MMY B;  1KD1 4;  3AMO A;  4XBT A;  3UJM A;  1FGO A;  1VQQ A;  4GHO A;  5D81 A;  1DMM A;  3F9S A;  4FMD A;  1W2B 2;  3B7C A;  1B2S A;  2R41 A;  3F14 A;  3WMD A;  1N5H A;  1TRQ A;  6GSP A;  2C11 A;  3GZY B;  1JV2 B;  2QGU A;  2OTJ 3;  2P05 A;  2OOV C;  1N9J A;  5IG4 A;  3F7X A;  1G96 A;  3IPT A;  1BNI A;  3KFQ C;  3SOA A;  1YI2 3;  1G0T A;  2UX0 A;  2CX1 A;  1YJN 3;  1RJO A;  1B27 A;  2FXT A;  5JPP A;  1L5G B;  3FZW A;  2GU1 A;  2IYJ A;  1PU4 A;  1UCL A;  1NB5 I;  1OHP A;  1B2X A;  2XFT A;  3FG4 A;  5AYR B;  1VZZ A;  4MEI A;  1RNB A;  2R4I A;  3ALA A;  3MG3 A;  1RHL A;  1OHO A;  2OOV A;  1D6Y A;  1G02 A;  4HYZ A;  3CNM A;  1VQO 3;  3A76 A;  1TUH A;  1YIT 3;  2HML B;  3I0Y A;  2L1S A;  1LXE A;  1A2K A;  1DYU A;  3JUN A;  3CD6 3;  3KZT A;  1UGI A;  4GL6 A;  5AII A;  1W01 A;  1E3R A;  1JB2 A;  1AV4 A;  2KAA A;  5GSP A;  4KFE A;  3EF8 A;  3NM7 A;  4I4K A;  1RKY A;  4BIR A;  3V99 A;  1O7M B;  4XM4 A;  4K1V A;  3CC7 3;  1STF I;  1IV9 A;  3AGN A;  4N6N B;  5M1A A;  5IEN A;  2K54 A;  4STD A;  3CPO A;  4O02 B;  1TJD A;  4X2H A;  1UI7 A;  1JB5 A;  3BU4 A;  3G16 A;  4HOH A;  3WA2 X;  1X1W A;  5JPU A;  1K9M 4;  1RRL A;  1MGW A;  1JNQ A;  1HZ1 A;  4H3U A;  1RNT A;  2YFJ B;  4G1M B;  1TFO A;  3LXU X;  4J5G A;  3MYT A;  4DKI A;  3OV4 A;  3BND A;  1ZO2 A;  1YJW 3;  1LNI A;  2GEY A;  3K5T A;  1Q86 4;  1KC8 4;  2P38 A;  5A0O B;  1QVF 2;  1GOU A;  2IUK A;  1GD4 A;  2ZDJ A;  3L0R A;  7STD A;  3LZA A;  5FW5 A;  3WR2 A;  3FLJ A;  2IUJ A;  4WYK A;  1IQY A;  3Q3F A;  3DGY A;  4R80 A;  2KF4 A;  2F5W A;  1V58 A;  1FUS A;  2Z77 A;  2GBX B;  3B8L A;  4OUQ A;  1K28 A;  4TX4 A;  1Q82 4;  1B21 A;  1N8Q A;  3BIR A;  3PCR A;  1IQ8 A;  4RZM A;  3BB9 A;  1BUJ A;  3NQZ A;  1YVB I;  2XR8 B;  2STD A;  1W4N A;  2ZA4 A;  2ML5 A;  3KSP A;  5AI1 A;  2W56 B;  4LMI A;  1LOX A;  1EUI C;  2ML6 A;  1MOL A;  1CH0 A;  1D6Z A;  1GD3 A;  4HZ9 B;  1BNR A;  1JKG B;  3HII A;  1I3F A;  2Z76 A;  1LOV A;  3STD A;  1RDS A;  4O8S A;  3EN1 B;  3DGN A;  1GY6 A;  2W04 A;  5BU4 A;  3PYJ A;  4RNZ A;  3J7Y d;  3T8U A;  3FG3 A;  2MF7 A;  2JDI H;  3CCU 3;  1YGE A;  4K61 A;  5CK6 A;  1W6C A;  5G2G A;  4CCV A;  2P09 A;  1K73 4;  4U13 A;  2CG0 A;  1K8A 4;  1BNF A;  3CCL 3;  1UCI A;  2BU4 A;  2K0M A;  2Z6B A;  1Q40 B;  3T0U A;  1WMO A;  3CME 3;  2I9W A;  2BMQ B;  3IJE B;  3DY5 A;  3K9M C;  4RNT A;  4QWT A;  2CH9 A;  2W9Q A;  3D3L A;  3G0K A;  1RGH A;  2XEP A;  1JN5 A;  3DGO A;  1FUW A;  1RGF A;  1E97 A;  1RRH A;  4HJL B;  3KII A;  3SYU A;  1LNH A;  1O7H B;  3PGB A;  3CC4 3;  4IT7 A;  3K0Z A;  4R9L A;  4NHF A;  3D4A A;  2XGN A;  4FMA A;  1IK3 A;  2F98 A;  3A5E A;  1AY7 A;  5EQL A;  2XGL A;  4GSP A;  1I0V A;  3Q90 A;  3AGO A;  2QEX 3;  2KF3 A;  1IYY A;  4GB5 A;  5IEP A;  1BSC A;  1O7W B;  4FCJ A;  1SQW A;  1K41 A;  2CG1 A;  1YHQ 3;  1RSN A;  1QAL A;  3H51 A;  3HI7 A;  1SJW A;  1JRQ A;  2O9U X;  4AKY A;  1AVL A;  4BL3 A;  3SVA A;  4HM2 B;  3B4P A;  1IVV A;  1MWS A;  1RGK A;  2P0M A;  3CCE 3;  2IA7 A;  1W02 A;  1PFP A;  1JBS A;  3BNB A;  3S5C A;  5BXQ A;  1JZO A;  1UCJ A;  1VQK 3;  1B2U A;  1QJG A;  1IDP A;  3DGM A;  2SBL A;  1A2P A;  3OWY A;  1VQ9 3;  1I3I A;  2GSP A;  1DET A;  3NUV A;  1FGT A;  1RCK A;  2CFK A;  4EXR A;  1A90 A;  3HIG A;  1YJ9 3;  3AMO B;  4HZB B;  2SAR A;  2CFD A;  3LOY A;  3NV0 A;  2HOH A;  1SPU A;  4Q53 A;  2WGO A;  1BRG A;  3UL6 A;  2Q07 A;  1YIJ 3;  2M7O A;  1JBT A;  1T2I A;  3BNE A;  3EB8 A;  1YNV X;  5IW9 A;  2J8X B;  4L7K A;  1EA2 A;  3F8H A;  3WDG B;  4PEJ A;  2KXG A;  3D5G A;  5CXO A;  2CFW A;  1BOX A;  1EG9 B;  1OF5 A;  1RGG A;  2E2U A;  3FF2 A;  4O2H A;  4RBN A;  4XBX A;  3WOD G;  3AHS A;  3MPH A;  4K1U A;  4EW5 A;  2HMJ B;  4HM4 B;  4HAA A;  3ROB A;  2WOH A;  1D6U A;  1BAN A;  1UUG B;  1V57 A;  1O7N B;  1RTU A;  3O8Y A;  5BVB A;  5CF2 A;  1A67 A;  1VQ7 3;  3SX1 A;  3CCJ 3;  2C4B A;  2H0H A;  3IMA B;  2CIU A;  1I8V A;  5AEW B;  3G6E 3;  1R4Y A;  2UUG C;  1Z1S A;  1BSA A;  1WMN A;  2K3D A;  3GWR A;  3S29 A;  1ULI B;  1Q7H A;  3BNC A;  7RNT A;  2ZL8 A;  3HOH A;  1NJI 4;  1WTH A;  3BLZ A;  1LVN A;  3D5I A;  8CHO A;  2AAE A;  2KRT A;  3JVC A;  3EN8 A;  2XSH B;  5LC6 A;  3ZG5 A;  1S72 3;  3FKA A;  3MWZ A;  1HKX A;  4HVN A;  1Q81 4;  2INX A;  5CF1 A;  2A15 A;  1X1Y A;  3CPW 2;  1V74 A;  3DM8 A;  1IVU A;  4WFO A;  3FG1 A;  1E3V A;  1NB3 I;  2HMM B;  3K7C A;  4IPB A;  9RNT A;  1VQ5 3;  2OTL 3;  3FCS B;  1IT8 A;  3MKI A;  1OGZ A;  1ROA A;  3DGL A;  3GSP A;  1M1K 4;  1KSI A;  1OUN A;  3K63 A;  1BNE A;  3X3X A;  1UDI I;  3SXX A;  1RGE A;  4FR9 A;  1N9E A;  1GOY A;  1MGR A;  1IVW A;  4OK0 A;  3EQQ B;  4J8T A;  5EVH A;  1M90 4;  5IG0 A;  2RSX A;  1NO3 A;  1CYV A;  1U8C B;  2H0I A;  3CNX A;  4XDV A;  3UL5 A;  3NBJ A;  3DMC A;  2OCT A;  1BAO A;  1WMP A;  1UUV B;  2AAD A;  1DVD A;  1CEW I;  1ISK A;  1VQ4 3;  3CU3 A;  4HM0 B;  4N6O B;  1GYB A;  1T2H A;  4LYL B;  2BT3 A;  2QIY A;  3EX9 A;  4WYK B;  3X3Y A;  3SOY A;  2C10 A;  1OGX A;  2CFL A;  2OWP A;  5AEU B;  1OAC A;  4XB5 A;  4ZM8 A;  4HM6 B;  1W5Z A;  2RBI A;  1O7G B;  3JUM A;  3PCS A;  4HM3 B;  1I2G A;  4N6U A;  1TTO A;  3SLU A;  1Q42 A;  1Q9E A;  3CCQ 3;  3GZB A;  3LTB A;  4LSO A;  2CFG A;  3CCR 3;  1Q7Y 4;  4EV5 A;  3I56 3;  1FGQ A;  4N6V 0;  1EEJ A;  3ZFZ A;  2CWU A;  5AIH A;  1OPY A;  1TFK A;  1JZD A;  3NQY A;  3ECF A;  4J9A A;  1I2F A;  1AVK A;  1FGR A;  3F7S A;  1YGW A;  5HOH A;  3RDE A;  4RNY A;  5HGR A;  5CLK A;  1YVS A;  2ZHX B;  4N6T A;  1RCL A;  3S67 A;  3KKG A;  2RNT A;  4NRE A;  1RLS A;  3GZX B;  1ZGX A;  3DZL A;  4R1K A;  3RNT A;  2PNC A;  1DE3 A;  4IIA A;  3X42 A;  3U97 A;  1FUT A;  1KQS 2;  4K90 B;  4LEH A;  1RGC A;  5IEO A;  5D82 A;  5AIG A;  2OQE A;  1N8R 4;  3EJV A;  3NBB A;  6RNT A;  1T5Y A;  2W9P A;  1RMS A;  3G8Z A;  1B2Z A;  1BRS A;  5D83 A;  3X3Z A;  4BU4 A;  2YX9 A;  1JN5 B;  1NDO B;  1TIJ A;  3D9R A;  2XSO B;  3VF1 A;  4FMC A;  3B4O A;  1FGM A;  1AQZ A;  1PYL A;  2CHC A;  3NXJ A;  2CW9 A;  3WHO A;  5ELJ A;  1I2E A;  1CQS A;  4R4K A;  4N3V A;  2V1L A;  4J5K A;  1VQ8 3;  1W6Y A;  2QA4 3;  2Y74 A;  4CDL A;  1BNS A;  3PXM A;  4HM1 B;  4HM8 B;  3OWS A;  4HKV B;  1W7C A;  1RN7 A;  2RCD A;  3UB1 A;  5KP1 A;  2KF5 A;  3OW2 2;  2D1W A;  1TRP A;  3LML A;  2MC8 A;  2HMO B;  1VQL 3;  1BRJ A;  3KSE D;  5IG5 A;  2F56 A;  1BRI A;  1GS3 A;  4XBY A;  4FCZ A;  3I55 3;  1U5O A;  3URP A;  3MG1 A;  3N9H A;  4NPB A;  5IER A;  4HM5 B;  1QAK A;  1US1 A;  1BIR A;  1BRH A;  1LQM B;  1RGA A;  2BNG A;  2CWT A;  2RGQ A;  7GSP A;  1AR0 A;  5EEO A;  1UI8 A;  1B3S A;  3UNL A;  1RGL A;  3TDG A;  1BSB A;  1B20 A;  4O3V A;  1LRA A;  3DUK A;  3KCH A;  4HBR A;  1S5A A;  2LQV A;  4L8P A;  1VQP 3;  1GOV A;  5BIR A;  3DH2 A;  1DMN A;  3X41 A;  2BMO B;  3EC9 A;  1W2Z A;  3NV0 B;  3OX9 A;  4WP5 A;  1WNH A;  2F86 B;  1M9G A;  1NNV A;  1C7H A;  3FGY A;  3LYG A;  3AHW A;  1ZS7 A;  2XH9 A;  5KP3 A;  1TU5 A;  4XDW A;  2YFI B;  1OF5 B;  2KF6 A;  4BL2 A;  1BRK A;  1KWI A;  2LYX A;  2O3O A;  2XRX B;  3F8X A;  4KZ1 A;  1EQK A;  1BSD A;  5M18 A;  2B24 B;  2E2T A;  5M19 A;  1BRN L;  4EV2 A;  1JB4 A;  1IV7 A;  2FNQ A;  1FA3 A;  1O7P B;  1X1U A;  4AKZ A;  5G1L A;  1UW1 A;  2HMN B;  3MG2 A;  2Z7A A;  1IU7 A;  3HK4 A;  1SAR A;  2XFS A;  4N6L A;  5G1K A;  4X2O A;  2F99 A;  1UCK A;  1GMR A;  2CWV A;  5DRV A;  1BU4 A;  1T3B A;  1BNG A;  2JQ5 A;  1N5P A;  2XF3 A;  5DRE A;  5KP4 A;  1BUQ A;  3PS8 A;  1J2B A;  1RN4 A;  2KCD A;  1QMA A;  3RGR A;  3CXC 2;  1GY5 A;  1DVC A;  1UGH I;  2WO0 A;  3EBY A;  2UGI A;  3S28 A;  4EBG A;  4I5Q A;  3HZP A;  4LZI A;  3MSO A;  2CC3 A;  3EE1 A; 
#chains in the Genus database with same CATH homology
 4BTY A;  1CYU A;  2IMJ A;  3JUQ A;  3VSY A;  4LGQ A;  2CK3 H;  3Q2P A;  3T8N A;  1WQL B;  4MJD A;  3WOF B;  3F40 A;  2W2C A;  3QRD A;  5AYS C;  3NX0 A;  4MMX B;  1NWW A;  4H61 A;  4HM7 B;  4KVH A;  1SII A;  1NU3 A;  3GZR A;  4JRF A;  3CCV 3;  3LTD A;  1EKM A;  3LTA A;  3ER7 A;  5FGO A;  2W56 A;  2WGQ A;  3V92 A;  3LTC A;  5IF6 A;  4ORL A;  3WOE B;  3GAX A;  3V98 A;  1JKG A;  2E2V A;  3EHC A;  4MMZ B;  1ROV A;  4L8O A;  1M1X B;  1QVG 2;  2OQE C;  3E99 A;  1IQX A;  1W00 A;  2B1X B;  3PZW A;  2L4V A;  2W0Q A;  2GBW B;  3CC2 3;  3GRD A;  1IVX A;  2CKF B;  2W03 A;  1ZX2 A;  4EC6 A;  1Q40 A;  2GU3 A;  2W6J H;  3JUO A;  5LC7 A;  3G71 3;  4N6M A;  5IG3 A;  1MNL A;  1R4C A;  3QK9 A;  1VQ6 3;  5STD A;  1HU9 A;  3LT9 A;  3NHX A;  4FMB A;  1A2V A;  2RFR A;  4WHA A;  1JJ2 2;  4EYC A;  3EBT A;  1OH0 A;  1STD A;  3H3H A;  4BTW A;  1IT7 A;  1QAF A;  3U1W A;  5AIF A;  1W6G A;  3MHE A;  1ASK A;  3SED A;  3NBR A;  3KE7 A;  3FF0 A;  3WA3 A;  3Q1C A;  3LH4 A;  5ELU A;  4BTX A;  2P0X A;  3X40 A;  1Y4K A;  3N54 B;  5I97 A;  1OHS A;  4WWU C;  4AEQ A;  2GXF A;  4OVM A;  3LT8 A;  4KFF A;  3OWU A;  2BO9 B;  2BHM A;  2GEX A;  3CCS 3;  1GY7 A;  3NM2 A;  5TGN A;  3RGA A;  3CMA 3;  2FGT A;  2PZV A;  3HX8 A;  1SIH A;  3S27 A;  3VGN A;  3N8B A;  1F8N A;  6STD A;  5JBS A;  1OCV A;  1VQM 3;  3OXA A;  4FCM A;  2WOF A;  2BMR B;  2YFL B;  4R9K A;  2HMK B;  4KFD A;  3JUP A;  3M8C A;  2D42 A;  1TP6 A;  3DXO A;  3FSD A;  3CCM 3;  1DMQ A;  3G4S 3;  3KN4 A;  2Y73 A;  3FH1 A;  1VQN 3;  4JF8 A;  1UUW B;  1ULJ B;  4MMY B;  1KD1 4;  3AMO A;  4XBT A;  3UJM A;  1FGO A;  5D81 A;  1DMM A;  3F9S A;  4FMD A;  1W2B 2;  3B7C A;  3F14 A;  3WMD A;  1N5H A;  2C11 A;  3GZY B;  1JV2 B;  2QGU A;  2OTJ 3;  2P05 A;  2OOV C;  1N9J A;  5IG4 A;  3F7X A;  1G96 A;  3IPT A;  3KFQ C;  3SOA A;  1YI2 3;  2UX0 A;  1YJN 3;  1RJO A;  2FXT A;  5JPP A;  1L5G B;  3FZW A;  2GU1 A;  1PU4 A;  1NB5 I;  1OHP A;  2XFT A;  3FG4 A;  5AYR B;  1VZZ A;  4MEI A;  2R4I A;  3ALA A;  3MG3 A;  1OHO A;  2OOV A;  1D6Y A;  4HYZ A;  3CNM A;  1VQO 3;  3A76 A;  1TUH A;  1YIT 3;  2HML B;  3I0Y A;  1LXE A;  1A2K A;  1DYU A;  3JUN A;  3CD6 3;  3KZT A;  4GL6 A;  5AII A;  1W01 A;  1E3R A;  1JB2 A;  1AV4 A;  4KFE A;  3EF8 A;  3NM7 A;  4I4K A;  1RKY A;  3V99 A;  1O7M B;  4XM4 A;  4K1V A;  3CC7 3;  1STF I;  1IV9 A;  4N6N B;  5IEN A;  2K54 A;  4STD A;  3CPO A;  4O02 B;  4X2H A;  1UI7 A;  1JB5 A;  3G16 A;  3WA2 X;  5JPU A;  1K9M 4;  1RRL A;  1JNQ A;  4H3U A;  2YFJ B;  4G1M B;  1TFO A;  3LXU X;  3MYT A;  3OV4 A;  3BND A;  1ZO2 A;  1YJW 3;  2GEY A;  3K5T A;  1Q86 4;  1KC8 4;  2P38 A;  5A0O B;  1QVF 2;  2IUK A;  1GD4 A;  2ZDJ A;  3L0R A;  7STD A;  3LZA A;  5FW5 A;  3FLJ A;  2IUJ A;  4WYK A;  1IQY A;  4R80 A;  2Z77 A;  2GBX B;  3B8L A;  4OUQ A;  1K28 A;  4TX4 A;  1Q82 4;  1N8Q A;  3PCR A;  1IQ8 A;  4RZM A;  3BB9 A;  3NQZ A;  1YVB I;  2XR8 B;  2STD A;  1W4N A;  3KSP A;  2ML5 A;  5AI1 A;  2W56 B;  4LMI A;  1LOX A;  2ML6 A;  1MOL A;  1D6Z A;  1GD3 A;  4HZ9 B;  1JKG B;  3HII A;  2Z76 A;  3STD A;  4O8S A;  3EN1 B;  3DGN A;  1GY6 A;  2W04 A;  3PYJ A;  4RNZ A;  3J7Y d;  3T8U A;  3FG3 A;  2MF7 A;  2JDI H;  3CCU 3;  1YGE A;  4K61 A;  5CK6 A;  1W6C A;  5G2G A;  4CCV A;  2P09 A;  1K73 4;  4U13 A;  2CG0 A;  1K8A 4;  3CCL 3;  2K0M A;  2Z6B A;  1Q40 B;  3T0U A;  1WMO A;  3CME 3;  2I9W A;  2BMQ B;  3IJE B;  3DY5 A;  3K9M C;  4QWT A;  2CH9 A;  2W9Q A;  3D3L A;  3G0K A;  2XEP A;  1JN5 A;  3DGO A;  1FUW A;  1RRH A;  1E97 A;  4HJL B;  3KII A;  1LNH A;  1O7H B;  3PGB A;  3CC4 3;  4IT7 A;  3K0Z A;  4R9L A;  4NHF A;  2XGN A;  4FMA A;  1IK3 A;  2F98 A;  5EQL A;  2XGL A;  3Q90 A;  2QEX 3;  4GB5 A;  5IEP A;  4FCJ A;  1O7W B;  2CG1 A;  1SQW A;  1K41 A;  1YHQ 3;  1QAL A;  3H51 A;  3HI7 A;  1SJW A;  1JRQ A;  2O9U X;  4AKY A;  1AVL A;  3SVA A;  4HM2 B;  3B4P A;  1IVV A;  2P0M A;  3CCE 3;  2IA7 A;  1W02 A;  1PFP A;  3BNB A;  3S5C A;  5BXQ A;  1VQK 3;  1QJG A;  1IDP A;  3DGM A;  2SBL A;  3OWY A;  1VQ9 3;  3NUV A;  1FGT A;  2CFK A;  4EXR A;  1A90 A;  3HIG A;  1YJ9 3;  3AMO B;  4HZB B;  2CFD A;  3LOY A;  3NV0 A;  1SPU A;  4Q53 A;  2WGO A;  3UL6 A;  1YIJ 3;  2Q07 A;  2M7O A;  3BNE A;  3EB8 A;  5IW9 A;  4L7K A;  1EA2 A;  3F8H A;  3WDG B;  4PEJ A;  2KXG A;  5CXO A;  2CFW A;  4O2H A;  1EG9 B;  1OF5 A;  2E2U A;  3FF2 A;  4RBN A;  3WOD G;  4XBX A;  3MPH A;  4K1U A;  2HMJ B;  4HM4 B;  3ROB A;  2WOH A;  1D6U A;  5BVB A;  1O7N B;  3O8Y A;  1A67 A;  5CF2 A;  1VQ7 3;  3SX1 A;  3CCJ 3;  3IMA B;  2CIU A;  5AEW B;  3G6E 3;  1Z1S A;  1WMN A;  3GWR A;  3S29 A;  1ULI B;  3BNC A;  2ZL8 A;  1NJI 4;  1WTH A;  3BLZ A;  1LVN A;  8CHO A;  3JVC A;  2KRT A;  3EN8 A;  2XSH B;  5LC6 A;  1S72 3;  3FKA A;  3MWZ A;  1HKX A;  4HVN A;  1Q81 4;  2INX A;  5CF1 A;  2A15 A;  3CPW 2;  1V74 A;  3DM8 A;  1IVU A;  4WFO A;  3FG1 A;  1E3V A;  1NB3 I;  2HMM B;  3K7C A;  4IPB A;  1VQ5 3;  2OTL 3;  3FCS B;  1IT8 A;  3MKI A;  1OGZ A;  1ROA A;  3DGL A;  1M1K 4;  1KSI A;  1OUN A;  3K63 A;  3X3X A;  3SXX A;  4FR9 A;  1N9E A;  4OK0 A;  1IVW A;  3EQQ B;  4J8T A;  5EVH A;  1M90 4;  5IG0 A;  2RSX A;  1NO3 A;  1CYV A;  1U8C B;  3CNX A;  4XDV A;  3UL5 A;  3NBJ A;  3DMC A;  2OCT A;  1WMP A;  1UUV B;  1DVD A;  1CEW I;  1ISK A;  1VQ4 3;  3CU3 A;  4HM0 B;  4N6O B;  1GYB A;  2BT3 A;  2QIY A;  3EX9 A;  4WYK B;  3X3Y A;  3SOY A;  2C10 A;  1OGX A;  2CFL A;  2OWP A;  5AEU B;  1OAC A;  4XB5 A;  4ZM8 A;  4HM6 B;  1W5Z A;  3PCS A;  1O7G B;  3JUM A;  4HM3 B;  4N6U A;  3SLU A;  1Q42 A;  3CCQ 3;  3GZB A;  3LTB A;  4LSO A;  2CFG A;  3CCR 3;  1Q7Y 4;  4EV5 A;  3I56 3;  1FGQ A;  4N6V 0;  2CWU A;  5AIH A;  1OPY A;  1TFK A;  3NQY A;  4J9A A;  3ECF A;  1AVK A;  1FGR A;  3F7S A;  3RDE A;  4RNY A;  5HGR A;  5CLK A;  4N6T A;  3S67 A;  3KKG A;  4NRE A;  3GZX B;  3DZL A;  4R1K A;  2PNC A;  4IIA A;  3X42 A;  3U97 A;  1KQS 2;  4K90 B;  4LEH A;  5IEO A;  5D82 A;  5AIG A;  2OQE A;  1N8R 4;  3EJV A;  3NBB A;  1T5Y A;  2W9P A;  3G8Z A;  3X3Z A;  5D83 A;  2YX9 A;  1JN5 B;  1NDO B;  1TIJ A;  3D9R A;  2XSO B;  3VF1 A;  4FMC A;  3B4O A;  1FGM A;  3NXJ A;  2CHC A;  2CW9 A;  5ELJ A;  1CQS A;  4R4K A;  4N3V A;  2V1L A;  1VQ8 3;  1W6Y A;  2QA4 3;  2Y74 A;  4CDL A;  3PXM A;  4HM1 B;  4HM8 B;  3OWS A;  4HKV B;  1W7C A;  1RN7 A;  2RCD A;  3UB1 A;  5KP1 A;  3OW2 2;  2D1W A;  3LML A;  2MC8 A;  2HMO B;  1VQL 3;  3KSE D;  5IG5 A;  1GS3 A;  4XBY A;  4FCZ A;  3I55 3;  1U5O A;  3MG1 A;  3N9H A;  5IER A;  4HM5 B;  1QAK A;  1US1 A;  2BNG A;  2CWT A;  2RGQ A;  1AR0 A;  5EEO A;  1UI8 A;  3UNL A;  3TDG A;  4O3V A;  4HBR A;  3DUK A;  1S5A A;  2LQV A;  4L8P A;  1VQP 3;  1DMN A;  3X41 A;  2BMO B;  3EC9 A;  1W2Z A;  3NV0 B;  3OX9 A;  4WP5 A;  1WNH A;  2F86 B;  1M9G A;  1C7H A;  3FGY A;  3LYG A;  2XH9 A;  5KP3 A;  1TU5 A;  4XDW A;  2YFI B;  1OF5 B;  1KWI A;  2LYX A;  2O3O A;  2XRX B;  3F8X A;  4KZ1 A;  1EQK A;  2B24 B;  2E2T A;  4EV2 A;  1JB4 A;  1IV7 A;  2FNQ A;  1FA3 A;  1O7P B;  4AKZ A;  1UW1 A;  2HMN B;  3MG2 A;  2Z7A A;  1IU7 A;  3HK4 A;  2XFS A;  4N6L A;  4X2O A;  2F99 A;  2CWV A;  5DRV A;  2JQ5 A;  5KP4 A;  1N5P A;  2XF3 A;  5DRE A;  1BUQ A;  3PS8 A;  1J2B A;  2KCD A;  3CXC 2;  1QMA A;  3RGR A;  1GY5 A;  1DVC A;  2WO0 A;  3EBY A;  3S28 A;  4EBG A;  3HZP A;  4LZI A;  3MSO A;  2CC3 A;  3EE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...