1E9MA

Ferredoxin vi from rhodobacter capsulatus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
AKIIFIEHNGTRHEVEAKPGLTVMEAARDNGVPGIDADCGGACACSTCHAYVDPAWVDKLPKALPTETDMIDFAYEPNPATSRLTCQIKVTSLLDGLVVHLPEKQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN VI
publication title Crystallization and Preliminary X-Ray Diffraction Analysis of a [2Fe-2S] Ferredoxin (Fdvi) from Rhodobacter Capsulatus
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Iron-sulfur protein
total genus 30
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2000-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1e9mA00
2CU3A 2MJ3A 3AEBB 1L5PA 2M56B 3W5UB 2EKIA 1KFYB 1V8CA 4IDIA 4C7YA 1YJIA 2KMMA 3ABVB 2MJDA 4WQMA 1FFUA 4N58A 1QOBA 1PDXA 3AB5A 1GPXA 2WP9B 1E10A 1FO4A 2H88B 2WQYB 4N6EB 1E9MA 1NYQA 2W3SA 1VDVA 1RYJA 4US8A 4HROA 1XLOA 1SB3C 1DOIA 3SFEB 1XLPA 4YSYB 3WCQA 3ZYYX 3B2GA 5G5HA 3B9JA 4C80A 2WDVB 1FXAA 3NVZA 2QIEB 2DBYA 2BT6A 3AV8A 2WDQB 3P63A 3VR8B 4YTNB 1N5WA 3LB8C 5H8YE 2MJEA 1WXQA 1TKYA 1WGKA 3L4PA 3P4SB 3AE6B 5H92C 3HVZA 2W55A 1PUTA 5EE1A 2K5PA 1CJEA 1WRIA 2PVGC 1E7PB 3AE8B 1JALA 2B76B 1B9RA 3AECB 1JQ4A 2WS3B 4ZHOA 1VLBA 3AE9B 1J7BA 3HUIA 1J7AA 5EE3A 1JRPA 4US9A 3FAHA 2JX5A 3P4QB 5GXGB 1DOXA 1EWYC 3EUB2 5MPOA 1FRDA 2KAJA 2BS4B 1L0VB 1IUEA 1WYGA 2PIAA 2PVOD 4JX1C 4P6VF 3SFDB 3W9CB 4ZHPA 1YQ3B 1V97A 2K22A 4YTPB 2WU5B 3NVYA 1NENB 3AE7B 1N62A 3AE4B 4HRSA 1RWSA 1WWTA 5G5GA 4ITKA 1N61A 2G1EA 1FRRA 4JWUC 1OQQA 2PKOA 1ZP0B 1FIQA 1OQRA 1SIJA 2BS3B 3FC4A 1YQ4B 4FXCA 4YXDB 3NVVA 1FFVA 1VJKA 3AH7A 5C3JB 1DOYA 1A70A 4YT0B 1AWDA 2FBWB 2H89B 3VRAB 2BS2B 1GAQB 1NI3A 3RPFC 4YSXB 1RM6C 2AX5A 2M19A 2CJNA 2N0SB 4USAA 1AYFA 4C7ZA 1TJEA 1J7CA 4A9AA 2WU2B 1JWAD 1XO3A 2WDRB 2HTME 1ZOYB 1L6VA 3CWIA 3HRDD 1CZPA 1JROA 1QOFA 3KWLA 1KF6B 1XLNA 1I7HA 1XLQA 5EE9A 1FXIA 4N59A 4YSZB 5AUIA 2L83A 2L52A 1E0ZA 3NVWA 3AE3B 2K9XA 3P1MA 3PO0A 1PFDA 3AE5B 1UWMA 3P4PB 2DWQA 4YTMB 1SF0A 3AEAB 3AEEB 3W5VB 3DWMA 1NVID 1ZXIA 5EE0A 3AEGB 3BIID 1R7SA 3DWGC 1F0ZA 1L6UA 2LEKA 1FM0D 1NEKB 1DGJA 1TKEA 2MH7A 3AE2B 1QOGA 2ACZB 1YJJA 3AE1B 1ROEA 2CJOA 2OHFA 1FMAD 3AM9A 4ZOHC 1TYGB 4KX6B 3AEFB 2QJLA 1NYRA 1N63A 4LTUA 5AUKA 3AN1A 1N60A 2W3RA 1QLBB 3LXFA 1JWBD 3CIRB 5C2TB 1ZUD2 3SR6A 3VRBB 2Y5CA 1RFKA 1TKGA 1N5XA 1E6EB 2E3TA 2W54A 3B2FA 3NS1A 3VR9B 1QF6A 1QOAA 3AEDB 3AMZA 1KRHA 2Q5WD 3ETRA 4JWSC 2WLBA 1OFFA 4WWMA 3NRZA 1T3QA 3P4RB 2JQRB 1JW9D 1QT9A
chains in the Genus database with same CATH superfamily
2KTRA 1C3TA 3RNAC 1I4QA 4W9LA 2N7EA 3HM6X 2A5UA 1YNTE 1YD8U 3U2SC 1WX8A 2OOBB 3UINB 1E9MA 2W3SA 4US8A 2PJHA 1L2NA 1V80A 3PZ7A 4LNFA 3TEYA 3P2BA 4YTNB 3RCZA 4TMAB 1LGRA 1I4PA 2K5PA 4LJOB 4HPMB 3TBLD 2L32A 3EECA 4ACFA 2KJ6A 2D3AA 1H8CA 1J8CA 2PMVA 5C23A 4HRSA 4DXGA 4C00A 4ITKA 1WIAA 3VTVA 2D3GA 2IZVB 3LJ3A 3MJ5A 2KMCA 1FFVA 3AH7A 1Q0WB 4TSSA 2BS2B 1UWXA 3Q8CA 5T8IA 1M4VA 2N0SB 1GG3A 5JH5C 4CYEA 2J53A 1FNVA 1Q10A 4N9F4 4AJYB 3ZNGC 1TGZB 2DYBA 4DQOC 3VVWB 4HCPB 3PO0A 3AEEB 3Q8BA 1HQRD 4PS3A 1ZE3D 1WFYA 2ACZB 2JY6A 2KTRB 4WIPA 2BPSA 2KMAA 1JWBD 2LHDA 1P0RA 3BINA 1OFFA 2BYTA 4KSLC 2KDMA 3T3OA 2XN9C 1V5TA 4FA6A 4HXDA 1PDXA 2WP9B 5LLIA 1XLPA 2VZKD 3B9JA 3NVZA 4NQLB 4OW0A 1MJDA 3UGBB 2LXAA 4HCNB 4GSWA 3X23A 1EO6A 1QQRA 3HVZA 3E56A 2LVPA 2KFKA 2ZZPB 1E7PB 3BWUD 2D3BA 4GXBA 2LZ6A 3EUB2 5MPOA 2KAJA 2JYTA 3MC0B 4TKNA 1J0GA 2KACA 3PTFC 4M01A 4AQ7A 2K8CA 2G9HD 4HK2A 4ICVA 1LQBA 3NUHB 1F9JA 2N7DA 5JHBA 4IM2A 1OQRA 2VH1A 1C4AA 3ZO5B 2ON8A 3MC9A 4P7IA 1K53A 4GGQA 2FNJB 1WRDB 4MGYE 4USAA 1YN5A 3FILA 1XXGA 5CTRC 3W1SA 1ZOYB 3ZJUA 3RNFC 1BT0A 1J19A 3I9V1 3RD2A 3TIXA 2K9XA 3B1LX 5FR3A 3AI5A 2Z59B 1ZDXA 1H4RA 3H8HA 1CMXB 4BVUC 4JL9A 4C56C 3R7QA 5I4DA 1TKEA 4ZRQA 4A55A 4FULA 1UGMA 2KDEB 4LTUA 3AN1A 2J0MA 4W9DA 3TL5A 3VRBB 3UIOB 3VR9B 5GMVA 1HZ6A 3PVLA 3TCAA 5E6OA 4ZRPA 3ETRA 2KLCA 3ZDMC 4OZAA 4R3DA 4W9FA 2M56B 2KVZA 3IAM1 3SDLC 1TS3A 1HXYD 2K39A 1WJNA 1FFUA 4N58A 1Y8RC 1FO4A 4M8NA 2L0TA 1ET9A 3DPDA 4N6EB 1PGBA 2KFKB 5L83A 1GUAB 1DOIA 1V2YA 2RDHA 3KUCB 3O13A 3ZNID 2WDVB 1WX7A 2V3NA 2JF5A 5G55A 3TMPB 3P4SB 1WI0A 3MC8A 2M0AA 3ZW3A 1JALA 1KH0A 2RDGA 1V1PA 1U4AA 4K3BA 5BYSA 3X0WA 1YOVB 1T0SC 2ZCCA 4TUUA 1IUEA 1T0QC 3W1YA 2MQJA 1F52A 1OEYA 2XK5A 3FILB 1JWMD 4DXAB 3OAWA 4NJCA 5CHFA 5HI1A 1VJKA 1YN4A 2W9NA 3DHIC 3GB1A 4L23A 5BYQA 4DXFA 3Q8AA 2QC8A 1E90A 3N1YC 4D2KA 4EZKA 1Y56A 2LI5A 3VTWA 2GBNA 4M00A 2DLBA 2BTEA 3NG0A 4YTMB 3AEAB 3I63C 3VH3B 3W5VB 5EE0A 5JZEB 2JPHA 4IWPA 1V5OA 2KXJA 3IT6B 1NEKB 1R4MI 1YJJA 1HEZE 2FUHB 4G11A 4KX6B 2VRRB 3AEFB 3A33B 1EWCA 3DCGA 1N60A 2RPQA 5C2TB 4KSKC 3LYYA 2BVCA 1QILA 2AQ1B 3DHGC 2CR5A 1KLUD 1XT9B 2Q5WD 2WLBA 4LK0M 2NS5A 3V60A 3HIZA 2JQRB 2ZW1A 2ZVOA 1FCCC 2XBBC 4RGOS 1F2RC 4W9GA 4KKIA 2L76A 1UELA 2H88B 3ALBA 1L4ZB 1YIWA 2N9LA 2MRPA 4WJOA 3VTUA 1JMLA 1DYQA 4YSYB 3ZJVA 1V1PB 1FXAA 2IYDB 2DBYA 2DENB 3ECIA 3DBHI 4RM8A 3LB8C 4A20A 4WJNA 5AZGA 2KNBA 2DZIA 2ZVNA 3AU5A 1WMHA 5HHDG 3ML8A 4IOIE 1X1MA 3O65B 3Q69A 2BYVE 2ZCBA 4J6IA 3ZTCA 3MJWA 1F0ZA 2J52A 4OZCA 2KANA 2KWUB 3Q2AC 2G3QB 5IOIA 4P6VF 1P3QU 3MHSD 3Q6BA 5C1ZA 3CSTA 1RRBA 3I57A 1ET6A 1ZP0B 1E7VA 1DOYA 2H89B 2LASA 3QCAA 1T6BX 4YSXB 1WGDA 2M19A 1S1QB 1UGJA 1K51A 2N7JA 3U4EG 4F8CB 2D07B 1C4PA 1FXTB 1KLVA 1BXTA 2X38A 3DWMA 3H1UA 1G6JA 2KHWB 1R7SA 4L1BA 1UUPA 4I6PA 1SE9A 2WXPA 2WXKA 2M0XA 3ZDTA 4HDOA 4IWOA 2O2VA 2FCMA 3BY4B 2JRIB 5L95C 3NRZA 1GPXA 4M0WA 4AS1A 4BKTA 4WWNA 4EOYA 2SAKA 4IDIA 2HE7A 2MJDA 3M62B 2EKEC 1WGGA 3QWZB 1WMHB 3GE8C 4RMAA 1NYQA 1D5ZC 3A4SC 1YMHE 2IBIB 2K8BA 3SHQA 1SB3C 3MTNB 4KGSA 3ZYYX 3KYDD 4MACA 4XX5A 5D6JB 2D11A 4OVUA 1IYFA 4HJKA 5FR6A 1D5MC 1T5XD 2PPHA 2Y3AA 1PUTA 1WR6E 2KYWA 1VZ6A 3N1ZC 1QKZA 2L05A 4KGRA 3WA0A 3BK2A 3R66C 2CHWA 3KUDB 4P1BC 1L0VB 2KX0A 4RNAA 4GDLA 2GI9A 1TT5B 2RR9A 2WU5B 3VQIA 4MGZE 1A5RA 2G1EA 2BS3B 2LHEA 1A70A 3ZQ4A 1AWDA 3RZFA 4MDKE 1SE3A 3Q3JA 2VH2A 4YSZB 2L83A 5BMGA 1I42A 2KWVB 3V3XA 3R8BA 4AOFA 2O2VB 2QSDA 2LRWA 3ZUNA 3AE1B 4W9IA 4M0WB 2Z0DB 1MG4A 1ZUD2 2ZJDA 1N5XA 3BYYB 3D32A 3E9SA 2D10A 4K7UA 3AMZA 2JUOA 4WWMA 2M8SA 2CU3A 2EKIA 3BVMA 2BWFA 4MT5A 3AB5A 2IGGA 4A8XC 1WE7A 3TJPA 1VDVA 3V6EB 1TZOA 4HROA 4IG7B 1ZW7A 4XE0A 4HVBA 3MHZA 3ONSA 2LFIA 2MJEA 3L4PA 4GDLB 2DZJA 4G0NB 1WX9A 2BYEA 1GB1A 1VRAB 1C77A 1SEBD 2WS3B 3GOEA 1J7AA 2JXTA 2PLPA 3ZXRA 1DOXA 3DBLI 2ZNVB 2IO0B 4YTPB 3UI3A 4DK5A 4PYZA 4NNJB 3PHWB 4W9EA 4FXCA 3I3TB 3DBHB 2IO1B 5CHVC 1C1YB 2WXQA 1JCKB 4H2AA 3RPFC 1WR1A 5JHAA 2MBOA 1WJ6A 2D2QA 1YX5B 2FAZA 4B6WA 3AE3B 3QK0A 3RMKC 3PREA 4NJ7A 5D94A 2FIDA 2KC2A 4XC2A 5IO9A 1FM0D 3GZNI 4HPPA 1ENFA 3AM9A 2KO3A 1WF9A 2W3RA 1QLBB 2J7QB 5IA7A 1PGAA 1V1OA 2LGXA 3S2AA 3JW0X 4I6LB 1WE6A 2REXA 2N4FA 2N9PC 4QAYA 4XWTA 1TBEA 3U52E 4WQMA 3DBSA 2IGDA 4MM3A 3JSVA 4M02A 2KVRA 1KM7A 2I38A 3ZIMA 4GB9A 2BT6A 2MSED 4PT5A 4KZ0A 2QEJC 1N5WA 1WGKA 3AE6B 2UU7A 3PSEB 2M4NA 2WXIA 4GDKA 4BAXA 4B9KA 2OJRA 1MVKA 2K6QA 1TY2A 1WYGA 2INDC 3Q3OC 1D3ZA 1WSPA 3RYTA 1WY8A 1WWTA 1E8XA 2N1VA 3VUWA 1P98A 1JWUD 2MX2A 4AP4C 1D4BA 1IGCA 4K1RB 1SJHD 4IW0A 3Q8FA 4GMVA 1AYFA 4DDGD 3H9DA 2BKFA 2ZEQA 1YQBA 1UBIA 1JROA 2TSSA 1KF6B 1ZGUB 4RH6A 4KDIC 2AQ2B 2QHOA 2VZKB 2FUG1 3TEWA 4A90A 2V4LA 1EF1A 2KDBA 5E6JA 3NY5A 1NVID 2DYMA 4NZLB 3AEGB 4Q2JA 1MPEA 3W1SC 5J2RA 3AE2B 4MGIE 2NMQA 4LDTD 4RGNA 3WAMA 2KDFB 4MM3B 4NY0A 5IN7A 1FD6A 3JSVB 3DBRI 4ANXA 3HVDA 3WAPA 2JSVX 2YEPB 1EUVB 4K7WA 4TQ1A 1BUIC 2V0GA 1YJIA 3DVNV 3TSSA 2KMMA 2WXNA 1SSNA 1Q1OA 2RMMA 1MHHE 2LXCA 2N9XA 2JYEA 1KOTA 4FJVB 2LGYA 2AL6A 3U8ZA 4BBNF 2BWES 4LDTB 4GDKB 2J42A 4AUQC 5TSSA 1ESFA 2GBKA 4RF1A 5BMHA 2QILA 2JT4B 3PLVA 1TIFA 1SXTA 2JWUA 4OHJA 4HWIB 3Q3MC 4EKUA 1K50A 1CJEA 4ZRIA 2L7RA 1HE8A 2HJ1A 3AECB 3V62A 4KKJA 3Q3NC 2NR2A 2MBBB 3FAHA 5GXGB 1GNUA 2LWPA 2L00B 1GB4A 4BBNC 1YQ3B 3GE3C 1ZDVA 1WXVA 3OJ3A 2GBMA 1C79A 1L4DB 1OEYJ 2PKOA 3WIMA 1AN8A 1LO5D 5E6PA 1GAQB 2J4XA 1TS5A 2HTME 1I4XA 1L6VA 1SJED 2GB1A 3CWIA 1T0YA 4WQOB 1WH3A 1XLQA 2JZ3B 2KC1A 3R2TA 2K1FA 5AUIA 3DBLB 2L52A 3ZTDA 3NVWA 2LD9A 2INCC 2NBVB 4A6QA 3ZGZA 1YJ1A 1XCQL 1IGDA 1V86A 4DHZE 1I4HA 2PE6B 1N63A 1WXSA 1GC7A 3Q3FA 2MBHA 5AZFA 3B08A 1V49A 1QF6A 1QOAA 3M63B 2LGIA 1LXDA 2JVCA 3ABVB 1Z5SB 2WGSA 2AEHA 3WALA 1XQQA 2KKCA 3APFA 2BB5A 3GZNB 3AULA 1NI2A 2CHXA 2K25A 1HA5A 3PGEA 2PVGC 1WGYA 2FE8A 3N3KB 4WURA 2EELA 3PS6A 4GOCA 3B0AA 3P4QB 1FPYA 3APDA 2I1KA 2IY0B 4EFOA 4DBGA 1N62A 3EFUA 4WH4A 1WZ0A 4IM3A 2FCQA 2PTLA 1LFDA 4RFBA 1WYWB 2C7NB 1SIJA 3L10B 2XK5B 5AEKB 1C76A 2JXXA 3QAQA 3A9JA 1NBFC 4A9AA 1R4NI 1TZ1A 4IUMB 2NCNA 2NTSA 2LUEA 1QOFA 4TV3A 1V81A 3PPAA 2WWZA 2C9WB 4MSQB 4GU2A 3ZRCA 2YLMA 3IHPC 2B3AA 1K8RB 2BGFA 3BIID 2D3CA 4KZCA 1FMAD 2IO2B 3ZRFA 3ZLZA 5IP4D 4URKA 1JWSD 3EHVA 2Y5CA 1F77A 5E6NA 2BW2A 3P42A 4JWSC 4XDCA 3UF8A 3P4RB 1WM2A 3PHXB 3AEBB 5D7GA 1D6EC 4RCOA 3VFKA 1QOBA 4FHJA 5LXHA 3N20C 1JRUA 1IBXA 3KLSX 2ONQA 2KLGA 1QZEA 2V3SA 4IWQA 2WDTB 3RNBC 2WDQB 3DDCB 1UH6A 4W9HA 1KTKA 2QDFA 2AL3A 4O1NA 1SBBB 4LCDE 2W55A 4F7ZA 3IAS1 1AARA 3DBRB 3C19A 5DPTA 3RZWC 4ZHOA 2EMSA 1J7BA 5EE3A 1GJZA 4WWOA 1L0XB 2NVUI 3IXSA 3DVGY 2FIFA 3KQ4A 4JX1C 3W9CB 3QIJA 2KQ7A 3J9CA 1B1ZA 4S0RA 3A9JB 1HZ5A 3OJ4B 1FRRA 3QQ8B 3V6CB 4ARCA 2LMCA 2JWZA 4WJQA 4KDLB 2NTTA 5J17A 3VXWA 2WXMA 1WXMA 3APCA 2O6VD 2WXOA 4ZRJA 2M17A 1VZ8A 4HPLB 1VCBA 3EFCA 2ZNVC 1IPGA 3SEBA 1E0ZA 1GC6A 1TTNA 2WX0A 1PFDA 3KH0A 4MELA 4OVVA 4A3PA 2X8XX 2INNE 2MWSB 3FKYA 2M1MA 1DGJA 4BKSD 4PYUA 2L0FA 1ROEA 2OHFA 4PK1A 2MA9B 2WXJA 4FHKA 2E3TA 2KWDA 5IAAC 2Y5BB 1IBXB 4PS8A 4C7YA 3N9YC 4ASWC 4OZBA 2MW5A 1EM7A 2PEAA 3CSFA 1XLOA 3UQAA 1P7EA 1CK1A 3WCQA 3DVGX 5G5HA 3NJTA 1V9JA 2V4IB 2KFJA 2WXRA 3GS2A 4AJWA 2IDYA 2MHJA 4ZYSA 3L08A 3AE8B 4MH8A 3RI7C 3KWVA 1JQ4A 3H7PA 5EDSA 4A3OA 5BMIA 3L54A 3SFDB 1R4MB 1WXAA 4HJGE 5D3IB 3VDZA 2YVCA 1RWSA 3BYTB 3HK0A 4F1SA 1ACCA 2BYFA 4DHJD 1F1HA 3NOBA 4ANWA 4G3XB 4E74A 2CS4A 1NI3A 2SEBD 4C7ZA 1JWAD 5KHOA 1CZPA 3H7SA 1KJTA 1XLNA 3VHTC 3UQBA 2N9KA 1SIFA 3WAOA 3PLUA 3P1MA 1OTRB 1ZXIA 3EA6A 3WANA 4DHJB 1GOZA 2KZRA 2KQSA 2RSUA 1QOGA 2HD5B 4ZOHC 4FJYA 4LNOA 3RNGC 1NYRA 2LGDA 3C0RB 4XYCA 3L17A 1R4NB 3RULA 2KJRA 2UYZB 1QT9A 2MJ3A 4WAFA 1OGWA 2JRHA 2N9EB 5HG2A 2K6DB 4II3B 2DAFA 3VH4B 1E10A 3OG5A 2YEPF 3GP7A 2IO3B 4FADA 4EUTA 3NZUA 3KVFB 3H7PB 3VUXA 3R2IA 2LJ5A 2MCNB 3NZSA 2L1AA 4W9CA 1TKYA 4LLGM 3A4RA 2W82A 2MLBA 2RGFA 1WRIA 4K81A 2R61A 3PZDA 3DOWA 5G2NA 3AE9B 5HFYA 4US9A 3NZ3A 3Q14C 1XF5L 5DPSA 4ZHPA 4YL8A 1SGHA 3NVYA 1NENB 2GBJA 1TS2A 1UF0A 4JWUC 1ZKHA 3AXCA 4KIKA 3FC4A 3NVVA 2LRUA 3T3NA 1FNUA 3U7DA 1MI0A 3ZNHB 4TQ0A 3H6NA 4I6NB 2BF8B 4BFRA 4PS7A 2IGHA 4P16A 3KW5B 3QC8B 4NPNA 4XWWA 3P4PB 1SF0A 2G4SA 4B95A 2KN4A 2BBCA 1E5WA 3DWGC 2KQ4X 1E8YA 4CO7A 1TS4A 4AWJA 3RT3B 2DZKA 2OJWA 3C8YA 3EGRA 3K9PB 1WZ3A 1TYGB 3CMMB 1D5XC 2JZPA 4CHKA 5LNK1 1C78A 1Q5WB 4NJ6A 2W54A 1LM8B 4JE3B 2L3ZA 1SE2A 4RGMA 3R3MA 1ZPSA 1SE4A 3V05A 4DDID 3KUZA 4K7SA 1BMLC 1MFWA 2WHIA 3SFEB 4C80A 2HTHA 4B0MA 4JPSA 3BZDB 1NDDA 4LNNA 3QX1A 1TY0A 5J18A 5FK9C 4GLSC 2R2QA 1EU3A 2B76B 4RGTA 2RD0A 2WXHA 1FEHA 1JRPA 2V1YA 2DNFA 4KIKB 1F2RI 2HJ8A 4BOZB 1L0YB 3U30A 4JIOU 3ZJTA 3AU4A 1M94A 2WXGA 3U7ZA 1EF5A 4II2B 3PRMB 1RM6C 3N1XC 3IFWB 3M95A 4ZDVA 5IKCM 5TR5A 2Z8LA 4N59A 2XEWA 3ZKJC 3OWEB 5DCNA 3AE5B 1UWMA 3PT2B 3PRZA 2NPTA 4GN1A 1ZXHA 4REZA 2K8HA 2LEKA 5DPWA 3PRPB 3N32A 1XD3B 2J0KA 1PYWD 3IBEA 2UWQA 1RFKA 1TKGA 5LXIB 2CU1A 3HM3A 2DX5B 1L5PA 3BVGA 1RFAA 3NS8A 5D3DA 4EEWA 3A9KA 4JQWC 4NAMA 1RYJA 1RAXA 5CX3A 2G4DB 3PZ8A 2GRIA 3B2GA 2C7HA 2WXFA 3TUOA 4OVZA 5CHWA 3Q8EA 3ML9A 4FN2A 1WXQA 4HLEA 4DWFA 2GBRA 1B9RA 2WYQA 3W2DA 4S17A 4ZYNA 1VD2A 4M8MA 3K9OB 4MEMA 4W9JA 4JGHB 2JX5A 3IG3A 5D2MB 2PVOD 1YX6B 4BOSC 4J3OD 3HHMA 2NBUA 2DHZA 4MH0E 4FBJB 3IT4B 2JU6X 3AE7B 3AE4B 1N61A 3JVZX 4WWPA 2ZW0A 2G45B 3R7RA 1OQQA 1XEEA 4MJSA 2DYOA 1YQ4B 2L8JA 2RDBC 4YT0B 3DVNU 3L13A 1WJUA 2NPTB 1TJEA 1XO3A 2WDRB 5AZHA 2BQQA 3VAWA 2GMIC 3V61A 2DAJA 1AW7A 2K3UA 3MFGA 5EE9A 5HKHA 1FXIA 4ANVA 4UDUC 4E71A 3I5JC 2NBWB 4E3CA 1VZ7A 2MP2A 3PV1A 2LVQA 2DWQA 1S3SG 2V9HA 1E8WA 2OEDA 4HEA1 1CQVA 3EC8A 1L6UA 3NHEB 3OLMD 3T9LA 1PQSA 2IY1B 4K3CA 2QJLA 4W9KA 5AUKA 1I4GA 2KX3A 3RUIB 2C60A 2XNAC 3NS1A 4YWGG 3A9KB 3KYCD 4P1CC 4HDQA 4ICUA 3QHTA 2DZMA 2J0JA 1EU4A 2ZPYA 2JZZA 2ZPNA 3W5UB 1KFYB 2C7MB 1VR9A 2KTFA 2MBEA 2KJHB 5BO4B 5KHQA 1STEA 4ANUA 2WQYB 1E8ZA 4KGTA 4GIVA 4XGAB 2LVOA 3QA8A 1K52A 3CF6E 1PGXA 2AWTA 2QIEB 2KK8A 3A1QA 3VR8B 5H8YE 2ASQA 2KWCA 5EE1A 2LGSA 1VLBA 2WX1A 2O6VA 3HUIA 4B0EA 4MJSB 1ISNA 3ENEA 1L7YA 4X57B 2BS4B 1UZXB 3SU8X 1YN3A 3LDZE 1MHXA 2FCNA 4DHZB 1FNWA 5G5GA 2V3PA 5JXVA 1P9DU 2KOXA 3BK1A 4IM0A 4KV2A 4BKSA 1C9FA 1FIQA 2WNMA 2R2OA 1I4RA 2BKRB 4MSMB 2MP2B 2FBWB 3VRAB 2E6XA 4C4VA 3DQVA 1XCTL 1V6EA 2CJNA 3TEZA 2ICIA 2GOWA 2KT7A 3ZXVA 3HRDD 1IP9A 4ARIA 4FLHA 4NAWA 4IC7B 3JYUA 2QMTA 4XZ4A 4LNKA 4LJPB 2MBQA 2LUMA 2CHZA 3RNCC 3RFZB 4BZAA 2MH7A 1WJ4A 2KD0A 3VUYA 3LXFA 2KN5A 4JLCA 2EMTA 5BYRA 3RNEC 3SR6A 1I35A 3L0WB 1E6EB 3B2FA 1HTOA 1MG8A 1E7UA 1WGHA 4MGKE 1JW9D 1HTQA 1V8CA 2K0PA 4BKGA 1T0RC 1WGRA 3A1QB 5FKAC 3SD5A 4WAAA 3URYA 2HDEA 1OQYA 4HKQA 1KLGD 4LNIA 2IJ0A 2QCZA 2D5GA 1P1AA 2INPE 2Y5PA 3UIPB 2O6VB 3AV8A 4CQNA 3P63A 2PW9A 3QARA 5H92C 1UBQA 1C4CA 4L2YA 2AQ3B 4RF0A 2AYOB 2Z0EB 3TEXA 1EWYC 1FRDA 2LJIA 2PIAA 4KVGB 1V97A 2K22A 4C4VB 3M3JA 3DHHC 2I1JA 4FJZA 4HKZE 3L16A 4NAWB 2KDIA 3ZNZB 1UD7A 4YXDB 4ZRKA 5C3JB 1Z2MA 2AX5A 4EZLA 1FCLA 5DPRA 1J7CA 2GLSA 2WU2B 3IVFA 2IPKD 3T8MA 4IKGA 4EE2A 3KWLA 1I7HA 1UNSA 2MEKA 2WXLA 2BB6A 4G50A 3ZVVA 4EZJA 2PE9A 3RN9C 1RLFA 1N6ZA 2RPVA 2CKHB 2N1WA 4RM9A 3BVZA 3QJZA 2CJOA 2C5LC 1P7FA 2A4ZA 3MP9A 1WM3A 3CIRB 2I2YA 4XDDA 3AEDB 4WJPA 1KRHA 3N30A 4NQKE 2FCSA 1T3QA
chains in the Genus database with same CATH topology
2LGIA 2SAKA 4IDIA 1I4QA 1ZPSA 1YNTE 3ABVB 2MJDA 1SE4A 3V05A 3U2SC 1BMLC 1E9MA 1NYQA 1D5ZC 2BB5A 2W3SA 1YMHE 4US8A 1SB3C 3SFEB 4KGSA 3ZYYX 4C80A 3PZ7A 4MACA 4B0MA 3TEYA 4JPSA 3BZDB 4YTNB 1TY0A 1D5MC 1HA5A 1T5XD 2Y3AA 4TMAB 1PUTA 1I4PA 2K5PA 1VZ6A 2PVGC 4GLSC 5FK9C 1EU3A 2B76B 1QKZA 4RGTA 2FE8A 4KGRA 4WURA 2EELA 2L32A 2WXHA 3BK2A 1FEHA 1JRPA 3P4QB 1F2RI 1L0VB 4RNAA 2GI9A 1L0YB 2WU5B 2PMVA 1N62A 3VQIA 4HRSA 4WH4A 3ZJTA 4DXGA 2PTLA 4ITKA 2G1EA 4RFBA 3MJ5A 2WXGA 3U7ZA 2BS3B 1SIJA 1FFVA 3AH7A 1C76A 2LHEA 1A70A 3ZQ4A 1AWDA 4TSSA 2BS2B 1UWXA 3Q8CA 5T8IA 1M4VA 1RM6C 2N0SB 1SE3A 4A9AA 2J53A 2NTSA 1FNVA 1Q10A 1QOFA 2Z8LA 4N59A 4DQOC 4YSZB 2L83A 5BMGA 3OWEB 3PO0A 3AE5B 1UWMA 3V3XA 3R8BA 3AEEB 3Q8BA 1HQRD 1ZXHA 4REZA 3BIID 1ZE3D 2QSDA 2LEKA 2ACZB 3AE1B 1FMAD 4WIPA 1PYWD 1JWSD 1JWBD 1ZUD2 2Y5CA 1RFKA 1TKGA 1N5XA 1F77A 3BYYB 2BW2A 3E9SA 2LHDA 3AMZA 3P42A 4JWSC 4XDCA 1OFFA 4WWMA 2BYTA 3P4RB 2KDMA 3T3OA 2CU3A 3AEBB 5D7GA 1L5PA 2EKIA 2XN9C 1D6EC 3BVMA 3BVGA 4MT5A 4RCOA 1QOBA 1PDXA 3AB5A 1GPXA 2IGGA 5D3DA 2WP9B 4A8XC 4NAMA 1VDVA 1RYJA 1TZOA 4HROA 1IBXA 3KLSX 1XLPA 2ONQA 3PZ8A 2GRIA 3B2GA 2VZKD 2WXFA 3B9JA 3NVZA 4XE0A 4OW0A 3TUOA 4OVZA 2WDQB 3MHZA 3Q8EA 1KTKA 2LFIA 1WXQA 2MJEA 3L4PA 1SBBB 4O1NA 4GDLB 1QQRA 3HVZA 2W55A 3E56A 3IAS1 1B9RA 1E7PB 3BWUD 3W2DA 1GB1A 1VRAB 1C77A 1SEBD 2WS3B 4ZHOA 1J7BA 1J7AA 2JXTA 2PLPA 5EE3A 2JX5A 1L0XB 1DOXA 3EUB2 5MPOA 2KAJA 3IXSA 2JYTA 3MC0B 2PVOD 3KQ4A 4JX1C 4J3OD 3W9CB 2KACA 4AQ7A 4YTPB 3J9CA 1B1ZA 2G9HD 3UI3A 3IT4B 2JU6X 3AE7B 3AE4B 3NUHB 1HZ5A 1N61A 1FRRA 2ZW0A 1OQQA 1XEEA 2DYOA 1OQRA 1YQ4B 4FXCA 4ARCA 1C4AA 2LMCA 2ON8A 1K53A 4YT0B 2WXQA 1JCKB 4H2AA 3RPFC 2NTTA 4USAA 1TJEA 1XO3A 1YN5A 2WDRB 1XXGA 2WXMA 3FILA 3W1SA 1ZOYB 3ZJUA 1AW7A 2K3UA 2WXOA 3MFGA 5EE9A 1VZ8A 1FXIA 4UDUC 3I9V1 1E0ZA 3SEBA 3AE3B 2K9XA 1VZ7A 1PFDA 2DWQA 5FR3A 1ZDXA 3H8HA 2INNE 2OEDA 4HEA1 1CQVA 4C56C 1L6UA 1FM0D 5I4DA 1DGJA 1TKEA 4ZRQA 4A55A 1ROEA 2OHFA 1ENFA 3AM9A 2QJLA 4LTUA 5AUKA 1I4GA 3AN1A 2W3RA 1QLBB 1PGAA 2XNAC 2WXJA 3VRBB 1V1OA 3NS1A 4YWGG 2E3TA 3VR9B 1HZ6A 2KWDA 4ZRPA 3ETRA 1IBXB 1EU4A 4XWTA 4OZAA 4R3DA 3W5UB 2M56B 3IAM1 1KFYB 4C7YA 1TS3A 1VR9A 3U52E 3N9YC 1HXYD 4OZBA 4WQMA 1FFUA 4N58A 2IGDA 1FO4A 1STEA 1ET9A 2WQYB 4N6EB 1PGBA 4KGTA 1EM7A 1XLOA 1DOIA 1P7EA 2I38A 2RDHA 3O13A 1CK1A 1K52A 3WCQA 5G5HA 1PGXA 2WDVB 2QIEB 2V3NA 2BT6A 4PT5A 2V4IB 3VR8B 2WXRA 2QEJC 1N5WA 5H8YE 3P4SB 1WGKA 3GS2A 2IDYA 3AE6B 2M0AA 4ZYSA 5EE1A 3AE8B 1JALA 1KH0A 2WXIA 2RDGA 4MH8A 3KWVA 1JQ4A 1VLBA 1MVKA 1V1PA 5BYSA 3HUIA 4B0EA 1TY2A 2BS4B 1IUEA 1WYGA 5BMIA 3SFDB 1WSPA 4HJGE 1YN3A 5D3IB 1MHXA 1RWSA 1JWMD 3BYTB 1FNWA 1WWTA 3FILB 2V3PA 5G5GA 5JXVA 1JWUD 4NJCA 5HI1A 1ACCA 3BK1A 1C9FA 1D4BA 1FIQA 2WNMA 1IGCA 1I4RA 1SJHD 1VJKA 1YN4A 3GB1A 4L23A 4DXFA 2FBWB 5BYQA 3VRAB 2E6XA 3Q8AA 1NI3A 1XCTL 2SEBD 2CJNA 3Q8FA 4C7ZA 1AYFA 3TEZA 2ICIA 1JWAD 4D2KA 3HRDD 1CZPA 1JROA 2TSSA 4ARIA 1KF6B 1XLNA 1Y56A 2N9KA 4RH6A 2AQ2B 2VZKB 3P1MA 2DLBA 2FUG1 2QMTA 2BTEA 3TEWA 4YTMB 4A90A 3AEAB 2LUMA 5E6JA 3W5VB 1NVID 1ZXIA 2DYMA 3EA6A 4NZLB 3AEGB 5EE0A 1GOZA 3RFZB 3IT6B 4Q2JA 1MPEA 1NEKB 2MH7A 3AE2B 1QOGA 1YJJA 1HEZE 4ZOHC 4KX6B 2NMQA 3AEFB 1NYRA 1EWCA 1N60A 3LXFA 4RGNA 5BYRA 5C2TB 3SR6A 3LYYA 4MM3B 1QILA 1E6EB 2AQ1B 3B2FA 1FD6A 1KLUD 2Q5WD 3HVDA 2WLBA 4LK0M 2JSVX 2JQRB 1JW9D 1QT9A 2ZW1A 2MJ3A 2YEPB 4WAFA 4TQ1A 1FCCC 1BUIC 1V8CA 2V0GA 2K0PA 1YJIA 3TSSA 2KMMA 4RGOS 2WXNA 5FKAC 1SSNA 2RMMA 1F2RC 5HG2A 1MHHE 4KKIA 1E10A 2H88B 3URYA 2JYEA 2HDEA 2YEPF 1L4ZB 3GP7A 4HKQA 1KLGD 2N9LA 2IJ0A 4GDKB 2D5GA 2J42A 2INPE 1JMLA 1DYQA 4YSYB 3ZJVA 1V1PB 2Y5PA 3R2IA 5TSSA 1FXAA 1ESFA 2DBYA 3AV8A 4RF1A 4CQNA 2L1AA 3P63A 5BMHA 2QILA 2PW9A 3LB8C 1SXTA 2JWUA 1TKYA 4LLGM 4OHJA 1K50A 5H92C 5HHDG 2W82A 1CJEA 1WRIA 1C4CA 2R61A 4IOIE 4L2YA 2AQ3B 3Q69A 3AECB 4KKJA 3AE9B 4RF0A 5HFYA 1F0ZA 4US9A 2J52A 3FAHA 4OZCA 4RGMA 5GXGB 3TEXA 1EWYC 1FRDA 3NZ3A 2LJIA 1XF5L 2PIAA 1GB4A 4P6VF 4ZHPA 1YQ3B 1V97A 2K22A 1ZDVA 3NVYA 1NENB 1TS2A 3I57A 1C79A 4HKZE 4JWUC 1L4DB 4NAWB 1ET6A 2PKOA 1ZP0B 4YXDB 3FC4A 3NVVA 1AN8A 1LO5D 5C3JB 3T3NA 1DOYA 2H89B 1FNUA 1GAQB 2J4XA 1T6BX 2AX5A 2M19A 4YSXB 1MI0A 1FCLA 4TQ0A 1J7CA 1TS5A 2WU2B 2HTME 1UGJA 1I4XA 2IPKD 1L6VA 1SJED 2GB1A 3CWIA 4IKGA 4EE2A 3KWLA 1K51A 1I7HA 1UNSA 1XLQA 2MEKA 2WXLA 2BB6A 3R2TA 5AUIA 2L52A 3NVWA 2N7JA 3U4EG 2IGHA 4P16A 4XWWA 2RPVA 3P4PB 1SF0A 1C4PA 4A6QA 1BXTA 2X38A 3DWMA 2KN4A 3ZGZA 2BBCA 1R7SA 3DWGC 4L1BA 1XCQL 1UUPA 2KQ4X 1TS4A 3BVZA 2WXPA 3C8YA 2CJOA 1IGDA 2WXKA 3EGRA 1TYGB 1I4HA 1D5XC 1P7FA 1N63A 3MP9A 2JZPA 3CIRB 2I2YA 5LNK1 1C78A 2W54A 4XDDA 4JE3B 1QOAA 3AEDB 1QF6A 1KRHA 3NRZA 1T3QA 1SE2A 4M0WA 4AS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CU3 A;  2MJ3 A;  3AEB B;  1L5P A;  2M56 B;  3W5U B;  2EKI A;  1KFY B;  1V8C A;  4IDI A;  4C7Y A;  1YJI A;  2KMM A;  3ABV B;  2MJD A;  4WQM A;  1FFU A;  4N58 A;  1QOB A;  1PDX A;  3AB5 A;  1GPX A;  2WP9 B;  1E10 A;  1FO4 A;  2H88 B;  2WQY B;  4N6E B;  1E9M A;  1NYQ A;  2W3S A;  1VDV A;  1RYJ A;  4US8 A;  4HRO A;  1XLO A;  1SB3 C;  1DOI A;  3SFE B;  1XLP A;  4YSY B;  3WCQ A;  3ZYY X;  3B2G A;  5G5H A;  3B9J A;  4C80 A;  2WDV B;  1FXA A;  3NVZ A;  2QIE B;  2DBY A;  2BT6 A;  3AV8 A;  2WDQ B;  3P63 A;  3VR8 B;  4YTN B;  1N5W A;  3LB8 C;  5H8Y E;  2MJE A;  1WXQ A;  1TKY A;  1WGK A;  3L4P A;  3P4S B;  3AE6 B;  5H92 C;  3HVZ A;  2W55 A;  1PUT A;  5EE1 A;  2K5P A;  1CJE A;  1WRI A;  2PVG C;  1E7P B;  3AE8 B;  1JAL A;  2B76 B;  1B9R A;  3AEC B;  1JQ4 A;  2WS3 B;  4ZHO A;  1VLB A;  3AE9 B;  1J7B A;  3HUI A;  1J7A A;  5EE3 A;  1JRP A;  4US9 A;  3FAH A;  2JX5 A;  3P4Q B;  5GXG B;  1DOX A;  1EWY C;  3EUB 2;  5MPO A;  1FRD A;  2KAJ A;  2BS4 B;  1L0V B;  1IUE A;  1WYG A;  2PIA A;  2PVO D;  4JX1 C;  4P6V F;  3SFD B;  3W9C B;  4ZHP A;  1YQ3 B;  1V97 A;  2K22 A;  4YTP B;  2WU5 B;  3NVY A;  1NEN B;  3AE7 B;  1N62 A;  3AE4 B;  4HRS A;  1RWS A;  1WWT A;  5G5G A;  4ITK A;  1N61 A;  2G1E A;  1FRR A;  4JWU C;  1OQQ A;  2PKO A;  1ZP0 B;  1FIQ A;  1OQR A;  1SIJ A;  2BS3 B;  3FC4 A;  1YQ4 B;  4FXC A;  4YXD B;  3NVV A;  1FFV A;  1VJK A;  3AH7 A;  5C3J B;  1DOY A;  1A70 A;  4YT0 B;  1AWD A;  2FBW B;  2H89 B;  3VRA B;  2BS2 B;  1GAQ B;  1NI3 A;  3RPF C;  4YSX B;  1RM6 C;  2AX5 A;  2M19 A;  2CJN A;  2N0S B;  4USA A;  1AYF A;  4C7Z A;  1TJE A;  1J7C A;  4A9A A;  2WU2 B;  1JWA D;  1XO3 A;  2WDR B;  2HTM E;  1ZOY B;  1L6V A;  3CWI A;  3HRD D;  1CZP A;  1JRO A;  1QOF A;  3KWL A;  1KF6 B;  1XLN A;  1I7H A;  1XLQ A;  5EE9 A;  1FXI A;  4N59 A;  4YSZ B;  5AUI A;  2L83 A;  2L52 A;  1E0Z A;  3NVW A;  3AE3 B;  2K9X A;  3P1M A;  3PO0 A;  1PFD A;  3AE5 B;  1UWM A;  3P4P B;  2DWQ A;  4YTM B;  1SF0 A;  3AEA B;  3AEE B;  3W5V B;  3DWM A;  1NVI D;  1ZXI A;  5EE0 A;  3AEG B;  3BII D;  1R7S A;  3DWG C;  1F0Z A;  1L6U A;  2LEK A;  1FM0 D;  1NEK B;  1DGJ A;  1TKE A;  2MH7 A;  3AE2 B;  1QOG A;  2ACZ B;  1YJJ A;  3AE1 B;  1ROE A;  2CJO A;  2OHF A;  1FMA D;  3AM9 A;  4ZOH C;  1TYG B;  4KX6 B;  3AEF B;  2QJL A;  1NYR A;  1N63 A;  4LTU A;  5AUK A;  3AN1 A;  1N60 A;  2W3R A;  1QLB B;  3LXF A;  1JWB D;  3CIR B;  5C2T B;  1ZUD 2;  3SR6 A;  3VRB B;  2Y5C A;  1RFK A;  1TKG A;  1N5X A;  1E6E B;  2E3T A;  2W54 A;  3B2F A;  3NS1 A;  3VR9 B;  1QF6 A;  1QOA A;  3AED B;  3AMZ A;  1KRH A;  2Q5W D;  3ETR A;  4JWS C;  2WLB A;  1OFF A;  4WWM A;  3NRZ A;  1T3Q A;  3P4R B;  2JQR B;  1JW9 D;  1QT9 A; 
#chains in the Genus database with same CATH topology
 2KTR A;  1C3T A;  3RNA C;  1I4Q A;  4W9L A;  2N7E A;  3HM6 X;  2A5U A;  1YNT E;  1YD8 U;  3U2S C;  1WX8 A;  2OOB B;  3UIN B;  1E9M A;  2W3S A;  4US8 A;  2PJH A;  1L2N A;  1V80 A;  3PZ7 A;  4LNF A;  3TEY A;  3P2B A;  4YTN B;  3RCZ A;  4TMA B;  1LGR A;  1I4P A;  2K5P A;  4LJO B;  4HPM B;  3TBL D;  2L32 A;  3EEC A;  4ACF A;  2KJ6 A;  2D3A A;  1H8C A;  1J8C A;  2PMV A;  5C23 A;  4HRS A;  4DXG A;  4C00 A;  4ITK A;  1WIA A;  3VTV A;  2D3G A;  2IZV B;  3LJ3 A;  3MJ5 A;  2KMC A;  1FFV A;  3AH7 A;  1Q0W B;  4TSS A;  2BS2 B;  1UWX A;  3Q8C A;  5T8I A;  1M4V A;  2N0S B;  1GG3 A;  5JH5 C;  4CYE A;  2J53 A;  1FNV A;  1Q10 A;  4N9F 4;  4AJY B;  3ZNG C;  1TGZ B;  2DYB A;  4DQO C;  3VVW B;  4HCP B;  3PO0 A;  3AEE B;  3Q8B A;  1HQR D;  4PS3 A;  1ZE3 D;  1WFY A;  2ACZ B;  2JY6 A;  2KTR B;  4WIP A;  2BPS A;  2KMA A;  1JWB D;  2LHD A;  1P0R A;  3BIN A;  1OFF A;  2BYT A;  4KSL C;  2KDM A;  3T3O A;  2XN9 C;  1V5T A;  4FA6 A;  4HXD A;  1PDX A;  2WP9 B;  5LLI A;  1XLP A;  2VZK D;  3B9J A;  3NVZ A;  4NQL B;  4OW0 A;  1MJD A;  3UGB B;  2LXA A;  4HCN B;  4GSW A;  3X23 A;  1EO6 A;  1QQR A;  3HVZ A;  3E56 A;  2LVP A;  2KFK A;  2ZZP B;  1E7P B;  3BWU D;  2D3B A;  4GXB A;  2LZ6 A;  3EUB 2;  5MPO A;  2KAJ A;  2JYT A;  3MC0 B;  4TKN A;  1J0G A;  2KAC A;  3PTF C;  4M01 A;  4AQ7 A;  2K8C A;  2G9H D;  4HK2 A;  4ICV A;  1LQB A;  3NUH B;  1F9J A;  2N7D A;  5JHB A;  4IM2 A;  1OQR A;  2VH1 A;  1C4A A;  3ZO5 B;  2ON8 A;  3MC9 A;  4P7I A;  1K53 A;  4GGQ A;  2FNJ B;  1WRD B;  4MGY E;  4USA A;  1YN5 A;  3FIL A;  1XXG A;  5CTR C;  3W1S A;  1ZOY B;  3ZJU A;  3RNF C;  1BT0 A;  1J19 A;  3I9V 1;  3RD2 A;  3TIX A;  2K9X A;  3B1L X;  5FR3 A;  3AI5 A;  2Z59 B;  1ZDX A;  1H4R A;  3H8H A;  1CMX B;  4BVU C;  4JL9 A;  4C56 C;  3R7Q A;  5I4D A;  1TKE A;  4ZRQ A;  4A55 A;  4FUL A;  1UGM A;  2KDE B;  4LTU A;  3AN1 A;  2J0M A;  4W9D A;  3TL5 A;  3VRB B;  3UIO B;  3VR9 B;  5GMV A;  1HZ6 A;  3PVL A;  3TCA A;  5E6O A;  4ZRP A;  3ETR A;  2KLC A;  3ZDM C;  4OZA A;  4R3D A;  4W9F A;  2M56 B;  2KVZ A;  3IAM 1;  3SDL C;  1TS3 A;  1HXY D;  2K39 A;  1WJN A;  1FFU A;  4N58 A;  1Y8R C;  1FO4 A;  4M8N A;  2L0T A;  1ET9 A;  3DPD A;  4N6E B;  1PGB A;  2KFK B;  5L83 A;  1GUA B;  1DOI A;  1V2Y A;  2RDH A;  3KUC B;  3O13 A;  3ZNI D;  2WDV B;  1WX7 A;  2V3N A;  2JF5 A;  5G55 A;  3TMP B;  3P4S B;  1WI0 A;  3MC8 A;  2M0A A;  3ZW3 A;  1JAL A;  1KH0 A;  2RDG A;  1V1P A;  1U4A A;  4K3B A;  5BYS A;  3X0W A;  1YOV B;  1T0S C;  2ZCC A;  4TUU A;  1IUE A;  1T0Q C;  3W1Y A;  2MQJ A;  1F52 A;  1OEY A;  2XK5 A;  3FIL B;  1JWM D;  4DXA B;  3OAW A;  4NJC A;  5CHF A;  5HI1 A;  1VJK A;  1YN4 A;  2W9N A;  3DHI C;  3GB1 A;  4L23 A;  5BYQ A;  4DXF A;  3Q8A A;  2QC8 A;  1E90 A;  3N1Y C;  4D2K A;  4EZK A;  1Y56 A;  2LI5 A;  3VTW A;  2GBN A;  4M00 A;  2DLB A;  2BTE A;  3NG0 A;  4YTM B;  3AEA B;  3I63 C;  3VH3 B;  3W5V B;  5EE0 A;  5JZE B;  2JPH A;  4IWP A;  1V5O A;  2KXJ A;  3IT6 B;  1NEK B;  1R4M I;  1YJJ A;  1HEZ E;  2FUH B;  4G11 A;  4KX6 B;  2VRR B;  3AEF B;  3A33 B;  1EWC A;  3DCG A;  1N60 A;  2RPQ A;  5C2T B;  4KSK C;  3LYY A;  2BVC A;  1QIL A;  2AQ1 B;  3DHG C;  2CR5 A;  1KLU D;  1XT9 B;  2Q5W D;  2WLB A;  4LK0 M;  2NS5 A;  3V60 A;  3HIZ A;  2JQR B;  2ZW1 A;  2ZVO A;  1FCC C;  2XBB C;  4RGO S;  1F2R C;  4W9G A;  4KKI A;  2L76 A;  1UEL A;  2H88 B;  3ALB A;  1L4Z B;  1YIW A;  2N9L A;  2MRP A;  4WJO A;  3VTU A;  1JML A;  1DYQ A;  4YSY B;  3ZJV A;  1V1P B;  1FXA A;  2IYD B;  2DBY A;  2DEN B;  3ECI A;  3DBH I;  4RM8 A;  3LB8 C;  4A20 A;  4WJN A;  5AZG A;  2KNB A;  2DZI A;  2ZVN A;  3AU5 A;  1WMH A;  5HHD G;  3ML8 A;  4IOI E;  1X1M A;  3O65 B;  3Q69 A;  2BYV E;  2ZCB A;  4J6I A;  3ZTC A;  3MJW A;  1F0Z A;  2J52 A;  4OZC A;  2KAN A;  2KWU B;  3Q2A C;  2G3Q B;  5IOI A;  4P6V F;  1P3Q U;  3MHS D;  3Q6B A;  5C1Z A;  3CST A;  1RRB A;  3I57 A;  1ET6 A;  1ZP0 B;  1E7V A;  1DOY A;  2H89 B;  2LAS A;  3QCA A;  1T6B X;  4YSX B;  1WGD A;  2M19 A;  1S1Q B;  1UGJ A;  1K51 A;  2N7J A;  3U4E G;  4F8C B;  2D07 B;  1C4P A;  1FXT B;  1KLV A;  1BXT A;  2X38 A;  3DWM A;  3H1U A;  1G6J A;  2KHW B;  1R7S A;  4L1B A;  1UUP A;  4I6P A;  1SE9 A;  2WXP A;  2WXK A;  2M0X A;  3ZDT A;  4HDO A;  4IWO A;  2O2V A;  2FCM A;  3BY4 B;  2JRI B;  5L95 C;  3NRZ A;  1GPX A;  4M0W A;  4AS1 A;  4BKT A;  4WWN A;  4EOY A;  2SAK A;  4IDI A;  2HE7 A;  2MJD A;  3M62 B;  2EKE C;  1WGG A;  3QWZ B;  1WMH B;  3GE8 C;  4RMA A;  1NYQ A;  1D5Z C;  3A4S C;  1YMH E;  2IBI B;  2K8B A;  3SHQ A;  1SB3 C;  3MTN B;  4KGS A;  3ZYY X;  3KYD D;  4MAC A;  4XX5 A;  5D6J B;  2D11 A;  4OVU A;  1IYF A;  4HJK A;  5FR6 A;  1D5M C;  1T5X D;  2PPH A;  2Y3A A;  1PUT A;  1WR6 E;  2KYW A;  1VZ6 A;  3N1Z C;  1QKZ A;  2L05 A;  4KGR A;  3WA0 A;  3BK2 A;  3R66 C;  2CHW A;  3KUD B;  4P1B C;  1L0V B;  2KX0 A;  4RNA A;  4GDL A;  2GI9 A;  1TT5 B;  2RR9 A;  2WU5 B;  3VQI A;  4MGZ E;  1A5R A;  2G1E A;  2BS3 B;  2LHE A;  1A70 A;  3ZQ4 A;  1AWD A;  3RZF A;  4MDK E;  1SE3 A;  3Q3J A;  2VH2 A;  4YSZ B;  2L83 A;  5BMG A;  1I42 A;  2KWV B;  3V3X A;  3R8B A;  4AOF A;  2O2V B;  2QSD A;  2LRW A;  3ZUN A;  3AE1 B;  4W9I A;  4M0W B;  2Z0D B;  1MG4 A;  1ZUD 2;  2ZJD A;  1N5X A;  3BYY B;  3D32 A;  3E9S A;  2D10 A;  4K7U A;  3AMZ A;  2JUO A;  4WWM A;  2M8S A;  2CU3 A;  2EKI A;  3BVM A;  2BWF A;  4MT5 A;  3AB5 A;  2IGG A;  4A8X C;  1WE7 A;  3TJP A;  1VDV A;  3V6E B;  1TZO A;  4HRO A;  4IG7 B;  1ZW7 A;  4XE0 A;  4HVB A;  3MHZ A;  3ONS A;  2LFI A;  2MJE A;  3L4P A;  4GDL B;  2DZJ A;  4G0N B;  1WX9 A;  2BYE A;  1GB1 A;  1VRA B;  1C77 A;  1SEB D;  2WS3 B;  3GOE A;  1J7A A;  2JXT A;  2PLP A;  3ZXR A;  1DOX A;  3DBL I;  2ZNV B;  2IO0 B;  4YTP B;  3UI3 A;  4DK5 A;  4PYZ A;  4NNJ B;  3PHW B;  4W9E A;  4FXC A;  3I3T B;  3DBH B;  2IO1 B;  5CHV C;  1C1Y B;  2WXQ A;  1JCK B;  4H2A A;  3RPF C;  1WR1 A;  5JHA A;  2MBO A;  1WJ6 A;  2D2Q A;  1YX5 B;  2FAZ A;  4B6W A;  3AE3 B;  3QK0 A;  3RMK C;  3PRE A;  4NJ7 A;  5D94 A;  2FID A;  2KC2 A;  4XC2 A;  5IO9 A;  1FM0 D;  3GZN I;  4HPP A;  1ENF A;  3AM9 A;  2KO3 A;  1WF9 A;  2W3R A;  1QLB B;  2J7Q B;  5IA7 A;  1PGA A;  1V1O A;  2LGX A;  3S2A A;  3JW0 X;  4I6L B;  1WE6 A;  2REX A;  2N4F A;  2N9P C;  4QAY A;  4XWT A;  1TBE A;  3U52 E;  4WQM A;  3DBS A;  2IGD A;  4MM3 A;  3JSV A;  4M02 A;  2KVR A;  1KM7 A;  2I38 A;  3ZIM A;  4GB9 A;  2BT6 A;  2MSE D;  4PT5 A;  4KZ0 A;  2QEJ C;  1N5W A;  1WGK A;  3AE6 B;  2UU7 A;  3PSE B;  2M4N A;  2WXI A;  4GDK A;  4BAX A;  4B9K A;  2OJR A;  1MVK A;  2K6Q A;  1TY2 A;  1WYG A;  2IND C;  3Q3O C;  1D3Z A;  1WSP A;  3RYT A;  1WY8 A;  1WWT A;  1E8X A;  2N1V A;  3VUW A;  1P98 A;  1JWU D;  2MX2 A;  4AP4 C;  1D4B A;  1IGC A;  4K1R B;  1SJH D;  4IW0 A;  3Q8F A;  4GMV A;  1AYF A;  4DDG D;  3H9D A;  2BKF A;  2ZEQ A;  1YQB A;  1UBI A;  1JRO A;  2TSS A;  1KF6 B;  1ZGU B;  4RH6 A;  4KDI C;  2AQ2 B;  2QHO A;  2VZK B;  2FUG 1;  3TEW A;  4A90 A;  2V4L A;  1EF1 A;  2KDB A;  5E6J A;  3NY5 A;  1NVI D;  2DYM A;  4NZL B;  3AEG B;  4Q2J A;  1MPE A;  3W1S C;  5J2R A;  3AE2 B;  4MGI E;  2NMQ A;  4LDT D;  4RGN A;  3WAM A;  2KDF B;  4MM3 B;  4NY0 A;  5IN7 A;  1FD6 A;  3JSV B;  3DBR I;  4ANX A;  3HVD A;  3WAP A;  2JSV X;  2YEP B;  1EUV B;  4K7W A;  4TQ1 A;  1BUI C;  2V0G A;  1YJI A;  3DVN V;  3TSS A;  2KMM A;  2WXN A;  1SSN A;  1Q1O A;  2RMM A;  1MHH E;  2LXC A;  2N9X A;  2JYE A;  1KOT A;  4FJV B;  2LGY A;  2AL6 A;  3U8Z A;  4BBN F;  2BWE S;  4LDT B;  4GDK B;  2J42 A;  4AUQ C;  5TSS A;  1ESF A;  2GBK A;  4RF1 A;  5BMH A;  2QIL A;  2JT4 B;  3PLV A;  1TIF A;  1SXT A;  2JWU A;  4OHJ A;  4HWI B;  3Q3M C;  4EKU A;  1K50 A;  1CJE A;  4ZRI A;  2L7R A;  1HE8 A;  2HJ1 A;  3AEC B;  3V62 A;  4KKJ A;  3Q3N C;  2NR2 A;  2MBB B;  3FAH A;  5GXG B;  1GNU A;  2LWP A;  2L00 B;  1GB4 A;  4BBN C;  1YQ3 B;  3GE3 C;  1ZDV A;  1WXV A;  3OJ3 A;  2GBM A;  1C79 A;  1L4D B;  1OEY J;  2PKO A;  3WIM A;  1AN8 A;  1LO5 D;  5E6P A;  1GAQ B;  2J4X A;  1TS5 A;  2HTM E;  1I4X A;  1L6V A;  1SJE D;  2GB1 A;  3CWI A;  1T0Y A;  4WQO B;  1WH3 A;  1XLQ A;  2JZ3 B;  2KC1 A;  3R2T A;  2K1F A;  5AUI A;  3DBL B;  2L52 A;  3ZTD A;  3NVW A;  2LD9 A;  2INC C;  2NBV B;  4A6Q A;  3ZGZ A;  1YJ1 A;  1XCQ L;  1IGD A;  1V86 A;  4DHZ E;  1I4H A;  2PE6 B;  1N63 A;  1WXS A;  1GC7 A;  3Q3F A;  2MBH A;  5AZF A;  3B08 A;  1V49 A;  1QF6 A;  1QOA A;  3M63 B;  2LGI A;  1LXD A;  2JVC A;  3ABV B;  1Z5S B;  2WGS A;  2AEH A;  3WAL A;  1XQQ A;  2KKC A;  3APF A;  2BB5 A;  3GZN B;  3AUL A;  1NI2 A;  2CHX A;  2K25 A;  1HA5 A;  3PGE A;  2PVG C;  1WGY A;  2FE8 A;  3N3K B;  4WUR A;  2EEL A;  3PS6 A;  4GOC A;  3B0A A;  3P4Q B;  1FPY A;  3APD A;  2I1K A;  2IY0 B;  4EFO A;  4DBG A;  1N62 A;  3EFU A;  4WH4 A;  1WZ0 A;  4IM3 A;  2FCQ A;  2PTL A;  1LFD A;  4RFB A;  1WYW B;  2C7N B;  1SIJ A;  3L10 B;  2XK5 B;  5AEK B;  1C76 A;  2JXX A;  3QAQ A;  3A9J A;  1NBF C;  4A9A A;  1R4N I;  1TZ1 A;  4IUM B;  2NCN A;  2NTS A;  2LUE A;  1QOF A;  4TV3 A;  1V81 A;  3PPA A;  2WWZ A;  2C9W B;  4MSQ B;  4GU2 A;  3ZRC A;  2YLM A;  3IHP C;  2B3A A;  1K8R B;  2BGF A;  3BII D;  2D3C A;  4KZC A;  1FMA D;  2IO2 B;  3ZRF A;  3ZLZ A;  5IP4 D;  4URK A;  1JWS D;  3EHV A;  2Y5C A;  1F77 A;  5E6N A;  2BW2 A;  3P42 A;  4JWS C;  4XDC A;  3UF8 A;  3P4R B;  1WM2 A;  3PHX B;  3AEB B;  5D7G A;  1D6E C;  4RCO A;  3VFK A;  1QOB A;  4FHJ A;  5LXH A;  3N20 C;  1JRU A;  1IBX A;  3KLS X;  2ONQ A;  2KLG A;  1QZE A;  2V3S A;  4IWQ A;  2WDT B;  3RNB C;  2WDQ B;  3DDC B;  1UH6 A;  4W9H A;  1KTK A;  2QDF A;  2AL3 A;  4O1N A;  1SBB B;  4LCD E;  2W55 A;  4F7Z A;  3IAS 1;  1AAR A;  3DBR B;  3C19 A;  5DPT A;  3RZW C;  4ZHO A;  2EMS A;  1J7B A;  5EE3 A;  1GJZ A;  4WWO A;  1L0X B;  2NVU I;  3IXS A;  3DVG Y;  2FIF A;  3KQ4 A;  4JX1 C;  3W9C B;  3QIJ A;  2KQ7 A;  3J9C A;  1B1Z A;  4S0R A;  3A9J B;  1HZ5 A;  3OJ4 B;  1FRR A;  3QQ8 B;  3V6C B;  4ARC A;  2LMC A;  2JWZ A;  4WJQ A;  4KDL B;  2NTT A;  5J17 A;  3VXW A;  2WXM A;  1WXM A;  3APC A;  2O6V D;  2WXO A;  4ZRJ A;  2M17 A;  1VZ8 A;  4HPL B;  1VCB A;  3EFC A;  2ZNV C;  1IPG A;  3SEB A;  1E0Z A;  1GC6 A;  1TTN A;  2WX0 A;  1PFD A;  3KH0 A;  4MEL A;  4OVV A;  4A3P A;  2X8X X;  2INN E;  2MWS B;  3FKY A;  2M1M A;  1DGJ A;  4BKS D;  4PYU A;  2L0F A;  1ROE A;  2OHF A;  4PK1 A;  2MA9 B;  2WXJ A;  4FHK A;  2E3T A;  2KWD A;  5IAA C;  2Y5B B;  1IBX B;  4PS8 A;  4C7Y A;  3N9Y C;  4ASW C;  4OZB A;  2MW5 A;  1EM7 A;  2PEA A;  3CSF A;  1XLO A;  3UQA A;  1P7E A;  1CK1 A;  3WCQ A;  3DVG X;  5G5H A;  3NJT A;  1V9J A;  2V4I B;  2KFJ A;  2WXR A;  3GS2 A;  4AJW A;  2IDY A;  2MHJ A;  4ZYS A;  3L08 A;  3AE8 B;  4MH8 A;  3RI7 C;  3KWV A;  1JQ4 A;  3H7P A;  5EDS A;  4A3O A;  5BMI A;  3L54 A;  3SFD B;  1R4M B;  1WXA A;  4HJG E;  5D3I B;  3VDZ A;  2YVC A;  1RWS A;  3BYT B;  3HK0 A;  4F1S A;  1ACC A;  2BYF A;  4DHJ D;  1F1H A;  3NOB A;  4ANW A;  4G3X B;  4E74 A;  2CS4 A;  1NI3 A;  2SEB D;  4C7Z A;  1JWA D;  5KHO A;  1CZP A;  3H7S A;  1KJT A;  1XLN A;  3VHT C;  3UQB A;  2N9K A;  1SIF A;  3WAO A;  3PLU A;  3P1M A;  1OTR B;  1ZXI A;  3EA6 A;  3WAN A;  4DHJ B;  1GOZ A;  2KZR A;  2KQS A;  2RSU A;  1QOG A;  2HD5 B;  4ZOH C;  4FJY A;  4LNO A;  3RNG C;  1NYR A;  2LGD A;  3C0R B;  4XYC A;  3L17 A;  1R4N B;  3RUL A;  2KJR A;  2UYZ B;  1QT9 A;  2MJ3 A;  4WAF A;  1OGW A;  2JRH A;  2N9E B;  5HG2 A;  2K6D B;  4II3 B;  2DAF A;  3VH4 B;  1E10 A;  3OG5 A;  2YEP F;  3GP7 A;  2IO3 B;  4FAD A;  4EUT A;  3NZU A;  3KVF B;  3H7P B;  3VUX A;  3R2I A;  2LJ5 A;  2MCN B;  3NZS A;  2L1A A;  4W9C A;  1TKY A;  4LLG M;  3A4R A;  2W82 A;  2MLB A;  2RGF A;  1WRI A;  4K81 A;  2R61 A;  3PZD A;  3DOW A;  5G2N A;  3AE9 B;  5HFY A;  4US9 A;  3NZ3 A;  3Q14 C;  1XF5 L;  5DPS A;  4ZHP A;  4YL8 A;  1SGH A;  3NVY A;  1NEN B;  2GBJ A;  1TS2 A;  1UF0 A;  4JWU C;  1ZKH A;  3AXC A;  4KIK A;  3FC4 A;  3NVV A;  2LRU A;  3T3N A;  1FNU A;  3U7D A;  1MI0 A;  3ZNH B;  4TQ0 A;  3H6N A;  4I6N B;  2BF8 B;  4BFR A;  4PS7 A;  2IGH A;  4P16 A;  3KW5 B;  3QC8 B;  4NPN A;  4XWW A;  3P4P B;  1SF0 A;  2G4S A;  4B95 A;  2KN4 A;  2BBC A;  1E5W A;  3DWG C;  2KQ4 X;  1E8Y A;  4CO7 A;  1TS4 A;  4AWJ A;  3RT3 B;  2DZK A;  2OJW A;  3C8Y A;  3EGR A;  3K9P B;  1WZ3 A;  1TYG B;  3CMM B;  1D5X C;  2JZP A;  4CHK A;  5LNK 1;  1C78 A;  1Q5W B;  4NJ6 A;  2W54 A;  1LM8 B;  4JE3 B;  2L3Z A;  1SE2 A;  4RGM A;  3R3M A;  1ZPS A;  1SE4 A;  3V05 A;  4DDI D;  3KUZ A;  4K7S A;  1BML C;  1MFW A;  2WHI A;  3SFE B;  4C80 A;  2HTH A;  4B0M A;  4JPS A;  3BZD B;  1NDD A;  4LNN A;  3QX1 A;  1TY0 A;  5J18 A;  5FK9 C;  4GLS C;  2R2Q A;  1EU3 A;  2B76 B;  4RGT A;  2RD0 A;  2WXH A;  1FEH A;  1JRP A;  2V1Y A;  2DNF A;  4KIK B;  1F2R I;  2HJ8 A;  4BOZ B;  1L0Y B;  3U30 A;  4JIO U;  3ZJT A;  3AU4 A;  1M94 A;  2WXG A;  3U7Z A;  1EF5 A;  4II2 B;  3PRM B;  1RM6 C;  3N1X C;  3IFW B;  3M95 A;  4ZDV A;  5IKC M;  5TR5 A;  2Z8L A;  4N59 A;  2XEW A;  3ZKJ C;  3OWE B;  5DCN A;  3AE5 B;  1UWM A;  3PT2 B;  3PRZ A;  2NPT A;  4GN1 A;  1ZXH A;  4REZ A;  2K8H A;  2LEK A;  5DPW A;  3PRP B;  3N32 A;  1XD3 B;  2J0K A;  1PYW D;  3IBE A;  2UWQ A;  1RFK A;  1TKG A;  5LXI B;  2CU1 A;  3HM3 A;  2DX5 B;  1L5P A;  3BVG A;  1RFA A;  3NS8 A;  5D3D A;  4EEW A;  3A9K A;  4JQW C;  4NAM A;  1RYJ A;  1RAX A;  5CX3 A;  2G4D B;  3PZ8 A;  2GRI A;  3B2G A;  2C7H A;  2WXF A;  3TUO A;  4OVZ A;  5CHW A;  3Q8E A;  3ML9 A;  4FN2 A;  1WXQ A;  4HLE A;  4DWF A;  2GBR A;  1B9R A;  2WYQ A;  3W2D A;  4S17 A;  4ZYN A;  1VD2 A;  4M8M A;  3K9O B;  4MEM A;  4W9J A;  4JGH B;  2JX5 A;  3IG3 A;  5D2M B;  2PVO D;  1YX6 B;  4BOS C;  4J3O D;  3HHM A;  2NBU A;  2DHZ A;  4MH0 E;  4FBJ B;  3IT4 B;  2JU6 X;  3AE7 B;  3AE4 B;  1N61 A;  3JVZ X;  4WWP A;  2ZW0 A;  2G45 B;  3R7R A;  1OQQ A;  1XEE A;  4MJS A;  2DYO A;  1YQ4 B;  2L8J A;  2RDB C;  4YT0 B;  3DVN U;  3L13 A;  1WJU A;  2NPT B;  1TJE A;  1XO3 A;  2WDR B;  5AZH A;  2BQQ A;  3VAW A;  2GMI C;  3V61 A;  2DAJ A;  1AW7 A;  2K3U A;  3MFG A;  5EE9 A;  5HKH A;  1FXI A;  4ANV A;  4UDU C;  4E71 A;  3I5J C;  2NBW B;  4E3C A;  1VZ7 A;  2MP2 A;  3PV1 A;  2LVQ A;  2DWQ A;  1S3S G;  2V9H A;  1E8W A;  2OED A;  4HEA 1;  1CQV A;  3EC8 A;  1L6U A;  3NHE B;  3OLM D;  3T9L A;  1PQS A;  2IY1 B;  4K3C A;  2QJL A;  4W9K A;  5AUK A;  1I4G A;  2KX3 A;  3RUI B;  2C60 A;  2XNA C;  3NS1 A;  4YWG G;  3A9K B;  3KYC D;  4P1C C;  4HDQ A;  4ICU A;  3QHT A;  2DZM A;  2J0J A;  1EU4 A;  2ZPY A;  2JZZ A;  2ZPN A;  3W5U B;  1KFY B;  2C7M B;  1VR9 A;  2KTF A;  2MBE A;  2KJH B;  5BO4 B;  5KHQ A;  1STE A;  4ANU A;  2WQY B;  1E8Z A;  4KGT A;  4GIV A;  4XGA B;  2LVO A;  3QA8 A;  1K52 A;  3CF6 E;  1PGX A;  2AWT A;  2QIE B;  2KK8 A;  3A1Q A;  3VR8 B;  5H8Y E;  2ASQ A;  2KWC A;  5EE1 A;  2LGS A;  1VLB A;  2WX1 A;  2O6V A;  3HUI A;  4B0E A;  4MJS B;  1ISN A;  3ENE A;  1L7Y A;  4X57 B;  2BS4 B;  1UZX B;  3SU8 X;  1YN3 A;  3LDZ E;  1MHX A;  2FCN A;  4DHZ B;  1FNW A;  5G5G A;  2V3P A;  5JXV A;  1P9D U;  2KOX A;  3BK1 A;  4IM0 A;  4KV2 A;  4BKS A;  1C9F A;  1FIQ A;  2WNM A;  2R2O A;  1I4R A;  2BKR B;  4MSM B;  2MP2 B;  2FBW B;  3VRA B;  2E6X A;  4C4V A;  3DQV A;  1XCT L;  1V6E A;  2CJN A;  3TEZ A;  2ICI A;  2GOW A;  2KT7 A;  3ZXV A;  3HRD D;  1IP9 A;  4ARI A;  4FLH A;  4NAW A;  4IC7 B;  3JYU A;  2QMT A;  4XZ4 A;  4LNK A;  4LJP B;  2MBQ A;  2LUM A;  2CHZ A;  3RNC C;  3RFZ B;  4BZA A;  2MH7 A;  1WJ4 A;  2KD0 A;  3VUY A;  3LXF A;  2KN5 A;  4JLC A;  2EMT A;  5BYR A;  3RNE C;  3SR6 A;  1I35 A;  3L0W B;  1E6E B;  3B2F A;  1HTO A;  1MG8 A;  1E7U A;  1WGH A;  4MGK E;  1JW9 D;  1HTQ A;  1V8C A;  2K0P A;  4BKG A;  1T0R C;  1WGR A;  3A1Q B;  5FKA C;  3SD5 A;  4WAA A;  3URY A;  2HDE A;  1OQY A;  4HKQ A;  1KLG D;  4LNI A;  2IJ0 A;  2QCZ A;  2D5G A;  1P1A A;  2INP E;  2Y5P A;  3UIP B;  2O6V B;  3AV8 A;  4CQN A;  3P63 A;  2PW9 A;  3QAR A;  5H92 C;  1UBQ A;  1C4C A;  4L2Y A;  2AQ3 B;  4RF0 A;  2AYO B;  2Z0E B;  3TEX A;  1EWY C;  1FRD A;  2LJI A;  2PIA A;  4KVG B;  1V97 A;  2K22 A;  4C4V B;  3M3J A;  3DHH C;  2I1J A;  4FJZ A;  4HKZ E;  3L16 A;  4NAW B;  2KDI A;  3ZNZ B;  1UD7 A;  4YXD B;  4ZRK A;  5C3J B;  1Z2M A;  2AX5 A;  4EZL A;  1FCL A;  5DPR A;  1J7C A;  2GLS A;  2WU2 B;  3IVF A;  2IPK D;  3T8M A;  4IKG A;  4EE2 A;  3KWL A;  1I7H A;  1UNS A;  2MEK A;  2WXL A;  2BB6 A;  4G50 A;  3ZVV A;  4EZJ A;  2PE9 A;  3RN9 C;  1RLF A;  1N6Z A;  2RPV A;  2CKH B;  2N1W A;  4RM9 A;  3BVZ A;  3QJZ A;  2CJO A;  2C5L C;  1P7F A;  2A4Z A;  3MP9 A;  1WM3 A;  3CIR B;  2I2Y A;  4XDD A;  3AED B;  4WJP A;  1KRH A;  3N30 A;  4NQK E;  2FCS A;  1T3Q A; 
#chains in the Genus database with same CATH homology
 2LGI A;  2SAK A;  4IDI A;  1I4Q A;  1ZPS A;  1YNT E;  3ABV B;  2MJD A;  1SE4 A;  3V05 A;  3U2S C;  1BML C;  1E9M A;  1NYQ A;  1D5Z C;  2BB5 A;  2W3S A;  1YMH E;  4US8 A;  1SB3 C;  3SFE B;  4KGS A;  3ZYY X;  4C80 A;  3PZ7 A;  4MAC A;  4B0M A;  3TEY A;  4JPS A;  3BZD B;  4YTN B;  1TY0 A;  1D5M C;  1HA5 A;  1T5X D;  2Y3A A;  4TMA B;  1PUT A;  1I4P A;  2K5P A;  1VZ6 A;  2PVG C;  4GLS C;  5FK9 C;  1EU3 A;  2B76 B;  1QKZ A;  4RGT A;  2FE8 A;  4KGR A;  4WUR A;  2EEL A;  2L32 A;  2WXH A;  3BK2 A;  1FEH A;  1JRP A;  3P4Q B;  1F2R I;  1L0V B;  4RNA A;  2GI9 A;  1L0Y B;  2WU5 B;  2PMV A;  1N62 A;  3VQI A;  4HRS A;  4WH4 A;  3ZJT A;  4DXG A;  2PTL A;  4ITK A;  2G1E A;  4RFB A;  3MJ5 A;  2WXG A;  3U7Z A;  2BS3 B;  1SIJ A;  1FFV A;  3AH7 A;  1C76 A;  2LHE A;  1A70 A;  3ZQ4 A;  1AWD A;  4TSS A;  2BS2 B;  1UWX A;  3Q8C A;  5T8I A;  1M4V A;  1RM6 C;  2N0S B;  1SE3 A;  4A9A A;  2J53 A;  2NTS A;  1FNV A;  1Q10 A;  1QOF A;  2Z8L A;  4N59 A;  4DQO C;  4YSZ B;  2L83 A;  5BMG A;  3OWE B;  3PO0 A;  3AE5 B;  1UWM A;  3V3X A;  3R8B A;  3AEE B;  3Q8B A;  1HQR D;  1ZXH A;  4REZ A;  3BII D;  1ZE3 D;  2QSD A;  2LEK A;  2ACZ B;  3AE1 B;  1FMA D;  4WIP A;  1PYW D;  1JWS D;  1JWB D;  1ZUD 2;  2Y5C A;  1RFK A;  1TKG A;  1N5X A;  1F77 A;  3BYY B;  2BW2 A;  3E9S A;  2LHD A;  3AMZ A;  3P42 A;  4JWS C;  4XDC A;  1OFF A;  4WWM A;  2BYT A;  3P4R B;  2KDM A;  3T3O A;  2CU3 A;  3AEB B;  5D7G A;  1L5P A;  2EKI A;  2XN9 C;  1D6E C;  3BVM A;  3BVG A;  4MT5 A;  4RCO A;  1QOB A;  1PDX A;  3AB5 A;  1GPX A;  2IGG A;  5D3D A;  2WP9 B;  4A8X C;  4NAM A;  1VDV A;  1RYJ A;  1TZO A;  4HRO A;  1IBX A;  3KLS X;  1XLP A;  2ONQ A;  3PZ8 A;  2GRI A;  3B2G A;  2VZK D;  2WXF A;  3B9J A;  3NVZ A;  4XE0 A;  4OW0 A;  3TUO A;  4OVZ A;  2WDQ B;  3MHZ A;  3Q8E A;  1KTK A;  2LFI A;  1WXQ A;  2MJE A;  3L4P A;  1SBB B;  4O1N A;  4GDL B;  1QQR A;  3HVZ A;  2W55 A;  3E56 A;  3IAS 1;  1B9R A;  1E7P B;  3BWU D;  3W2D A;  1GB1 A;  1VRA B;  1C77 A;  1SEB D;  2WS3 B;  4ZHO A;  1J7B A;  1J7A A;  2JXT A;  2PLP A;  5EE3 A;  2JX5 A;  1L0X B;  1DOX A;  3EUB 2;  5MPO A;  2KAJ A;  3IXS A;  2JYT A;  3MC0 B;  2PVO D;  3KQ4 A;  4JX1 C;  4J3O D;  3W9C B;  2KAC A;  4AQ7 A;  4YTP B;  3J9C A;  1B1Z A;  2G9H D;  3UI3 A;  3IT4 B;  2JU6 X;  3AE7 B;  3AE4 B;  3NUH B;  1HZ5 A;  1N61 A;  1FRR A;  2ZW0 A;  1OQQ A;  1XEE A;  2DYO A;  1OQR A;  1YQ4 B;  4FXC A;  4ARC A;  1C4A A;  2LMC A;  2ON8 A;  1K53 A;  4YT0 B;  2WXQ A;  1JCK B;  4H2A A;  3RPF C;  2NTT A;  4USA A;  1TJE A;  1XO3 A;  1YN5 A;  2WDR B;  1XXG A;  2WXM A;  3FIL A;  3W1S A;  1ZOY B;  3ZJU A;  1AW7 A;  2K3U A;  2WXO A;  3MFG A;  5EE9 A;  1VZ8 A;  1FXI A;  4UDU C;  3I9V 1;  1E0Z A;  3SEB A;  3AE3 B;  2K9X A;  1VZ7 A;  1PFD A;  2DWQ A;  5FR3 A;  1ZDX A;  3H8H A;  2INN E;  2OED A;  4HEA 1;  1CQV A;  4C56 C;  1L6U A;  1FM0 D;  5I4D A;  1DGJ A;  1TKE A;  4ZRQ A;  4A55 A;  1ROE A;  2OHF A;  1ENF A;  3AM9 A;  2QJL A;  4LTU A;  5AUK A;  1I4G A;  3AN1 A;  2W3R A;  1QLB B;  1PGA A;  2XNA C;  2WXJ A;  3VRB B;  1V1O A;  3NS1 A;  4YWG G;  2E3T A;  3VR9 B;  1HZ6 A;  2KWD A;  4ZRP A;  3ETR A;  1IBX B;  1EU4 A;  4XWT A;  4OZA A;  4R3D A;  3W5U B;  2M56 B;  3IAM 1;  1KFY B;  4C7Y A;  1TS3 A;  1VR9 A;  3U52 E;  3N9Y C;  1HXY D;  4OZB A;  4WQM A;  1FFU A;  4N58 A;  2IGD A;  1FO4 A;  1STE A;  1ET9 A;  2WQY B;  4N6E B;  1PGB A;  4KGT A;  1EM7 A;  1XLO A;  1DOI A;  1P7E A;  2I38 A;  2RDH A;  3O13 A;  1CK1 A;  1K52 A;  3WCQ A;  5G5H A;  1PGX A;  2WDV B;  2QIE B;  2V3N A;  2BT6 A;  4PT5 A;  2V4I B;  3VR8 B;  2WXR A;  2QEJ C;  1N5W A;  5H8Y E;  3P4S B;  1WGK A;  3GS2 A;  2IDY A;  3AE6 B;  2M0A A;  4ZYS A;  5EE1 A;  3AE8 B;  1JAL A;  1KH0 A;  2WXI A;  2RDG A;  4MH8 A;  3KWV A;  1JQ4 A;  1VLB A;  1MVK A;  1V1P A;  5BYS A;  3HUI A;  4B0E A;  1TY2 A;  2BS4 B;  1IUE A;  1WYG A;  5BMI A;  3SFD B;  1WSP A;  4HJG E;  1YN3 A;  5D3I B;  1MHX A;  1RWS A;  1JWM D;  3BYT B;  1FNW A;  1WWT A;  3FIL B;  2V3P A;  5G5G A;  5JXV A;  1JWU D;  4NJC A;  5HI1 A;  1ACC A;  3BK1 A;  1C9F A;  1D4B A;  1FIQ A;  2WNM A;  1IGC A;  1I4R A;  1SJH D;  1VJK A;  1YN4 A;  3GB1 A;  4L23 A;  4DXF A;  2FBW B;  5BYQ A;  3VRA B;  2E6X A;  3Q8A A;  1NI3 A;  1XCT L;  2SEB D;  2CJN A;  3Q8F A;  4C7Z A;  1AYF A;  3TEZ A;  2ICI A;  1JWA D;  4D2K A;  3HRD D;  1CZP A;  1JRO A;  2TSS A;  4ARI A;  1KF6 B;  1XLN A;  1Y56 A;  2N9K A;  4RH6 A;  2AQ2 B;  2VZK B;  3P1M A;  2DLB A;  2FUG 1;  2QMT A;  2BTE A;  3TEW A;  4YTM B;  4A90 A;  3AEA B;  2LUM A;  5E6J A;  3W5V B;  1NVI D;  1ZXI A;  2DYM A;  3EA6 A;  4NZL B;  3AEG B;  5EE0 A;  1GOZ A;  3RFZ B;  3IT6 B;  4Q2J A;  1MPE A;  1NEK B;  2MH7 A;  3AE2 B;  1QOG A;  1YJJ A;  1HEZ E;  4ZOH C;  4KX6 B;  2NMQ A;  3AEF B;  1NYR A;  1EWC A;  1N60 A;  3LXF A;  4RGN A;  5BYR A;  5C2T B;  3SR6 A;  3LYY A;  4MM3 B;  1QIL A;  1E6E B;  2AQ1 B;  3B2F A;  1FD6 A;  1KLU D;  2Q5W D;  3HVD A;  2WLB A;  4LK0 M;  2JSV X;  2JQR B;  1JW9 D;  1QT9 A;  2ZW1 A;  2MJ3 A;  2YEP B;  4WAF A;  4TQ1 A;  1FCC C;  1BUI C;  1V8C A;  2V0G A;  2K0P A;  1YJI A;  3TSS A;  2KMM A;  4RGO S;  2WXN A;  5FKA C;  1SSN A;  2RMM A;  1F2R C;  5HG2 A;  1MHH E;  4KKI A;  1E10 A;  2H88 B;  3URY A;  2JYE A;  2HDE A;  2YEP F;  1L4Z B;  3GP7 A;  4HKQ A;  1KLG D;  2N9L A;  2IJ0 A;  4GDK B;  2D5G A;  2J42 A;  2INP E;  1JML A;  1DYQ A;  4YSY B;  3ZJV A;  1V1P B;  2Y5P A;  3R2I A;  5TSS A;  1FXA A;  1ESF A;  2DBY A;  3AV8 A;  4RF1 A;  4CQN A;  2L1A A;  3P63 A;  5BMH A;  2QIL A;  2PW9 A;  3LB8 C;  1SXT A;  2JWU A;  1TKY A;  4LLG M;  4OHJ A;  1K50 A;  5H92 C;  5HHD G;  2W82 A;  1CJE A;  1WRI A;  1C4C A;  2R61 A;  4IOI E;  4L2Y A;  2AQ3 B;  3Q69 A;  3AEC B;  4KKJ A;  3AE9 B;  4RF0 A;  5HFY A;  1F0Z A;  4US9 A;  2J52 A;  3FAH A;  4OZC A;  4RGM A;  5GXG B;  3TEX A;  1EWY C;  1FRD A;  3NZ3 A;  2LJI A;  1XF5 L;  2PIA A;  1GB4 A;  4P6V F;  4ZHP A;  1YQ3 B;  1V97 A;  2K22 A;  1ZDV A;  3NVY A;  1NEN B;  1TS2 A;  3I57 A;  1C79 A;  4HKZ E;  4JWU C;  1L4D B;  4NAW B;  1ET6 A;  2PKO A;  1ZP0 B;  4YXD B;  3FC4 A;  3NVV A;  1AN8 A;  1LO5 D;  5C3J B;  3T3N A;  1DOY A;  2H89 B;  1FNU A;  1GAQ B;  2J4X A;  1T6B X;  2AX5 A;  2M19 A;  4YSX B;  1MI0 A;  1FCL A;  4TQ0 A;  1J7C A;  1TS5 A;  2WU2 B;  2HTM E;  1UGJ A;  1I4X A;  2IPK D;  1L6V A;  1SJE D;  2GB1 A;  3CWI A;  4IKG A;  4EE2 A;  3KWL A;  1K51 A;  1I7H A;  1UNS A;  1XLQ A;  2MEK A;  2WXL A;  2BB6 A;  3R2T A;  5AUI A;  2L52 A;  3NVW A;  2N7J A;  3U4E G;  2IGH A;  4P16 A;  4XWW A;  2RPV A;  3P4P B;  1SF0 A;  1C4P A;  4A6Q A;  1BXT A;  2X38 A;  3DWM A;  2KN4 A;  3ZGZ A;  2BBC A;  1R7S A;  3DWG C;  4L1B A;  1XCQ L;  1UUP A;  2KQ4 X;  1TS4 A;  3BVZ A;  2WXP A;  3C8Y A;  2CJO A;  1IGD A;  2WXK A;  3EGR A;  1TYG B;  1I4H A;  1D5X C;  1P7F A;  1N63 A;  3MP9 A;  2JZP A;  3CIR B;  2I2Y A;  5LNK 1;  1C78 A;  2W54 A;  4XDD A;  4JE3 B;  1QOA A;  3AED B;  1QF6 A;  1KRH A;  3NRZ A;  1T3Q A;  1SE2 A;  4M0W A;  4AS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...