1E9QA

Crystal structure of bovine cu zn sod - (1 of 3)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
151
structure length
151
Chain Sequence
b'ATSAVCVLSGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADSNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE
molecule tags Oxidoreductase
publication title Conformational Variability of the Cu Site in One Subunit of Bovine Cuzn Superoxide Dismutase: The Importance of Mobility in the Glu119-Leu142 Loop Region for Catalytic Function
pubmed doi rcsb
total genus 38
structure length 151
sequence length 151
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2000-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1e9qA00
1HL4A 1TO4A 1IBBA 3GZPA 1E9QA 1TO5A 3H2QA 1IBDA 1SDAB 1XTMA 1Z9PA 1F1DA 2C9UA 4U4IA 3GQFA 1Z9NA 1S4IA 4FF9A 1F1GA 2VR8A 3GZOA 1PZSA 3LTVA 2AQNA 1MFMA 2AEOA 2AQTA 3L9EA 3MNDA 4MCMA 1N19A 5KBKA 1U3NA 4A7SA 2WZ0A 2VR6A 4BCZA 4N3TA 1IBFA 3KH4A 1IB5A 3QQDA 2JLPA 1E9OA 4OH2A 3RE0A 3CE1A 1SDYA 2AQPA 2XJKA 3CQPA 1AZVA 2Z7UA 1XTLA 1FUNA 3KM2A 3L9YA 1UXLA 5KBLA 1E9OB 3GZQA 4A7GA 2AQSA 1SXCA 1UXMA 2Z7ZA 1CB4A 1SXZA 4BD4A 4N3UA 1OAJA 2ZOWA 3MKGA 1BZOA 2WZ5A 5CU9A 2WZ6A 4A7VA 3HW7A 2NNXA 2LU5A 4OJAA 2WKOF 1OZUA 4A7UA 1RK7A 1PU0A 1F18A 1SOSA 2C9VA 2E47A 1OZTG 1L3NA 1IBHA 1XSOA 1OALA 2ZKXA 1KMGA 1JK9A 4A7TA 3QQDB 2Z7WA 4A7GF 3HOGA 3CQQA 3HFFA 3ECUA 1ESOA 1JCVA 1EJ8A 1SRDA 4B3EA 1CBJA 1Q0EA 2Z7YA 1SPDA 2APSA 4BCYA 4A7QA 1YAIA 3H2PA 3KBFA 2GBUA 2ZKYA 2AQQA 3GTTA 1YSOA 1N18A 3KM1A 2WKOA 1P1VA 2GBTA 2R27A 1E9PA 1SXNA 1SXSA 2Q2LA 1QUPA 3ECWA 1SXAA 4L05A 1E9QB 2XJLA 5KBMA 1F1AA 1PTZA 1DSWA 2K4WA 3PU7A 1HL5A 4MCNA 1B4LA 3F7LA 1SXBA 2GBVA 3KBEA 2E46A 1OEZW 2WYZA 1DO5A 2AQRA 3F7KA 2WWOA 3GTVA 2WYTA 3KH3A 2JCWA 1E9PB 2AF2A 3S0PA 3ECVA 1YAZA 2VR7A 2ZKWA 1BA9A 2V0AA 2WWNA 1EQWA 3T5WA 3K91A 1B4TA 1COBA 2C9SA 3SODB 1JK9B 2SODB
chains in the Genus database with same CATH superfamily
4LU5L 1JGEA 1FFPA 1OSZB 4OZFG 5BS0B 2NSXA 4L0PB 3B2DC 4HCRH 5D72H 1SYVA 1TQCC 2MQCA 4OJFL 5E4EC 1XF4B 2Y6TE 4F7KA 2YFNA 1S7SA 3H4FA 2X1QA 3F7PC 4G8IA 3CVHH 4MJJA 3RVWD 4AQOA 1NEZG 1Y0LA 5EH1A 1YYMH 2CJTA 2PUQT 3ERXA 1EO8H 3EO1A 4G70B 1XGRB 3PGDB 4AEIL 1IT9H 2XZCL 2GY7B 1J5IA 2R1YA 3KL5A 3ZPDA 1IGYA 2CHDA 3NZUA 3QXWA 3SE9H 4FXLA 2RQEA 3MCG1 1SJEB 4N1EA 5INDB 2ZJSH 1MCHA 2VC2B 3LEYH 3MLRH 3FPXA 5TQ2L 1FVEB 5IROA 4RISL 5HGHB 3DX8A 3H54A 4G2AA 1A02N 1RJZA 4NYLA 3QIWC 5HVFB 2APFA 2YPVL 3CFJB 3RFRA 1Q9KB 3MUHL 2Z31C 3U4KA 3UROR 4WFEE 1PCXA 4HV8A 4M4RA 5HYEA 1YY8A 2VN5A 4J1UA 5B38B 4OB5H 3GI8L 3U1SH 1J5OL 1HAWA 4LFHD 1CK0L 2I69A 4TKWA 5KSAA 1UYWL 4WHDA 3SPJA 5G5DA 1FIGH 1JWMB 2X2JA 4NJAL 1NDMA 2DQTL 1CBJA 1HCVA 3CSBA 3VG9B 2OMUA 2WKLA 3AROA 1HDMB 2Q1EA 3T04D 1G9NC 1F8TL 2PPAA 4JJHA 4O51B 4JG5A 4I3SH 2ZSWB 4WI6A 1UKSA 3EXJA 3V6FB 3KM1A 5ESQB 2R27A 3AS1A 3IXTA 2OYKA 4R84A 1DBML 2K7PA 1O7VA 3QORA 2G3MA 3GXUB 3X3FH 4C83A 2DB8A 4O9HL 2WLNA 1KNOA 1MLBA 3IDYC 4Y1AA 5EO0B 4U1NB 2Y7NA 3IXAA 4JREC 1LK3H 2D03H 5KSBA 1K3ZA 1P5UB 3FU7B 3QJFA 4OZFH 5E2TH 1QPXA 2UUDK 4G6JH 4N2AA 4RGNE 4UM8B 1CDYA 5CZRA 2VTFA 4TUKH 4XPHH 1NCBH 5IBUG 2G9KA 5F3FA 4PS3A 4AE1A 1S3KH 4BQ9A 3SDXB 3BZFB 2RHEA 3S3JA 3BUQA 3PHQB 4ZMAT 5B1CA 1XEDA 1CYGA 2VDQB 3WNOA 1FG2A 3J7HA 1IL1A 3SYPA 1SJXA 3D0LB 3AT0A 4KKBC 4PLKC 4BEIA 3BQUB 1G6RA 2R0KH 2ZD0A 1FBIL 1U6AL 3RWHA 4M61B 2DJ4A 1H0DB 1NEZB 2HVJA 4NRZB 4UT7L 1T03L 1G43A 4ZS6D 4H4NA 4C57C 3OKNA 1JHTA 3O41B 1G7QB 2NYZA 4ZMXA 1IC4L 3OZLA 4G8FA 3VSVA 5I24A 1FORL 1B9ZA 3CBKB 3IMVA 3PP4H 3PQYA 2E9GA 1WT5C 4NQVA 2Z8RA 3WNLA 4MQXC 3UO8B 2HH0L 4P46C 1ZHBB 1QAWA 1XTLA 3RJQB 3HBZA 5HI5D 1FJ1A 1L9PA 2H1PH 5EZJA 4XVUD 1ACYL 4LHUD 2Q0ZX 3ZYIA 3LY6A 4WFGD 4TNFA 2DPKA 3HR5A 2NDGA 1MHPL 2Y1VA 3KLLA 4H88H 2ZQKA 3MBXH 3WIIL 1OY3B 4GKNB 2IC2A 3FQXB 4JG9A 3WJMA 3UERA 5F9AC 1WTLA 2C3WA 2QSQA 5L4MA 3NIDB 3I6KB 1JGLH 1ORQA 3TWYA 5I8EB 3EGXA 3VXRB 1L9TA 1F6FB 4GXUM 3IEAA 3LNIA 1BQRA 1OTSC 4NS0A 3V4UL 4ANXA 3UIZA 3WEOA 1SOQA 2YXFA 4R83A 4C4KO 3G9VA 3Q9PA 4QOKE 5H8DA 3ZE2E 3EDDA 5CINL 3WHE1 4NQCE 5TE7L 5BO1H 3LQMA 5EEVA 1AQHA 2NNAA 3A4FA 2N0MA 5KJ4A 1LQBC 4GQ9L 1BJMA 1ZY9A 4L37B 4X6FB 4FQIH 3SKNA 1U3HC 1PJWA 5EC1B 3ZIYA 1UA3A 9PCYA 1M05B 5DSCA 2B3IA 3CFCH 4PRIA 4WDIA 4FNLH 5AVWB 5DHVH 2ZG3A 5CMAA 3R7QA 1NFIA 5D2LA 3F64A 2QVMA 1XH0A 3I3EA 2H3NA 5HHXH 2K4WA 1LEKA 4FYRA 4EI5C 2DMHA 3NSXA 1EAJA 1D9KD 4R7NB 3WCYA 1TQTA 1WIUA 1X6LA 3OHXA 1CLOH 2ATKA 3AXLA 4N68A 5JYMA 2CO4A 1UH3A 5D5MA 3W9EA 5TGBA 3HAEG 3EDEA 3EO0B 2OAAA 4JMNA 5AOKA 3WDHA 5JOPD 2C3VA 2EEAA 2J25A 2A73A 3I3BA 4ICXA 2EH7L 3CZEA 5H37A 1KY6A 1SDDB 1JPSL 3HLKA 1CDHA 4AL8H 4F9LA 3IMSA 3QDME 4YPGA 5BZDB 4DKFL 2NY2B 1R3KB 4GIAA 5C0BA 1IBDA 4XBEL 1HVXA 4L3AA 2HJKB 2YUVA 4OVVA 1MWAL 3ALWA 1FIEA 3HMXA 1FL5A 5CCJA 1ZT1A 5EF2A 5F96H 5IBTH 1Z3GL 3MZTA 1NGYA 4ELKB 1TSRA 3ME0A 2NXZB 3T1FB 2N0KA 1DEDA 1L9MA 3GMPA 4GT0A 4RWYL 4YGVA 32C2B 5E9DB 2X10A 1CPUA 2ZJSL 3NIGE 3RFZA 6PCYA 2XPYA 4P9HL 4R4BB 3B8SA 1FYTB 4F8LA 2R69L 1NGWB 1QYGH 5TQ2H 4HOXA 5MI0C 3TCXA 1XR8A 3SQOL 5TK4A 4OJCA 3NCJH 4RGND 3VVVA 2OJ1A 5AW1B 1EEZA 5A2LH 4M56A 2VL5B 4N6QA 3HAEB 3JV6A 1UT9A 3O3DB 2NX5D 4LSUH 1FHGA 3BWZA 4MNQD 2Y36L 3CX5K 5J6HA 1AO7D 5F7NC 4YZFF 5C2BH 1Z5YD 3KBPA 3CU1A 1U8LB 1Y7VA 3APCA 2NXYC 4PP1C 1D7DA 4Z7OB 2IWGA 3K81A 5C0DB 4ETQA 2TSAA 3K74B 4LNRA 3J2PA 1DBKH 3P9WB 5DURB 4FG2A 1KTLA 2YAPA 3ZK0A 4D7PA 5K9QI 4IRJB 4ZFOB 2BP8A 5HGAA 5M95B 3RWDB 2B59B 3VB9A 2XTJE 1TTAA 2H0FA 3R1GH 4PBVC 3M7OA 3PV7A 3VFUA 2F2HA 4NHCH 3CVIL 2AK1H 3S4SB 4YE4H 2WBWB 3T6QC 1EAPA 1S7SB 2RALA 4QRQA 5DJ0A 5GGQH 2QMKA 5E6IA 1NDMB 4HUKB 1M1XB 4XC1L 2QR0B 1E8XA 2RD0A 1AGBA 3L2MA 1M53A 3TNMA 3RDTA 3S3BB 1FPTH 4PP2B 3DMMD 1DFXA 4EUPG 2BSBA 5DQJB 4DGUA 1A6UH 4ZX5A 5JLZA 3PU7A 1SN0A 3FRPG 5LB1A 1IAII 5DYOB 3IFNL 4HS8H 3DO3A 1OIOA 2P5EE 4XVJH 2DI8A 4P2OD 1MW0A 4WU7B 4IJTA 3ZYJA 2GSIA 4JFED 3VGFA 3UJIH 3NPSB 2J1ZA 4IRZA 3DX8B 1HILB 1C9SA 3O9WD 4ZOEA 1DQKA 4FQLH 5CLTA 4E9YA 1A8JH 1KSRA 1Q9KA 1WWCA 2GG1A 2XACC 4HHAB 3GJFK 1PLGH 2ICES 4IW4C 4TQ8A 4UT7H 3VXUD 5K9JH 4JKWA 4OCMC 4RMUA 3VFWB 3T1WA 1YY8B 1NDGA 2XPGA 3MMEB 1CJYA 3IVKB 1BDYA 1OTUD 4KK6C 1X9LA 1WWBX 4LRNH 2X3CA 5C08A 4OF8A 6FABH 2OMWA 3P4MA 4LEOB 2YAHA 1OP5K 3QIUD 4UANA 1U42A 5BRZD 3TNNB 5B8CB 4XPBH 3ATEA 2OR7A 2UYLA 4HPYL 5DZPA 3NEXA 5J3HD 5HYFA 1ZEAL 4OZGA 4F57L 3Q6FB 4FULA 4O51A 1XSKA 2BP0A 3FCSA 1XIWA 3K4ZA 2X4OA 1JDCA 1I9IL 2AJYH 4Y2LA 4B95C 1XGTB 4PRIE 2FATH 2NDFA 4JPVH 3MBXL 3MBWA 3WFBL 5IJVA 1JMZA 3VFSB 4WQOA 5DRXA 2R2HB 3CVBA 4L8SC 5EO0A 4TN9A 1CDCA 1ZHBA 3B1TA 3MO1B 3U0PB 4M1DH 1MFEH 4H1LH 4XPFH 1FNLA 1QACA 1QTPA 3ARPA 4CADB 4AQAB 3DUHA 3HBPA 1QQDB 4Y5XB 2F68X 1RK7A 2G2RA 1F18A 3HNSL 4XP1H 2QSCH 1KXHA 3GGWA 3GXNA 3LH2H 4NKOA 1HJCA 3P1VA 5FX3A 2AERT 2AJXL 5SX5K 1PCSA 2NXYB 4R7DA 4AW4A 4FFWD 1TMCB 1HNYA 3EGSB 3INUH 2WQXA 3RGVB 1NCCL 3V4PA 1E5ZA 3RTQA 3TPUA 2MSPA 3EGXB 3VXRA 4ONGH 5K33A 2X7LA 3SBRA 3OBAA 2OSLB 4PW4A 3WEXB 1J1OH 1S3RA 1N5YL 3NP3A 5LN8A 3CFCL 1AMYA 1NEZA 4NRZA 1MLCB 3K2IA 3MLVL 2DKMA 5ANMB 4LLWB 5ESVB 3E6HA 2Q8BL 1NAMH 2IBZY 3F85A 1I85C 5GS0H 7PAZA 2R69A 4GRLD 5BZZA 5LGKA 3IFOB 3PWUB 2A2QT 3L3OC 1F42A 4HQQH 1YC7A 2YWYA 1F3JA 3P3SA 2HX7A 4BINA 1UM6H 3ZT6A 5IHWA 1V7ML 2YJLA 1HQRA 1K8DA 3EJZD 1ULVA 2WQWA 3HI5H 4GRWE 1C5DA 1F1AA 1A8ZA 1YRKA 4F92B 1RZJH 3C6SA 3QZMA 3QUYD 1IARB 4YK4C 1AJ7L 3GMQB 1VA9A 4U0QB 5DS2A 4HS3B 2F7QA 4PREB 1NAKL 2D31B 4WY7H 5MI0B 4NAMA 2XHNA 3O4OC 1T7XA 4DGVH 2J12B 4R90H 2FRGP 2ZKWA 1EGJH 5DFVD 3O6KL 4YDKL 4YWGH 5IMKA 3PQYE 3WUWG 3QIBA 1QKZH 2P5ED 4HWBH 2F7OA 1UZ6E 3EJUA 3GSRB 4HHGA 4HWNA 3T2LA 2C9XA 3T0BA 2WBJC 1KLUB 1I53A 1ZSHA 3B7TA 3OGOE 3QFJD 4JFTA 3VM7A 4JQXA 1SY6H 1EH9A 2EIZB 4ZX6A 4XI5C 2VW7A 4TUJB 4XVSH 4AKPA 3FXIC 4XVTL 2A9CA 2V5YA 1U2HA 3C5XA 1RUPL 2OQJA 5C0BB 1M1SA 4I9WE 4PLJC 5ABAA 1KBGL 4RESB 2ODHA 4Q6IA 3SYAA 4XZ4A 4MA1B 2NRDA 2CE6A 2GJZB 3TYFA 3L7EB 2NSQA 1F4YH 3UCRA 5BMFL 2NY6C 4Y1TA 4FC3E 2VDOL 3VU1A 1MCDA 4MNQB 3RNKB 4LFHG 1C1EL 3FTUA 1OQXA 5TDOA 4AQZA 1BQHB 2NY1D 1W91A 4O2EB 4LSUL 3QNYB 2Y36H 1GC1H 2WXPA 1SXCA 2GJ6D 3KYAA 2AABL 4UUJA 2CA4A 2YFOA 4YSSA 2EO7A 3SDAD 4CMHC 3GSQB 4N86A 2CGRH 5DJYA 2WZ6A 2YK1H 4CVWA 2CDGA 2VDLB 3AC0A 3OAUL 4K7PX 4X80L 5HI4D 1L0XA 3MLXH 4A7UA 4UDTA 2AQ3A 2CIKA 4L1SA 3OX8A 1TMQA 1I8UA 4Z3IA 2CA3A 4Q97A 3KPQA 2QQQA 3QZWG 3VRIA 3C12A 2C3XA 1AQDA 2HTLC 3GPEA 4R2GC 1JK9A 1PMYA 1K6QL 2Q9OA 4DVRL 1SDDA 4MDIA 4NHCL 2WXQA 4WUKL 3L5IA 3KR3L 1KB9J 4JKLA 4KJWC 4ZAKC 1SLWA 4I3RH 1X5LA 1BD2E 5EC2B 3D25A 3UZQB 4X6EB 1FQ9C 4W6XB 5DEJA 1D7CA 1L4IA 1X6NA 3QISA 4XHJD 4GKSA 4AY0A 2VN6A 1TF4A 3TV3H 4WI0B 4FNTA 1FCGA 1WISA 3BO8B 1RFDL 2B7DT 1FPTL 1U3JA 2JK5B 2X40A 1AZBA 2BP8B 2YPLE 2Y06L 2DDQH 2H8PB 3ME0B 4RFOL 4N0YH 1MCKA 4PIBA 4XBGB 2QLVB 1YA5A 4B9GA 2QQKL 4K3HA 4N5EC 1FZOA 2VC2H 4FNRA 1KCRL 1I3VA 2EKSA 4KV5E 5IFAL 3MRFA 5HI4C 3TIEB 2QFRA 5KBMA 4FFVD 2DKUA 4Q6KA 2BK8A 4YDZA 1G9MH 5T3XE 2B16A 1OB0A 4FQLL 4PRPB 3QDGE 1CXFA 3IKKA 3BMWA 4BH7B 1MFBH 1FHNA 3RWCB 2JXMB 4ZTPL 2LVCA 4XCFL 5KYXB 4ODVH 3VWKA 3QWQB 1OAZH 1PY4A 4FHKA 4Y4FB 3RWGB 2BLFA 2E6JA 4BDVA 3AY4C 2I60L 2YRPA 4XO8A 4Y9GA 2R4SL 5K9OB 5A16A 3ZN6A 3Q8EA 2IPKB 3BDBA 5CIPB 1VEMA 1XF1A 3BKYL 4HPYH 2VUYA 1LK2B 3NFNB 4PRPD 5L0QB 3KMDA 5I1EL 1VFOA 2YOAA 1TVDA 3Q01A 4H0GA 1F1GA 4JAMA 4KITB 1TENA 2B59A 3PLYA 2WBJD 3KPMB 3WKYA 2F6AA 3S2AA 3GPSA 1JFHA 2VXQL 4FD0A 1BYNA 4Y16D 1HHKB 5B8CA 4PJ7E 5MEOB 5L2JB 4Y4KB 4PJ8A 4YHIA 3DBXB 5EBMB 1T0MB 2CHNA 4LOUD 5TDPA 4QRRE 3W9DB 1AC0A 4XPFL 3TNMB 1E6OH 5DVKA 4J27A 2JKLA 5JLZB 2MOVA 5FGBA 4C56D 1LWHA 3HG1A 2IBGA 4DEPB 4UOW1 4GO8A 5FW6A 2ZUTA 1EEYB 2PCFA 2AXGA 1HXYA 4PJ7B 5CP7B 5H37G 1VFMA 1AR1B 3R8QA 5HHNB 4Z6AT 3EFOB 3F58H 3QXDA 1P7BA 5GRUH 2QKIB 3WN6A 1A4CA 1JUFB 4L4VA 1FV1A 1A3RL 4NC1E 3ZSSA 3VD4A 4P04A 1G7HB 4R4NC 1XF2B 3MV7A 1NEPA 2WP3T 5DVNA 3SDAB 2E9WA 4G8EA 4P0DA 4JANB 5CILH 3AG1B 1M2VB 4EN3D 1J0KA 2GJ6B 4BFIA 5IQMA 4KPHH 1SHSA 5D7LE 1WC7A 2X09A 3O8XA 4QJ3B 5F0LB 4ODUB 4GAFB 2RR3A 2GAZA 4PYGA 3RVXD 1YAIA 3G7TA 4G11A 4GUCA 4R3SB 3RB5A 2VDRB 1KTDA 1SLVA 3ILEA 4JR9L 5FUZL 4M62H 5B3JF 5DJDB 4J3OH 1YSOA 1DJWA 2OX5B 4BCXA 4AQ1A 1D9KB 2I27N 4OTXH 4WHCA 3CXDL 3PCYA 4S1RL 1P1VA 2L7QA 2P52A 4NAJA 2MOGA 4K23L 5TF1L 4KO9A 4NPYA 3W5MA 4MWFB 3K4AA 1RMFH 1R3IH 1Z9LA 1NKOA 2HFFA 3MJ8B 4ZS7L 1N6QH 2DLTA 3DV6B 1HSBA 4YDKH 3FQWA 4A2GA 5I1JH 4G6ML 4HWBL 5DS8A 4Z0XA 5LBSH 3BVXA 4IQHA 4Z9KB 3QO1B 2DYSB 3VYOA 3CZGA 2PTTB 3JV4A 4HCRA 4JFZH 4PJEA 1UJ3B 3V4VL 1HHGA 4HUXA 3HHSA 4XNMA 5L4IA 4TPRL 5D2LF 3H3PH 3F00A 2JCCF 2A38A 3MACH 5GS1C 1HZHH 2XTSA 5EU4A 2A74A 1SMOA 1SOXA 5IMKB 1ECZA 4X0NA 4AWJC 1ED3A 3KJ4B 1UEYA 3L4TA 3VXRD 5BMFH 3DJ9A 3P4OB 4KVCL 2HMIC 2UX6A 3EH3B 1C5CH 4AG4L 2QQLH 2IV9A 1NWOA 3B7YA 2LFEA 3VFGH 4LLWA 4YHYB 2HMID 2G75A 4RZKA 3T3PE 3BPNC 5C9KA 1Q9LA 3O9WC 2MIZA 3BVTA 3LPWA 3DKHA 3Q5YA 3A3YB 3RUGB 3HC0B 1HCYA 1KIUA 4ZSOA 4DPCX 4CNIB 1AXTH 3OLEA 1VHPA 3MRQA 2EUVA 2YK1L 2WP3O 2DYPA 2OL3A 2F53B 1HHIB 4ELDA 5L88H 1ACCA 2V7HB 3VXQA 2MCPL 1WHPA 1QZ1A 4O2EA 1UD5A 1J8HD 4EBQH 1HE8A 1A3LH 2Y3AA 3EBIA 4PRAA 2BNRE 3BZ4B 1YECL 4AVJA 5IBUB 1NGZA 5CFAA 2JI2A 4GO9A 4WTXA 2W0PA 3BZEB 3CFKA 5J6SA 1MAML 5AKVA 5IW1B 2Z6FA 4JKPH 1MJUL 2X0WA 5CEYB 4Q2ZB 5DI8A 4OCYH 2K3HA 3KPNA 4KY1H 1ZGLB 3V5KB 4EZJA 1IGML 3CGTA 2BSTA 2YD9A 3EJYC 1E27A 4Y8AA 4UT6H 4L8CB 4HFUL 4XE0A 5A7EA 2QQKH 4XMLL 2OYPA 4V1DD 2CLRB 1SJHA 2D8KA 1FZKA 4YLQT 1DQLL 3U46B 3S3CB 4B50A 4HZLB 4D9QD 5JIIA 4FLQA 1O7SA 1WP6A 4X7TA 5L0QC 2ZKYA 2PWDA 3WTXA 1S7RA 2RJMA 1YJDH 4ISVA 4H40A 1ASPA 3VXNA 5JHAA 1HEZB 3HMWH 4V1DE 3CPLA 2Z35B 3NGBB 1E3FA 1QUPA 4YDNA 5LQBL 5GGTH 4UIKL 2J1KA 2CRZA 4YHKL 5FC9A 1GHFL 5DJAB 4FNSA 4FNQA 5CIPH 2YA0A 4X4XA 1XF5A 3TIEA 3AS3A 4G8IB 1O7DE 2DWEA 4NC2B 2NSMA 1IC5H 4JPKH 3N40F 4U6HB 1SBSL 5ECGA 1CURA 1T3FB 2VR7A 4XXCC 2ISDA 3RWCA 4JPIA 2HKAA 4XODA 5ICXB 1M6OB 4OW6A 5EOTB 3QQXA 1CN4A 4G9FE 1FZMB 4DP2X 1FH2A 4F7PB 3MLSL 1JK9B 3BZDA 2IPTL 5B3JE 4AYDC 1ZLUH 2IPUG 1TLKA 4OZ4A 1THCA 4LB8A 5FF6A 2EVJA 3DVFA 1HCZA 4QT5B 3ZDZE 3P3TA 4M8QB 1T5WB 3FBKA 2CHZA 2D4FA 2DTML 4OLWH 2XTJB 4RMWA 3GJFB 5EEWA 4JM4H 3CQFA 5H2BA 2FX8L 2UUDH 1X7TA 4F37F 3EH1A 2A0LC 2Q20A 4PCSA 3L3DA 1E9OA 4QRPE 5HY9B 5I8OH 5KS9E 2WXNA 3UC0H 4MCYA 5CUSL 1RZQA 4MASA 4MA8L 1R19A 1U4FA 4U1GB 4PYHA 2AVGA 4XWGL 4Y7OC 3BKJL 2RA1A 2DF3A 3CC5B 5DJ6B 3PWPE 3FTGA 5DURD 4JRWA 2LU3A 3K2MC 4GKZA 4L8BB 1UWEH 3ZHKA 5A2BA 4CL7A 4GEJA 4MGXA 5IMOA 3FSVA 4B27A 2ARWA 3B4NA 3AAZB 4LDEB 2ZKHL 1WK0A 3PWPD 5IP4A 3PGCB 4JG1L 2J8UB 4KH2A 4TF4A 3CVHL 4X6DA 5GGRA 1U8QB 3AGWA 4RRPM 4FQXC 5CBAA 4K5MA 3U48A 3OSKA 1OK0A 3DA0A 4N5ED 4C4KT 4B60A 1J9TA 3L17A 1ZANH 3O3EB 1DUZB 3MV7B 1XD0A 1WAAA 3G08B 1MRFL 4KI1A 3NA9H 1NGQL 5F7EH 2DJUA 1E3XA 2VUOA 5AOMA 3RGHA 2WK2A 4BFIB 3ZGHA 4TS6A 2AK4E 3KLAB 2XQYG 2JH2A 5F9DC 5LWYH 3WMSA 3DIFB 1FNSH 3PDOA 3UAEA 4P4KA 2NT0A 2WSDA 4KTDL 3PWJB 1KTDB 3DHMA 2P1YA 4OCWL 1AGFA 1WBXA 2ICWJ 2VXUL 3U9WA 4DQOH 2HTLD 2OULB 2COQA 1LO3H 5GGSY 4OFQA 4TV3A 1RLBA 3OJDB 1REIA 3SD5A 3P3YA 4GW1A 3L54A 1WUNT 2BRRL 2W95A 2HPTA 3BAXA 5F3BB 3KL0A 3WIFB 2VLRD 2FYYA 4HAGA 1BF5A 2NYYC 1J0YA 3WXVL 4ZT1A 3IPEA 2DYPD 3ZR5A 1U2CA 2AFNA 5F7DB 1CGYA 1UFGA 2X2UA 1DHKA 1OT2A 3CVDA 4DHLA 4I4WB 5D96C 1EXUB 1E4XH 3IMRA 4MHHI 1A6TB 3QAZC 4QRRA 3R06A 3GSNB 3WKQA 4NPKA 1L0YA 1KLGA 3K6SA 2DMBA 4BFFA 4QRRD 4EPSA 4FNUA 2WUCL 4ZW6A 1ZK9A 2F1AA 3FYIB 3MOQA 3LTVA 2QTEA 3OPZL 1J9SA 4L18A 2CO3A 1PZ5B 1F41A 3MOAL 4Z7UA 1G7PA 3O6ML 5E08L 2XXMB 4XNBA 5DHVB 4DFIA 1HE7A 2IANA 2M83A 1EHNA 1JV5A 1QBML 1WZAA 2WANA 3ZJAA 2AV1A 3P9LA 1EZSA 2MCPH 2ZWZA 4UV7H 5EU7E 3F65A 3PAUA 2YOCA 2D3LA 4FQXB 4QOKB 1BVLA 3K8KA 1RPQA 5I76B 1VKXA 3NZHH 3L7FA 2Q7YA 4ZFFA 2R83A 4B53A 1T5XA 1AZUA 2WWMC 2WXLA 1IFHH 5EF3A 1V54B 2BS71 2H3KA 4QGYA 1BECA 5AW8B 4CNIA 3NJKA 3K6DA 2FIKA 3IF1B 5DK0A 4BZ1H 4GRLA 3NCWA 2HUHA 2D0GA 3KBHE 3WNIA 5L2KD 2DQIH 3QRFM 4KRNA 4XP4H 1QLEL 5J0BA 5F89A 5JHLH 3X12A 5D7IB 5F7UA 4MNGA 4NFBA 2IAAC 1T66C 3S34H 3U4AA 5FXCH 1G4MA 4JPWH 4LXFA 3O3BA 4QHMA 5DTFA 3PGFL 1S7UA 2APBA 4ADGA 1NCJA 2FH8A 3IPBA 1EFXA 5DUML 4X4YB 4GRLC 3FSWA 3BWSA 5HYJD 5I75B 1K5NB 1YO4A 2C3GA 5F9OH 3N1MC 3RTQC 3GK8L 4ABVA 3SCMA 4L3CA 2CO6B 4YUEH 4I0PA 1ADQH 3UZEC 4I0CC 4OLZH 2PXYB 5KVEE 2B0SH 5AAPA 4I0KA 4DEWA 3PNWA 3U2IA 2F7IA 3LRHA 1Q9LB 3Q8BA 4PJIE 1T4KB 2ID5A 4UOJA 3DX0A 4OGZA 3HC0A 1FAKT 5E1AA 3G04A 1JPTH 3OPUA 5DLLA 1B90A 1L9OA 3M1BA 1DQDH 1FE8L 5GS2H 5F7MC 1HHIA 4B9YA 5FYKL 1YLBB 5HJ3A 1MIEH 3HRPA 2EDTA 3DJTA 4PH8A 1FZJA 5ACLA 2NY0B 2FNBA 4PJ9A 32C2A 5C0CD 3ZDXE 3NBNA 3SDYH 1A5FH 4F2ME 3VTAA 3ULVD 3FN0L 3GI9H 3QC5X 5GRVK 3KXFD 2ZAHA 2VZOA 1QTSA 4IRSC 4LHJB 3OZ9L 2OJEA 4HYTB 1ZA6A 3FFCD 1BW8A 1EUTA 1U6AH 5IUCA 3ZE2B 5D1XC 1NIEA 1KCLA 4I1PA 3ZUCA 5C08D 2PR4H 2DTMH 3MDJA 4YDVB 1ID2A 3MGTA 3AY4A 4YSDA 2H6PB 5KSAD 1X4YA 4PGBA 3SY0A 1GGTA 4OZHA 4UB0L 2FX7L 2AJUH 4MJID 5IGXL 2ZXAA 3Q8FA 3UGUA 1JNHA 4NKMB 1U8LA 4HZLA 5EIIB 3J07A 2VR6A 1BXUA 1JYVA 3C8HA 4YPJA 4ICWA 3H9HA 5I1KH 2HKHH 1OXYA 1DO6A 3NSYA 5EEUA 4M5ZL 1RULL 3TFKD 1OW0C 2XRAL 2J1YA 3PWLA 5CCHE 3UFIA 4AEFA 2A7BA 4H88L 1UWEL 1E9OB 1KCBA 1LO5B 3FB7B 3QA3A 1EA9C 2IOOA 2VR5A 2DYRB 4PJ8C 2ZZUT 2ZOWA 4CVZA 1E42A 3GIVB 4W6WB 4X6BA 4DGWC 2PO6C 4HSAC 1MW3A 3HKZA 4IJ3C 1KTBA 4AOFA 3V4PH 4URKA 1ET8A 3CZFB 3AQXA 3BP7A 1WQVT 3TA4D 4YHOL 5DVPA 2UY7B 4Z95H 1C8QA 3VU2A 4D8PB 3VMNA 4JY6B 3Q44A 3TFBA 1RZGB 4V1DA 2J8HA 4QRTA 5FR3A 4GI8A 2ZWNA 3FH8A 1YUHB 4HMCA 1TZGH 3QULA 1NAMA 1IGFL 2CR6A 4Z7AA 4P5TB 5ID1B 3FQUA 1NIDA 3A22A 5ABZA 1JDAA 3WD5H 5IFHL 3EOAA 1EJ8A 5CR1A 1E7VA 1HINH 1YN7B 4XP6L 2MCAA 2DM7A 4P3CL 2ENQA 1PFCA 5DUPL 1KIPA 3S36H 1YEEL 3ARDD 3GSOB 2WOBA 3T6XA 2Z4QB 1HH9B 4WCYL 1WA0X 1SFDA 1IM3A 2NY0D 1DZ0A 2FJSA 3RIFF 1B0IA 3B9VA 2DM2A 2XBDA 3WNNA 4HALA 3VX1A 1UXWB 4YVUA 5J12B 3EG9A 4NQDE 4BSVB 5BS0D 4H1LA 1QRND 3DETD 1IBGL 1IC1A 1QABA 2W07A 4OZGB 4MXQD 2OPCA 1KPUB 4Q7DA 1KYDA 3WL9B 1MG3C 4QRPB 4DN3H 1AYOA 2W9DL 2XZZA 3VFMA 1JZ3A 1CXLA 2VWEE 2E9IA 4U05A 4J4PD 2R7EB 3X1BA 1DANU 5BXFA 4ZNEE 4PVNA 4RETB 3I75A 5DRXB 4X6DB 5GGRB 3TVMD 1D5IH 4X7EC 4N8VA 4OIBA 2GSGB 2Y07H 3MOAH 4B5ZA 3VD9A 4LLQB 4RFNC 3D33A 1NEUA 2G9HB 4HBQA 4RWYH 1GZPB 1HTYA 3JVFC 3KYNB 1BAWA 4QRUB 3WUWB 1N0XH 5D6CA 5L8JB 2DI7A 2DLFL 3FOMB 1JGVL 4U7SA 4D3CH 2D3VA 1GR7A 3GXPA 5K1JA 5ILTH 3DOSA 3NFSL 2X4PB 1TTUA 3L95B 2MQGA 4K2UH 4Q9QL 3RILA 4GUPB 5DA0B 2VN7A 5F7YC 3DSNB 1U8PA 1H6EA 4U1NA 4NUGH 3IRPX 1CICC 1JRHH 1INDL 4JGUA 5EULV 3EFDH 4Y1AE 4FFZL 1R3JA 1SYSA 2EIBA 1MFCH 3IAPA 4E42A 4OI8A 2GHWB 4FMFA 1Q1JL 1WGOA 3D3VE 5HPOA 5C9JB 2B1AH 3C9NB 5JO5B 4AVKA 4EKJA 2HA1A 4FXKA 1PQZA 4MTMA 3GBLA 1YDPA 5JDSB 4GLRI 2EZ0C 4AMWA 2ED8A 2ZUQB 4GAGL 3EJQA 3NDYE 2MCG1 3D5OF 4A7TA 3EXLA 1I9EA 1TLMA 1FN4A 4FYSA 1I9IH 2H45A 2FHFA 2AK1L 2BXYA 1LDPH 4CSZA 1QHPA 2DBJA 4RZCA 2DWDB 1JHTB 4HIEA 1C7TA 2IG2L 1CGVA 4GMSH 4NAQA 4X99B 3RVVD 4X5RA 3PQYB 1PZ5A 1MCFA 1INEH 5SX4H 2EILB 2W38A 1L9NA 3TA3C 4EIUA 3ZMRA 3SYQA 3ZZ1A 5C70A 2ZOLA 4XMWA 1S7WB 1IM9D 1NJ9B 5GQBA 1T1WB 5GS3A 1I75A 1A6ZB 3UTZB 3PNWB 4HH8A 2AKRA 5KBNC 2A6IB 1DVFA 3ML8A 1K72A 3HKFA 4BA8A 3F7KA 4NRYB 4Q0XL 3PABA 4TQPA 2VLRB 3I02B 2JJSA 4GG8A 5E5MA 1UD3A 1UZ8B 3JTSB 4Y4HC 5CJBA 5M7QA 5GZOC 4MNQE 4CN4A 1KGWA 4PJXB 1S8DA 1UH2A 4W6YB 1ZTXH 4NFDA 4OZIE 2OZ4H 2EE0A 1QUNB 3UAAA 2SEBA 3CFMA 1U8CB 5F1OB 2Y1ZA 1NAML 2NQCA 2PWEA 3QDHA 5SWSA 4GH7B 3L4WA 4J6IA 5F8RC 5DJZA 5IGXH 4LDCA 1S7TB 1KCVH 4XCYA 3UYPA 5I66B 3MX0B 1CFSA 1OGTB 4DKEL 1XTMA 5CD3B 4X50A 3TYGH 1WUZA 4KI5F 4X7SH 4MNHB 4UTBH 2VZ1A 3SE3A 4EVNA 1IBZA 1KJ3L 5G4MA 1MRCL 2OK0H 2AJYL 1S9XB 3L16A 5SWQA 4DP7X 4FA6A 4UQCA 3VQ2C 1OGPA 5A3ID 5CJXC 2OR9L 2MMXA 3TEYA 4LLMB 4QXTA 3F2LA 3OKEB 1YEKL 3CFTA 1NCDL 2BP3A 5FM4A 1DQQA 2FWUA 3ENEA 2BNRD 5IVOA 1MFEL 4KO6A 3O6KH 2UZYB 4OZIA 1MCEA 1XL6A 2ENJA 5A2CA 4DUWA 4NRXA 2Z7ZA 1MI5B 1ZVHA 4QXWA 2BHFA 1PYWB 5GJTL 4PRDB 3U7YL 4B9JA 4YHOH 4MB4A 4Q52A 4BGLA 4GMTL 3ZDWA 4A7VA 2AV7A 5HHOB 4U1KB 3NJGA 4P2OA 3GO1H 4LEEA 4BZYA 1FRGL 3MLYL 2CKBA 3QFDB 3TA3B 3MN8A 4F9LC 1OWRM 4LPWA 2E47A 3MRFB 4RGNC 1LMKA 1TJIL 2EE3A 4HVBA 2F0CA 3LKPA 5BJTB 2O4EA 1NBVL 1TCRB 2ZUQC 5CN3A 2G3NA 2GTWA 3ZYOA 2J20A 2ZX7A 4S2SA 1ILUA 3ATFA 1DBAH 3D4GA 1AXSA 2VDOH 1CUOA 1CZ8H 3LXAA 3PGDA 3BSZL 4K9JA 2Q8BH 4JKMA 4ZTOL 3V6OE 1LNUA 3VI4B 1HYRC 4PGBB 4L1LA 5E2UH 4YEFA 1SPDA 4UIMA 4Z8FL 1CG9A 1NAMB 2AGJL 2QDWA 3QNZB 4BFEA 5B3NA 1L5GB 2XU9A 1LO2H 4A55A 1AGCB 1D6EA 3OKLA 5I2IA 2CGRL 5I82A 1ZIBA 2EYRA 3H9HB 4BFRA 4X80H 2EECA 2P26A 4JHZA 1WFIA 3Q9QA 4BHUA 3RLSA 3HIZA 3MJ9A 4PJ5E 3OMNB 2R23A 2VLMD 5GRYA 3IGAA 3JXAA 5HDBF 3LZFL 2Z31D 4X2UA 2BC4B 1RK0B 2BSSA 2H6UA 4L3EB 3EIFA 3BCDA 4AC4A 1ROWA 5KVGH 3LHPL 5C92A 3JYBA 3NIDF 5AD0B 4A1RA 1AKPA 3QA3B 1XCXA 4CU8A 1A64A 3CHPA 3AREB 5KJRL 3O0RH 1IC0A 4LPXA 3KLKA 4Z7QF 3Q2LA 3SGDH 1T1ZB 3MLWL 3N44F 1JOIA 5E5UB 1RZIB 3IMWA 3BP7B 4EI5D 7FABH 3D39A 2FL5B 4WFGE 4LNRB 4YBLC 2Y06H 4Y2DA 5BVPL 3LKNB 4F2MA 4JFWA 3CBRA 2C1PA 4ZMPA 5EORL 4ZFOA 2AK4D 3IJ7A 2UZXB 5AKSA 2KZBA 5IFAH 5ILTL 3QUMB 1Q72L 4HJIA 5JW3H 3A23A 3Q7JA 3OGCA 4MCMA 2X2YA 2B9AA 2WW8A 3G6DH 4LLQA 4XNDA 1OAYH 3MRCA 3EFOA 3H9ZA 3QXDB 1C1EH 4JBSA 4M7LT 5T5FH 4PIRF 5IB3B 5EU6A 1W80A 3MLUL 2WMPA 3ASWA 4MS8D 4I18A 3BLBA 5F7AA 5LGHL 5I0VA 4P46B 3BSHA 4NQEE 1NM9A 4J8RA 1XIWC 1R4XA 3KJ6H 2VQ1B 3SDXA 1Q1JH 4NO0A 3RIKA 2HT4D 4PUBH 1J87A 4JO3H 3OAZK 4CDHA 1N12A 2XKNB 1IL1B 4FFYL 2MPVA 4UF7C 3FT9A 3UGEA 3NCBB 4GAGH 5TE4H 4FDWA 2YMXH 4F58L 2AJVL 1MQKH 1J18A 3LIUA 3QCUH 1I8MA 1D9KA 2BNUB 4ZK8A 3ZBMA 5AG9A 1NLDL 4QKTA 2X9YA 3S88L 1DN0A 2KHAA 1BZ9A 1RD6A 5A3IC 5FW7A 1LTXA 2QSVA 4G9FA 2BWIA 4FFTA 1PY9A 2YKKA 2F54A 1BJ1H 3Q6GL 4MQXD 1JFQH 3I50L 4ORZC 1Q38A 4RFOH 4Z7WA 5CGYC 2R56L 4DZ8A 1UASA 3B2VH 3KYNA 2VKXA 2EYSB 3H6AA 3P0YH 3KWWA 4JLRB 1CFQA 3NJNA 2KKQA 4NKDA 3C09C 3ZE1B 4D0CB 2C26A 2GCYA 1OTTD 2GSMB 2QPDB 4EDWL 3ULAB 3S2CA 4N2CA 2BW4A 4ORGA 5DHYB 3D07A 1WIPA 1USZA 1MFBL 3N3EA 4ZRGA 2ICCA 3F58L 3LNHA 4UBDD 4CJ1A 3BVNB 5CN2A 1KB3A 4JVWA 4Q9BA 1ACXA 2VB5A 5DZ9A 1A3RH 3FU0A 4F8OA 4BH8B 1KYUA 2YR3A 3TO4C 2OL3L 4JE0A 2VITB 1MCSA 1X5GA 3QQ3B 5FPIA 2C9PA 5I71C 2YWZA 1JF5A 3HI1A 1P4LB 5IVNA 1I1AD 2LTQB 4LVNC 4OFYD 1MREH 2XG4B 3HI6L 4A37A 4OIFA 3HJ0A 1LDSA 4S11A 1CD1B 4PY7A 3OQRA 5T33H 2XVLA 4JZJC 3C8KA 3HZ3A 4PB0L 3EYFA 3QUXD 3ARFA 2X70A 4WI3A 5GISL 4Q14A 3TX4A 4LOFA 3T0WA 4PJDB 2E4TA 5CGBA 3GZOA 4XH2A 4PRHE 5FGCE 3TN0A 4LRIA 5D7EA 2FIRT 3VXUA 2WVVA 2QHRL 3G5XB 1CFSB 5D2NC 5E99H 3UACA 2WZPA 1NFAA 5CD3A 4PJBA 4GIOA 1PDKB 5JW5B 3ARQA 4KTGA 2DQCL 1A1OA 5LBSL 1AR1D 4JFEA 3U7YH 2QL1A 1ROCA 3ARRA 4EN3B 3WY4A 3ZTDC 5JW4M 4HJJL 2FO4A 2A73B 2QTVA 1NPJA 3V4VH 5BVJB 3RZCA 3GO1L 4D94A 1QSFA 5T1LA 2XBTA 3X11B 3ZRCC 5I1DA 4A7GA 1ZE3H 4ODXA 4L9LA 5BQ7A 1GW6A 3L3KB 5EEYA 1CICD 2NY5H 3ECBA 3VFPA 3OJMB 1EBAA 4ZODA 1MZYA 4AJYV 1W9XA 2R59A 3O2DL 3IDJB 3MRRA 4K73A 4W4OA 4XWOD 5D7LB 5I5MA 3PABB 1TEFA 5I5RA 4HKZA 3F84A 3UYRL 4W70A 1L3NA 3K2KA 1HOEA 4L3FA 2CR3A 5JNYB 4JPQA 5CFHA 1MUJB 4P9ML 1O6TA 1PS3A 1A7NH 4APQC 4E41B 4RFEB 1MY7A 4IHOB 3MLTB 2O26U 4RIRA 2CSPA 3LNEA 5E2UL 1EZVY 2EIZA 1CFMA 1AHWB 3K8MA 4R4BA 4A66A 1A4JA 1YQVL 2VDNB 1LWJA 2H2PC 1AGEA 4H8UA 4XCNA 4M62L 4KQ0A 2P8MB 4YDJA 2YSSA 4AMKL 2QLYA 2XIDA 2VCOA 4DWHA 4V2BA 2TRYA 3KYKH 3T3PB 2IH1B 1XGPB 5DK2B 4Q6IB 5DC4B 3DX7A 4X83A 4JY4A 1BD2D 4FQJH 4M00A 3EYVB 2AEQH 1KTRL 3ES6A 2HG5A 1OF2B 3DX9A 2QJDA 1RP9A 3LN4A 4I0PC 3QYCA 3IJSA 2VE6A 2PF6A 4G6MH 5DD3H 3WN5C 4JKPL 3IDNA 4FQ2L 4K71B 2V17H 3HC3H 4GNKB 4NCC2 2VSMB 2D7NA 3LOWA 4XB8A 4UMGA 1JK8B 1BFVH 2O5ZL 3MV11 4IOSD 1IAKB 1M56B 4F5CE 3GHEL 3MBEC 4U1KA 4DN4L 1P4UA 2QFPA 3G5VB 1M4KA 3CIAA 3MRBA 2A3TA 4JN1L 2NNCA 1UATA 4S0HA 2Q5BA 4LASL 1FGNH 1P7QD 3ESPA 3SODB 1A0QH 2QR0A 3ZKMD 4AG4H 5D4QA 3CX2A 1WA2X 2LW3A 3VI4F 3SGJA 1INQB 3FTGB 2HX8A 1CTNA 4KQ4L 3OSVA 3BP5B 5EZOL 1HWHB 2P9RA 1XR9A 3MBEA 3D6GA 3QZBA 3QPKA 4WW1A 4H5SA 4R8WL 4YO0B 1MFMA 3ARUA 3MNDA 3EYSH 3TF4A 3A6CH 4FZ8L 4GB9A 4RSVA 4G8AC 4HIJA 3ROLA 3GTNA 3FT1A 1J11A 5DUBA 5IQLA 1FI8C 3KW7A 4GOSA 5I2IB 4AZUA 1ZGLM 4YZWA 3P2BA 3LS4H 3ULUF 4UI2A 2K8QA 3L5JA 2YMXL 3RUGF 1AKJB 3GMOA 3HG2A 2AQSA 4XRCA 3UP1A 5LN4A 1NLDH 1XO8A 2IF7A 1YECH 3BSGA 2FSDA 3L81A 3MLSH 4MJIA 4NERA 3SO5A 3ZZSA 5DZVA 2OMVA 3K71A 1OAJA 3B7UX 2NY1B 4RNRB 5T3XD 5ADPH 5AAWA 1AOZA 1L0QA 1SJEA 2RCSL 4NWTL 5INDA 2Y25A 4QRFA 3T2NH 3QG6B 4HUWB 4OF5A 4HIHB 1FO0A 5JXAL 4NZJA 1OPOA 5K9OA 3PWJA 3NPZB 2MHAB 1KJ2L 3AABA 4LSQH 2X6MA 2VXSL 4AXWB 5F0MB 4OGXH 4FE9A 4UMSA 2XNAB 2ARJB 1S7XA 1J12A 2EO1A 4JHWL 2V2TA 1O0VA 1XGTA 1ASOA 1MFUA 4MAYD 2CCWA 4O4YH 4EDWH 2XZQL 2IIJA 5I9QC 2FYYB 1J0IA 2PNDA 3B56A 1P4IL 1YMHA 3KPSD 3O8XC 1CI5A 2AVFA 3NN8B 4PG2A 1AE6H 1J5DA 3F7RA 4M1GL 5EDSA 4A68A 5IVZB 5L7XH 5EBMA 3CHRA 1CDJA 2YARA 3IJ8A 2J44A 4TSCL 3ULVC 4Y5XA 5FGBC 1QSZA 4O02A 5IEHB 3QFJB 2ENSA 3L3IB 4JB9L 2Y5TA 3D52A 4JVPA 5DJ8B 4J2QA 4QCIA 1IC5L 3RTLA 2A99A 4R7DB 1QEWA 5CKAA 1EO5A 1UXSB 4FTVD 5AOLA 5MP6H 3UTTA 2XETA 1XWVA 2HFEB 3GTVA 2DD8H 2BCKA 4OD2A 4Y1AB 4M6OH 2FJUB 4LSTL 7CGTA 1E8ZA 2EDWA 2X9WA 2VLJE 4QGTA 3VA6A 1U0QA 4F7EA 1DVFC 2KZKA 2WQSA 3BHBB 4PRID 4WNJA 4HAFA 3HB3C 1JPEA 2C7UB 3JWOL 4XOAA 5G55A 5MENA 5FYKU 4AYMC 3O3AA 1GPOL 2RBLA 2YEQA 1FNSL 4A6YA 5C08E 4PG9B 1BBJB 1D5ZB 4P2QA 5EBLA 3RGVD 4QHKI 4OUOA 1NKRA 4HJSA 3SOTA 1Y6MR 2I26N 3BAIA 4DZ8B 2AEOA 3Q1EA 4E0RA 2E8YA 5KVFH 4HZ1A 4R96A 1UWGL 2FE0A 1CFNB 1T66D 1U3NA 4YSPA 1PZUB 3PWPB 4KK8C 1OL0A 2FBRA 4NPJA 4PCTA 3WLBB 4G8GA 4J4PC 5AW4B 1GKEA 4AYFB 4NBZB 2A4CA 1KGJA 2PXYC 2KPNA 1E40A 1RUKH 3DXAB 5IB5B 1YN6A 2EVHA 2NY5L 2UWEE 3RWIA 4WI8A 4WWKC 1X5AA 2XWZA 3QJOA 1S7UB 3WHE0 2JKIS 5I6NA 1PX4A 3WDIA 3K2UH 3IFPB 1IE5A 1IZKA 4KK5D 4K3EH 3U7WL 2TAAA 3GIZH 4MMZB 1W0YT 2G30A 3P11L 5FYJE 2D7QA 2WTRA 1CE1L 2UY6A 4Z7VB 5F0PB 2CZNA 3VFTA 4YSTA 4JO4H 4LHUA 3ELQA 5AW2B 3FO9B 2BNQA 4ANKA 4Z7OE 2C4XA 1ET5A 3OQ3B 4KMQA 2ATPA 3H56A 1HHGB 1I8LA 4HUXB 4G82A 4PCYA 2QBWA 2CG9X 4XN9A 1ETZB 4LEXL 2VLJB 1AZZC 2IAMC 4I3GA 2OCFD 5IVXF 1N59B 1JV2B 3QHFH 3MRKA 2XDHA 3RKDC 2FQEA 4M5YH 3V0WH 1MRFH 4XXWC 3NT0A 3I3DA 4NO3B 1RIUH 1Q90A 2ZCKL 1YEHH 2MQ3A 2XV0A 3IGLA 4IHOA 3VDAA 2OMNA 4DPAX 1A65A 3GM8A 1PG7W 3JYCA 1U2YA 1XQ4A 4G43B 1MRDL 2NY2C 1GYVA 3VXUB 3ASNB 4TRPH 5KEZA 4UT9A 4PRBB 5DMYA 3AG2B 2B4CH 4U1JA 4XNUL 2YD7A 1AI1H 4JHAL 5IROD 4LCYA 3ARWA 3SQRA 5E94A 4EN3A 1NFDF 1QLEH 3QSKB 4PRIB 4WDIB 5ACZA 1EFQA 3O2WH 4L4VD 2PYFB 5AZUA 5D7JA 5IK3B 5F9WB 4AYEC 3IDXL 1Z9MA 4HIXH 3BN9C 3MBED 4QRBA 3WXVH 1FO0L 4F27A 1KPRB 5D9SB 5KYWB 1O7DC 4YFEA 2DMCA 5C0EA 3KDMB 4ZFGL 1FC1A 3V6ZA 5LDUA 3AXLB 2WSKA 4LPTA 3FO0H 3IU3A 4R4FH 1OARH 1XGZA 2WBXA 2Z65C 3TPKA 3U2SB 2XKUA 4BUHA 4F93B 3CZLA 4H26A 1E27B 3RIAF 2PP7A 4FS0A 3WNKA 4XXDB 1F13A 3BT2H 3O6MH 4Y2OB 1SJHB 1VZHA 4WJKB 1YEFH 4NQSA 5TE6L 2JE8A 3AU1A 1QG3A 2H26A 4HXBL 1GS8A 4QY8B 4UQDA 5T1KB 3PXJA 2FHCA 4ENED 4BH7A 3QJUB 2WINB 4O02L 1MCRA 4KUCD 3ZSTA 1L7TH 4PRHA 3NMEA 4JY6A 2DBLL 1FL5B 2OMTB 3V79C 2ZOUA 3CE1A 4HK0B 2EC9U 4KZCA 3AQYA 5EDXA 3K72B 4KX8A 3RI5F 3PL6D 3SDYL 5J11C 4YL9A 3EBAA 4RFNB 3ZE0B 1YNLL 1DVZA 3LMJL 3WSQL 2WN2A 2ZF8A 4JDZA 1CXKA 4K07A 1U8IB 2F61A 2IQAA 5DHEA 3RX9A 4WI7A 3VJ6A 3VM5A 3TEWA 1A2YB 4V11A 1NCAL 5I8KL 2NNXA 3L1GA 5JHLL 4Q6YA 3ULUL 1ZV9A 3PHOB 1BG9A 1I3RB 2DWXA 4KZDL 3QBTB 4CILA 4NEHB 1F0LA 1OZTG 4K3JL 3T0AA 5JPNB 1WD9A 2ITCA 1MEXH 5E0QA 2YPLB 2NZ9C 3ELAT 1XHHA 3EJPA 4W9LC 4WEBL 5E03A 2CMRL 5F6IC 2X2IA 5L2JA 2FGZA 1GZQB 5F9OL 2HKHL 3DDGA 3KZ8A 4N1HB 2MHAA 4ZOCA 4QXVA 4DK3A 4ETYA 4M1GH 1SQ2N 5E8OB 4WW2B 1PG7X 1PY0A 1MH5A 2HRPH 2YD1A 2ARJA 3V9FA 3WKNA 1JZ8A 4M48H 5CJOL 3BW9A 4IRJA 4QJ5B 1B0GA 4MBRA 2VJ0A 5JHDB 1OPGH 1E4KA 2YAQA 3D06A 5I1AB 5LGJB 4QXUH 4KVNH 4KRPD 4WNSA 2CGZA 3T8VA 4B9KC 1MHEA 1GZHA 1U3ZA 1OV8A 1IQDB 2GSGA 1LP9A 1R5VB 4QAWA 5DRZA 5B1BB 2HLFC 5F7BA 1G7MA 2KQNA 4I5BA 2ROXA 3V6OA 1FV1B 2F5BH 1WTGT 4QYAA 2EDKA 3S35X 1BPVA 4G80B 4PJBF 2QGEA 3CSYA 3GI9L 1TTRA 3QNXB 1RUAH 3A0OA 4JANA 4X98B 5AG8A 1N6VA 2ZONA 3VO0A 4JG0L 1N0LB 5DYOA 4EDXB 5EWIL 4OI7A 2CBPA 1M7DA 4LF3B 3V5DA 1RH8A 2VDQL 4W9CC 1T89A 5CEZE 4OGYH 3BH8B 3TGXA 2A83A 2HLAB 2IH3A 4UTBA 3QCVH 2C9RA 4NN6C 3K1KC 3D12B 5E6SB 3HE7D 2C9SA 1I4FB 4D9LH 1H0DA 1WRFA 2OX5A 1XZWA 5EUOF 1N10A 3AWFA 1IBBA 5ITBL 1JGDB 1BGXH 3L4XA 1Z9PA 1I82A 2CUIA 5L6YH 5F88A 4G8FB 4FF9A 3LN9A 1LO4L 4KXCA 5MEND 1BD2B 5I17A 1F4XL 2G60L 2X1WL 3F8UB 4MXWL 5G4NA 3UZEA 4IBUA 4I88A 4TVSa 1YDPB 4LU5H 4ZW8A 2VXTH 1WA1X 3C5SB 1D5ZA 2AMUA 1A6AB 1MFDL 3CZUB 3QO1A 5DT1L 1LWRA 4DN3L 3ILQD 4YHNB 3GBNH 3S98A 1AZVA 5DQ9B 3QFJA 1Y6KR 3E8UH 3BP6A 3LVTA 3HR5B 3OF6A 2FQGA 3S48A 4UOZA 2I07A 1TYJA 4QCIB 2BWDA 1TOXA 1T04A 4JO8A 2PTUA 1OE2A 5E8NA 3DRQB 1QRNE 4OLXH 1SXZA 3DURB 1UXSA 3DO7A 4F80A 1DLFL 4QTIL 4ZPVB 5KUMA 4EUPB 3FQNA 4CA4A 4AEIH 4HEME 5J9PA 4HPOH 3LS5H 2I85A 3MC0A 2ZOLB 1R3LB 4HAKA 4U1SA 2N01B 4WO4C 4Q9RH 2UY6B 3GMLB 4NN5C 3KPSE 4LLDA 1O6VA 3MREA 3W39B 1YEHL 2KYIA 2ESVB 3QI9B 4NUJA 2Y3NA 1K5WA 2WBJB 4KOBA 2TRHA 1BAFH 1A1MA 3VI3E 4PBWD 4G1EB 4YNYB 4MS8C 5LBVA 4WGVB 3M46A 1QBAA 2WXRA 1IFRA 1SVBA 1RUQL 3S36L 4WVRA 5AVTB 4AK1A 5C0RL 4G9DB 3OL2A 4Z7UB 3TBBA 4N0UE 1KEML 1DJHA 3KBFA 1BMWA 5IV2A 4PTTA 4R96B 4OV5B 2P7TA 3WN5B 3U2JA 2FQDA 2BINA 1MLCA 3H9SB 3PUCA 3W82A 3NGBC 1ES0B 4O2FA 1C16B 1NGZB 1IAIL 1FO0H 1TFHA 4PJAE 4BK5A 1CIDA 3IETB 3EO0A 4ZFGH 5E6YA 3A4DA 2FEJA 2FIKB 1Z6JT 1CGTA 1TJGH 4OCXH 4OLYH 2KDYA 2EINB 1H3VA 4NZFA 4OZGF 2FD6L 1UOKA 2K6WA 3LKQA 1A6VH 3DROB 5AL0A 3TEXA 2IH8A 1M7IB 2UZIH 3VRJB 4DESA 1ZJAA 4JZNA 3WV0A 2A0LD 5FO7A 4BXVA 2YGOA 3MRDB 1KPVA 1TEYA 2MKLC 4FXTA 4KFMA 2VLJA 3RVXC 3F3HA 4HXBH 4F37K 1VADB 4LP8A 1JZFA 1RQ5A 4KK9C 5LG6A 1DVXA 4D3CL 1GOGA 2X4RB 3WJJC 1KWKA 2W60B 5IKCB 1WSST 3HC2A 5C7ZA 5FYJH 1R46A 3I6GB 2GC4C 2Z31A 4U6XA 3DUSB 1YNTF 2YPLD 4RAVB 3T9WA 1ZIAA 4DFHA 3SGJC 3MR9A 1DQIA 2H32H 3LMJH 1I3UA 3WSQH 5IMMB 3K6NA 4U1LA 4DZBB 2X05A 3VWJB 2YEZB 3TO2A 1OAKL 3W2DH 2B1HH 4TLUA 4PJ9C 4WKZB 3ZL2A 1BQ5A 3PRZA 1OLZA 3HZYA 2A9NH 4ODSL 4Z5RB 1KACB 4A2EA 2ZUUA 2ZXEB 1BZOA 3GMRB 3IPFA 1KENL 5CU9A 1FFOB 2CMRH 4PJDE 2ZP0T 2AP2A 3KYOA 4RSYA 1S9WB 5D9SA 5KYUA 4PGEA 2PP8A 4JFFB 2IQAB 1ACYH 1MW2A 1H8OA 2IBZX 4NJ9L 1O9WA 5I26A 3TO4B 5T1KD 4U1IA 5FGSA 3UEQA 4FL4C 3RWDA 4JO1H 3TASA 4QAMB 3VD2A 4RCAA 3DMMA 1NKGA 1TZIB 1YPZF 4KKAC 1RK1B 1YEKH 1XEUA 1QSEA 5TQ0L 5EN2B 1CLCA 1INEL 1RJLB 4HS6A 4MJIE 2YPVA 1DEEA 1UOVA 2EP6A 3D51A 4AVIA 1A7PH 5T1JA 5T5FA 3NZ8B 4DCQA 4HKBA 3CC5A 5DJ6A 2GJPA 4JM2F 3KGTA 4OD1H 4UNTA 5I0ZA 4J3OF 4ZD3L 4AJWA 4PBXA 1BM3L 2JTDA 3LKNA 2W5PA 1FRGH 2GITA 2D9QB 1FLRL 2PR9A 2LLGA 2PW1A 2E7BA 2UZXA 2ADJB 1CQYA 2IDUA 4JVUA 3KCWA 1TJIH 2PO6A 1UWXH 4OGQC 1U8QA 2BOBB 4PD4J 3V4VB 4P2QE 1TKWA 4HBCL 4HJGB 3MRCB 3QG7H 2EDBA 2EIDA 3WGUB 1WT5A 1EJ6A 3SE6A 3OR6A 4NQCA 1E9PB 4CSTA 2V8LA 1A2YA 3X3GH 3ARED 4EF3A 1KZYA 1T7VA 1QI5A 4LVEA 4BFKA 3QNXA 4XB7A 2VLKB 4BRVA 2OJZH 4DKEH 5CF3A 2IDSA 3TYGL 3RPKA 3TFKC 4EDXA 1B4RA 5IFJA 3CDCA 2G60H 4MXWH 3M17B 1HJBC 1XAUA 4E9TA 4C47A 3H2QA 2OTPA 5EBGA 2C9UA 1AXIB 3FBQA 1KIQA 1OD9A 3X13A 2DI9A 5C3LD 3MCYA 1RZ8A 4MBOA 2VISA 5HHVH 3THML 3AB0C 3B2MA 2Q8AL 3CDYA 1B0GB 1XF3A 2X0UA 2DRUA 2Z4QA 1ZD6A 4BE6A 2QT6A 5ICYA 2Q87A 2BSRA 4MYPA 3MLWH 1MWAH 3UPRA 4GAJL 5KVGE 3MRJB 1I7TB 1K4DA 2HJLB 5LNGA 3MJ7B 1WZMA 3VFNA 5D7IF 4ZNEA 3IKCB 2VLJD 4XN4A 5KSBF 3NIFE 4IRSD 3EG9B 5I1GH 1KDIA 4M5SA 1I1RA 4XT1C 5I16A 1HFUA 5ISZA 2CNZA 4JM2B 3DLQR 3STZB 1BIHA 3GSNA 3DPDA 2JIXB 3P9MB 4S10A 3U6RA 2R69H 3Q3GA 1U8NA 1RZPA 1K9TA 4YHPA 3EOBA 1CVSC 5FCUL 2VH5L 4KVPA 1IBHA 4WRLA 2HT2C 3ARXA 2X4UB 4HU8A 3CN4A 4LPCA 3C2AH 1CFTA 5C0RH 3O45B 5HP5A 4I48A 3X1GA 5I6KA 1LP9E 1T83A 3QDAA 5BRZB 3GMLA 2BW5A 5TJWK 4QHNB 2DQHH 1TQWA 2VSKB 3MTRA 5ESVA 3SDXF 3QUZB 1SRDA 4L5FH 4ZUVB 4ZO8A 1IIIA 4ZFFB 1LEGA 3BYTA 4PR5A 5TH2B 4PGDA 4B41A 5K1NA 2D73A 1U8KB 3QWOB 4JY5H 2L8AA 3O6FC 4RGMC 1IAOA 1L6ZA 4WEEA 4HWBA 4DW2H 1RZ7L 2FSEA 2FJFA 4MD5B 3DWTA 3LZFH 5IB1A 2AJVH 5I74C 3Q2NA 5IW6A 2GBTA 2EEDA 3QCUL 5IV2B 4PG2C 1UM4L 1VFBB 1NC4D 3ZKNC 5EPMA 1OGAA 1JBJA 4AQ1B 3PXLA 1IEAA 3TWCL 1AP2A 2VQTA 1H5BA 5HJDA 3VE0A 1M7XA 3NCFB 2E46A 4NKIL 2XN9A 4U3HA 5A1AA 3NZSA 4G72B 4WU5A 2AQ1A 2XN1A 2R0WH 3L8QA 1YNTB 4ZG1A 3DURA 2B77A 2GVYA 2B5IC 1T6VN 4NQVB 1VACA 4NLAA 5CD5D 3H4HA 4GSXA 2E6QA 2VT0A 2N7AA 2F54E 1WAPA 1GYWA 3HZMA 3IDUA 3B7RL 4PV9A 4HS8L 3GXDA 5AQ0A 1QSFB 5T1LB 3WIHH 1E4WH 4TUJA 4KKCC 4KJYB 1HXMB 4DP4X 1UJ3A 1WGVA 2WGXA 1E9QA 3G6DL 5AB0A 2CD0A 4KI5D 4HWZB 4MAYB 3GUTA 4YNYA 4HIEB 5KJ7E 3QJVB 2A6DB 1UGNA 4NOBA 1ORSB 2WXJA 4HF5L 4NUQA 3VMOA 2GJZA 3TYFB 2VDLH 3BGFB 2YQGA 4JRLA 3KJ6L 3BC9A 5IR1B 1R0AH 1H6FA 3U9UA 2OXGB 3QQDA 4Z7IA 1Q0XH 2DQFB 3KL3A 4HHWA 5SWZB 2K4AA 1T1WA 4XPBL 3CZKA 4AM0Q 7PCYA 4JRXE 1QFPA 5DQDH 3L5WB 5JDJA 3HMXL 3I6LD 1FAIL 2J4WH 4RGNB 5HPMB 1JP5A 5DWPA 3TO2B 2AJZA 1X5HA 4RWHA 1FNGB 3S88H 4KZEH 4F9PA 2IVFC 3L4YA 3SJVE 1FYTD 1K2DB 2FUTA 4TL5A 1VPOL 1PZCA 2FO8A 3CG8A 3ZYZA 2ZCLH 4QIRA 4ANUA 3M1OA 3F6JA 2J57A 2Y7SA 3HS8A 3F7VA 1JSYA 1S9VB 4H8WC 3KYOB 3VXSE 4AGOA 3FTVA 1TJMA 3V5HA 1MPAH 4WJ5B 2Y0SA 3DPBA 3QIUC 1FFPB 2FQFA 3C5ZA 2ZUYA 3E2HC 3DUUA 3OG6B 4NQQA 1BMGA 4YGAB 2F19H 4KDVA 4ZFZB 1L6PA 1QFWL 3HHMA 4KXBA 1F2QA 4LSRH 3A67L 3WY3A 2JMRA 3B2PA 4YSQA 3BMVA 1RK1A 2DWSA 2YJQA 1CLYH 3S8WA 3BAYA 4JFYA 5GSVA 3HRZC 3GF8A 4HOWA 4IEFB 1CTMA 3V7AG 1DQQB 4OM1H 1KC5L 4PV8B 1KJVB 2Q86B 1KCWA 4P2OC 5IQ7L 4TLSA 1N3NA 1WV7T 5KYXA 3TBWA 4TOYL 2ITFA 3T1FA 4BDVB 4BRJA 1LO0H 4MA3A 4F7MB 1PKQE 2ZUVA 3MNZA 3V10A 4G3YL 4PI0A 3EOAB 3HI5L 4JQVC 2Q10A 3GLEA 5BZXA 4D8OA 5J1TC 5JW4N 3LKPB 4DQAA 2DWEB 1BFOA 3KHQA 3NFNA 4GSRA 3CFJA 1LL1A 4LO9A 3KXFA 5G4OA 1KN4L 1IJNA 3HUJE 3GSOA 4WY7L 5C0GA 3VH8G 2E7LA 2AEQL 3PL6A 5C6PB 4JCMA 4LCWE 5IHZB 4AGNA 2YGPA 3FRPB 3QDMB 5C0BE 5E8DL 1E5AA 1QNZH 1E5CA 4L9DA 3UJJL 43CAA 1ITCA 1MELA 2V3FA 5TD4A 3AU0A 2BZ7A 4H1LB 2P3YA 5CLYA 1LP9F 1DE4A 1FVDA 5F72S 1KGCE 3HC4L 4G59C 4EMZA 1VFAB 5KAQF 5F6HI 4XVSL 4KC3B 5GHWL 4UU9B 2F7PA 4EIGB 2WB7A 3ZXAC 5D70H 3FSAA 2X5PA 2XT1B 3G6JB 3N5AA 4XCCH 3RWFA 1T0NB 4GAAA 4BFOA 3KPOA 3LH8A 4W9EC 1A3QA 1DFBH 5DR5L 3FRUA 3VG9C 4CVUA 1R17A 1M6UA 1K4DB 4ESKA 2YD3A 3FU7A 3QIBD 4HJGA 2X6VA 3SDDB 1DBJH 5C0IA 2OMZA 3DHUA 1WD8A 1M1XA 3Q2VA 3FAXA 3NIFF 4NQCB 2WLLA 4Z3HA 5HYQB 3PUUA 3VW3L 3KPLA 1GC1L 1CICB 4K9EC 4RA0C 3T77A 1I1CA 3CK0H 4PP2A 4CJ0A 2R9HD 3DI2B 4F2MB 3RX7A 2ZXDA 4AMKH 3B43A 3VFRA 4MMZC 4Y5YA 3IFLH 1BVOA 5DD1H 3OKMB 2BIMA 4FQJL 1YPZB 2EDYA 3FTSA 1I8KB 5CLZA 5JHDE 4NNPH 3RWHB 4JX0A 5E9DE 1MFNA 3VXRE 4JGNA 25C8L 1X9RA 5IB3A 4FOMA 1R3JB 1SYSB 4WUKH 3WE1A 1G7QA 2J88H 2R2BA 3EJYD 3U36A 1D5BA 3NUKA 1WFMA 3BYYA 4JQXC 4AX3A 4ZO9A 1V3KA 1TETH 1E4KC 5EU6E 5C08B 1EBPA 4M6AA 1W0VB 1FVCB 1GIGH 5PCYA 3RNQB 1DCEA 1SOKA 3SE4C 3QCTL 4GQZA 3ZKQD 1D9KC 4DN4H 1TVHB 5DD5H 4WGWB 1KG0B 4GXVH 2WQUA 1JZ7A 1CCZA 3P69A 5D1ZB 2WYTA 3S37H 5FIEA 3U6RB 1RJYB 2DWDA 4H1LG 2GQHA 3DXAA 3WE6A 5IB5A 1P5VB 3ZX1A 3V7MA 2EE2A 1A9EB 1WZKA 3D48R 1JAEA 3W0WB 3NEOA 1Q94B 1SJMA 5E0FA 3SE4A 2HN7B 5ISZD 3OR7A 5D2NB 1NC2A 4QO1A 4HF5H 1EAOA 1OAUL 3PAZA 1AQKL 1IAIM 4PTUA 1XGUB 2V2XB 3HZMB 4N22A 4Z7VE 4YK4B 2WTRB 4YFLI 5KYYA 5D6DC 2AI0L 4MX7B 4NC0B 1NPUA 4ZO6A 3DC0A 4AW7A 3II1A 1MN4A 2H0EA 3HPJB 3KPRB 2ICWI 4TVPL 3BUPA 1Z5HA 2X88A 4HWZA 4MAYA 2NNAB 4X4MA 5ENWA 1RLWA 2HFGH 5IJKC 2EVGA 5D2NE 2MNWA 5HYJB 1ORSA 3FU5A 5BRQA 3D50A 1PZ3A 3VFVB 5DMIH 2VO5A 3RTQB 4XC3L 1E2WA 3HG5A 1YNKL 1OSZA 4UILL 3V0EA 4AQ8C 1QWUA 1BQSA 3VXQB 4C4BA 3DXAE 4R6UA 4E5XB 2CJUL 1UXLA 2IFGA 1NUFA 3IM1A 5ADPL 3ETTA 1WCQA 3KPTA 4TULH 3STBA 5FA3A 1VCAA 2FT7A 4FNPA 3KVQA 1BVLB 1F2XK 3CDZB 3UGXA 3E6HB 3EF4A 4DOHB 3ZQWA 4PHZA 3MKGA 2DJMA 1BLNB 2HCZX 2VM9A 3V4LA 3QRBA 2UX7A 3VXOB 1P4LA 3HFML 4P46D 1Y0LB 2G3ZA 1F3JB 3CHSA 5JQ6L 3KNBB 3LZNA 5FKPB 4H13C 3W9EB 2AJZB 2X4TA 1S9XA 3HG4A 1HQRB 3LN5B 4R5VA 4PJHE 1UWGH 3LKRA 3CDGA 1N26A 3P0GB 1KJ2B 2FX9L 1V3MA 3S37X 1QFWH 3CUPA 1DVYA 2HWZH 1OP3H 4AM0B 2AEWA 3OKEA 5JQHC 5KVFE 4OFVA 3EH5B 4OF3A 4PSRA 5EU3B 1ZLWH 4IDJL 1ZS8A 4WWNA 1JL8A 4HEPG 1PX8A 1NTDA 2CRIA 2MTPA 2XN9E 4HIIB 5AB1A 4WJ5A 1PDKA 3HE7C 3N9GL 4PRDA 4RDQF 3B8YA 3KPSA 4EI5B 1BP3B 1BYOA 2EXYC 4P5MA 4K55A 1FIGL 5I30H 2MJWA 1G1CA 3U2SA 1DN2A 1O5DT 3QFDA 4J1UB 2Y7QB 3KWVA 2AK4B 2EO9A 4KJQC 4NZ8A 3RVUD 5F2FA 2YA2A 1KCUL 2BNQE 4JFQA 5MHSE 3MHZA 3RA7L 3VI3B 1DO5A 1OAQL 1KGXA 4WV1B 4M3HA 3CXHJ 4YN3A 3W1ZA 3EYUL 3ZHNA 5D1ZC 3L7EA 4PJAF 3T8XA 3HAEA 3JV6B 4XOBA 4AV4A 4B0MM 4TUOB 1UVQB 2IALA 4WI5A 2VAAB 3ZLQC 1GGCL 3ECQA 4XN5A 3IXTB 3RG1C 1N6QL 1G9NL 2K8MA 4HJ0C 2QHLA 3QNYA 1PLBA 3UJJH 2O6CA 3F7VB 3I9PA 5JA9A 2L7JA 1M71A 3CFUA 1RKRA 1EEUA 3SJVB 1ZA3A 2C1OA 5GGTA 1MSPA 1PFOA 3GQFA 3Q2CA 4L4JA 1I9RL 1R34A 2J6EL 4XNYL 5KVDL 3UTSB 4KK9D 2WXIA 2YZ8A 4AGPA 5IEKA 4TPRH 4YDVA 5HHPA 1P1ZB 4K5LA 5ICZB 4OU3A 3S7GA 2EDMA 2BS9A 2R0KL 5JUEL 3VXMB 1QLFB 1ZT7B 3ZZQA 1XCQB 3VYNA 2W0LA 4QTHA 5IQNA 1I31A 2IWKA 2VE6B 4KHXH 3Q48A 3CMOL 2H41A 4M6MH 1M3JA 4RH4A 1FUNA 4R4FL 1TJHL 4Y7MA 2RGSA 3VW3H 2V9UA 4L8BA 4AENA 2YUWA 4N9GA 1JDDA 1QW8A 2BNRB 2XVGA 5AKTA 4ES8A 3T09A 3PPSA 5B38G 2X3BA 1WFUA 1AXTL 2CH8A 4K9EH 1VGKA 1IQDA 2CO2A 5DRZB 5GRZA 1XCTA 3IDGB 4RGOH 1DBBH 3CJJA 4HU2A 1F6LL 1QLRA 4LNVA 5H35B 3TESA 3GBDA 5DRNB 2V6HA 5F1SA 1U93B 1Z9SA 1X3DA 3CSYB 1CGXA 1OE3A 4LLYB 2AC0A 2LQRA 15C8H 2FJGB 2QMJA 2Y7MA 4I9WD 4MAUH 4H5SB 4B3EA 1USQA 3QHTC 3BX7C 4Y5VB 2AS5M 2BHYA 4M03A 4FI6A 5E6RB 5FYLL 5GGSB 4K5OA 3T2QA 4OCYL 5D4JA 5EF1A 3PHSA 4HC1H 2YZ1A 1RURL 5BO1L 3DHJA 3QUMH 5INCA 4I13B 4HWUA 3N91A 2ZUXA 4TUKL 3A5VA 3TC9A 1EDYA 1FG9C 1QEXA 4GS7C 1OCWL 3LRKA 3ATBA 1CQKA 4TSBL 2OMVB 5TDNA 3K71B 4WWOA 3FRUB 1TZ8A 3JWNC 3X1FA 1SEQH 1ZHKA 5E5RB 4KOCA 1OM3H 1HC1A 2WQVA 3ILQC 3NP4A 4YHIB 1WEJL 1EHLL 4YHKH 2VXVH 4D2NA 5CMAB 3W9DA 3CFNA 4WJG3 4XGZB 4WSGA 1ZLVH 2XNAA 3VFMB 1T7WA 3IBOA 4QHUB 4XNZB 4R0LC 1LEKB 1C12A 3DX6A 2ED7A 3EADA 4ORGB 1W8EA 3BJ91 3OF6D 5ANHA 5FS5A 3SCMD 1SGKA 1P0SE 2HFGL 2XPZA 3CPUA 3E9UA 5H4YA 1Z9NA 3RGVA 3TPUB 5CHNB 4F3FB 1OP9A 2VKWA 3LB6C 4BZ1A 5J9PB 1J48A 4X6CE 2V4LA 2YD4A 5I6XB 4FCHA 4OAWA 4Y5XC 4H0IA 1TPXC 1DP0A 1OP3K 4WHTB 5FHAL 2AQ2A 3PE9A 4P23D 4U7KA 4YC2C 5AL8A 1GAFH 2GABA 3N41B 1UJ3C 3BUYB 4J3OG 5IHBA 4FMKA 4OH2A 4QRUA 1MCPH 2Q7YB 4EN3C 1I9JL 4YLCA 1F58H 4ZXBB 3BXNB 3VACA 3S5ZA 4CVXB 1W0WA 4W9FC 2GJRA 5DJ2A 2XG4A 1R3KA 1S7VB 2BWQA 3QUYA 5DU7A 4X42A 4PVMA 1PD1A 1QPKA 4PJGA 3DHPA 1QEWB 4ZMQA 2OLDA 3MROB 5EO9B 2W0FA 1RZKH 1NINA 2LU7A 5CZKA 4ELMF 4L8SB 2R1XA 3MJWA 1QYGL 5SV4A 2FR4B 3VSUA 5CEZH 3H9SE 2CBOA 3MYJA 2EDRA 2LR4A 3T65A 4O2CA 5JIKA 3BEVA 2DH2A 3PHAA 4YIQA 1BOYA 4WV1C 3TT1L 3N55A 5HYSA 4PJAB 2ZKMX 4GSQA 1KN2L 2HN7A 4XO9A 4UQ3B 3BPLB 4X5PA 4IIQA 2DQEH 2ESVE 3SOBH 3TVMA 4M48L 1XGUA 3O2VH 4FNLL 1YMME 3ECUA 1BX2B 1U8HA 4LOEA 4LSPH 2I9TA 3GS0A 2PXYA 4ACTA 2O61A 3FSZA 3H42H 4KTEH 1CFNA 3QRGH 4WWPA 4I2XA 1IUZA 3HR6A 2PTTA 4QTFA 4E9RA 3LQAH 3MUJA 4CU7A 2ORBH 4JUSA 1KCUH 4GKNA 4CSSA 4DP1X 2MFNA 5JMRA 4Y2DD 5BNXD 5FDWA 3V0FA 1ZHNA 1JWUB 3ULUD 4HPOL 1VADA 4G8GE 4N4YB 5C0CE 1PTZA 2EDQA 2YA1A 1OT4A 2Y4SA 4N2BA 2JSFA 1MUJA 2D2OA 2V7NA 3W0WD 5ABDE 1GGCH 1NJ9A 4ZYKB 2R15A 2WV3A 2KMWA 2BO0A 2KZ1B 2BDNH 1F02I 2CBTA 1GH7A 3FO9A 4QRPD 3LX9A 4YDJB 5E6IB 1JTOA 1U4EA 2VXUH 3PJSA 5FUCE 4I77L 4FERA 3CBJB 5FW8A 1WZ1L 3QQ4B 3VI3A 4XVJL 4GRWH 4HIQA 1LO3L 2OR8A 4UNIA 2OMYA 3EHBB 3ETBF 4JM2C 3HLAA 1WICA 2WJ5A 3UJIL 2ERJB 4OZHB 3L08A 1U3YA 1WS7A 2H9GA 3VGBA 5I1HL 2DEXX 4LCWA 1P53A 3U25A 3TBVB 5DJZB 1CS6A 2XA8L 2X4NA 2NUPA 4AH2B 4NT6A 3GRWH 2YQBA 1XZ0B 1G6VK 1E28A 5IVXA 3EUDA 4YSAA 1OAXH 4P57B 2YAFA 5TGBB 4UWQB 4DKAA 4P5TD 1CI3M 5ESAA 1BIIB 3V6OC 2KDGA 2AK4A 4OLXL 2EEXA 4UV4H 1EPFA 4QTIH 4Z7OF 3ULVE 3H2WA 1XD1A 3ILPB 3P2DA 3DECA 3IMUA 3ZE1F 1QBMH 5DA4A 2YEVB 4HDIA 4JPVL 5F6IB 1UURA 5KYWA 1PIFA 4HCGA 1XGYL 1VESA 1OZUA 2VN3A 1TG8A 1BWWA 2JXMA 3FCSB 3NZHL 1K8IA 1OSEA 4P5SA 3VQLA 4ZFQA 2NY4B 1ET7A 3FQRA 2DEWX 1GJWA 3VSTA 4KDTC 4OM0H 4JL2A 4YBLB 4MAUL 3CVIH 2H5UA 3V0VB 2W65A 5DJAA 3IWUA 5GGQL 3POHA 1GJUA 5I28A 1FVEA 1T2JA 1GMIA 1GA2A 4PJHA 1PIGA 4A2MA 3SJVA 4AIXA 2DQIL 4NQSB 4KY2A 1KIPB 2D9CA 2YPKA 5CS7A 4PLJD 5BOPA 1KOAA 2DOCA 3TM6A 4UQBA 2E27L 4KROC 1BVZA 1HN1A 4MJIB 4PJIB 1P1ZA 4ALAC 3CAFA 4XI5D 3WS3B 3HS0C 2GBAA 3QDMD 1CDUA 1UCTA 1TJXA 3TH3T 1UFUA 5KS9A 1B3IA 2ROYA 1FO0B 1CT8A 2KT6A 4LPYA 2IANE 3RFZC 1SEQL 5TDPB 2IQ9L 4IKLA 2ADGA 2BVTA 1B4LA 3B2UC 4GQQA 1PKQB 1EHLH 3H9SD 4YX2L 3RY6A 5EFIA 1TQCB 3GSNH 3MI6A 3PS6A 5AW0B 2R23B 2EABA 4JK0D 1DLHB 3QIWB 3NABH 3DGCR 5MERB 3L9BA 5HI3D 4HJEA 3LV3B 1A9BB 4P3DA 2OMBA 2PXYD 4E9QA 1FE8H 2HTKD 5KSBB 3NN8A 2O5XL 4Z3TA 3W37A 1EFXD 1RPKA 4E9XA 1Z9OA 4PV1C 2IFFH 4NZTL 3MSPA 1FGVH 4ZD3H 1MHCA 5FYJL 2Z1KA 2XXGA 3C6LA 3F6LA 1QA9B 3HS9A 3N44B 1G7LB 4YQXL 2W88A 3B3IB 2MPAL 1RIHL 5JA8B 1TUPA 1I9JH 4P2AA 2WWKT 3L9EA 4OD3L 3AAZA 1N64L 3APNA 3HPLA 4IIZA 5A2IH 4DP8X 1IC7L 1CFTB 2WLJA 1G6RB 4C4UA 4LLUA 2XJKA 4M61A 4KX7A 3HAEH 5C07D 3EOYG 4N2EA 1FWXA 3T4AC 3OV6A 5F6HJ 1JGIA 3M88A 1AS7A 4U1HB 2WB1A 3IWVA 2QSCL 4I18B 3RVTC 4H2CA 4ACPA 5C9JA 1V7NL 2AJXH 1CB4A 5CO1A 5E95B 4M5ZH 3IYLW 2XKNA 1KB5A 4EI6B 2VJ8A 2C9VA 3WKMH 4HFWA 2AABH 4Z0XB 2PPEA 1J1OL 1OKEA 1JPGB 2NNFA 2N7SA 3ULUE 1RCYA 2W0KA 3HBGA 3V52L 2FVNA 3LNGA 4IBYA 1I8MB 4Z78B 4RZCB 3QNFA 4KTEL 5AW9B 4XNMB 3VTTA 5K1VA 1LD9B 3WJJA 1OO2A 1IFGA 1UT2A 2GB2A 5SWZD 1XXFC 5F88B 2A4EA 4WU5B 3RWIB 3HFFA 4PLOB 3L4VA 3LSOB 5HJGA 5AENA 5D7KE 1TDQA 3PPEA 2IDCA 4HJUA 2CDGB 2FECI 2R0ZL 5J3HC 2XZAH 2ERJC 3KR3H 3T0EA 4Z77A 4IRSA 4I3RL 3BPCB 4Z76A 4I87A 4OAWB 3VI4E 4U6VH 3MA9L 3L6FB 4MDJA 5M94B 4Q89A 1WHOA 4HH9B 3TL5A 1F4WL 1G7JB 2ZAIA 2WUBL 4GY4A 3FFCE 3MRLA 1BCIA 2FBJL 3GKWH 2WO3B 1E9QB 4P3CH 3UTQA 3HE7A 3KGSA 3V55A 4R90L 3PWNB 1NBZB 1FCCA 2VC2L 5HVGB 4KRPB 1Z5LA 5DMKB 1WZ1H 2X1PA 4L8SA 1PPIA 4LMQE 1QRNA 4PVLA 3UYOD 1ZV2A 4UINH 5CXPA 1D5MB 4OKVB 2AF2A 3MRPA 2V7NB 3W0WE 3G5ZB 3MYJB 2V5TA 4N2LA 3ARYA 4Y16A 4ZPTB 5I1HH 1YYLL 3S3SA 3G5WA 5DGQA 1DJYA 4FHBD 4HEMA 5FO8B 3NCXA 3MRNB 4KAQH 1AD9A 4CAGA 2CM6A 3ABGA 2VLME 3T6VA 4RBPH 4YSCA 4PQXA 2Q8AH 2Y5EA 1JN6B 4GRLB 4G6AD 4QUOA 4AL8C 1MNUL 5DD6A 1U92B 4PJCE 1AZNA 2JI3A 4HS3A 4H8WH 3U46A 4YPGB 5BZDA 4N2NA 1F4HA 2Y07L 4PWKA 5I1EH 4MZIA 1S9VA 1KPRA 3WEMA 4N8CH 5JMOC 1S7RB 4W9KC 3WDJA 2HJKA 2JJVA 3OAUH 1PAMA 3O4LB 3V6ZB 5IJKA 1A7QL 2CWRA 2WSPA 3FK3A 4P2CG 3DIDA 2M1KA 2NXYD 3IETA 3D3VB 5HHOA 2VLLA 3QUKA 1N4XL 1MWAB 4JGMA 4WTWA 1E6OL 4K2UL 2CCVA 4Q9QH 4I1RA 1I7ZB 4L9LB 2VZVA 4KQ3H 5MEOA 2B2XL 1F3RB 1Z1WA 3TV3L 1INDH 4MMXB 1TZHA 1RFDH 2NZ1A 5F9JA 3RU8L 5DVMA 2HFTA 2F8VA 2GTZA 3ZUNC 3VI4A 4LL1A 4PFEA 1KT2A 4MNQA 3QVAA 5FAAA 2W65B 2VRAA 4TVPE 12E8L 1TSHA 3AS2A 3T4YA 3AITA 3FTZA 2CO7B 3QJHA 1VZGA 5IHLB 4Z7UF 3TBYB 3UTSE 2NUPB 4PWJA 5IJDC 4M8QA 4JRYE 3IU4L 4RVBA 1IGJB 3LPPA 2YBRB 4MCZB 3GXFA 2YPKB 1WE5A 4G42B 1U58B 4EXKA 4UM8A 3PHOA 3F01A 4PJFB 2Q2LA 2X53A 3K8LA 4PJIA 3OX8B 3E1ZA 2CLZA 3SDAA 5ESAB 5EIVA 4PLNC 5DUJA 4PMEA 2I60H 4KO7A 3ES6B 3I6LE 1AQDB 3L45A 3SDCC 5I18H 5D1QA 2ZE0A 6TAAA 3LN4B 1HI6A 4NKMA 1B2YA 4ODHL 4BV1A 2O5XH 1AGBB 3EZ8A 1FFNB 2IFFL