1E9QB

Crystal structure of bovine cu zn sod - (1 of 3)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
151
structure length
151
Chain Sequence
ATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDDERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTSTGNAGSRLACGVIGIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE
publication title Conformational Variability of the Cu Site in One Subunit of Bovine Cuzn Superoxide Dismutase: The Importance of Mobility in the Glu119-Leu142 Loop Region for Catalytic Function
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 41
structure length 151
sequence length 151
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2000-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1e9qB00
1S4IA 4A7QA 4A7GF 1OAJA 5CU9A 2WYZA 1E9QA 2Z7YA 3GZPA 1SPDA 3K91A 1OEZW 2Z7ZA 2K4WA 1CBJA 1XTMA 1F1AA 4OH2A 2LU5A 3T5WA 1JCVA 3MNDA 3S0PA 1BZOA 4BCZA 1JK9B 1F1DA 1EQWA 2APSA 3ECWA 1SRDA 2WYTA 1SXNA 1SOSA 2VR7A 3L9EA 4A7UA 3CQPA 2V0AA 1YAZA 2AQQA 1XTLA 2SODB 2WKOA 2AQTA 2Z7WA 1OALA 1Z9PA 1AZVA 1SXAA 1FUNA 3KH3A 4FF9A 2JLPA 5KBKA 1E9PB 1F18A 3GTVA 2Q2LA 2WWOA 4MCMA 4A7VA 1KMGA 4U4IA 3HOGA 2GBTA 1CB4A 3KBEA 2VR8A 2ZKYA 3CQQA 5KBLA 3QQDB 4BD4A 2XJLA 2R27A 1YSOA 3KH4A 3CE1A 3GQFA 1N19A 2AEOA 3GTTA 3HW7A 2ZKXA 3H2PA 1E9OA 3SODB 2WWNA 1BA9A 2C9UA 1N18A 1HL4A 3F7LA 3KM2A 1IB5A 3L9YA 1B4TA 1SXZA 1SXBA 3MKGA 1PU0A 1DO5A 2E47A 3GZQA 4MCNA 3PU7A 1MFMA 1OZTG 1E9QB 2AF2A 2GBUA 2VR6A 1JK9A 3ECVA 3KBFA 3KM1A 1PTZA 1TO4A 1IBHA 3F7KA 4BCYA 1COBA 1SXCA 2AQSA 2ZKWA 1IBBA 1F1GA 1EJ8A 2Z7UA 2WKOF 2WZ5A 1PZSA 1DSWA 2NNXA 1E9PA 1UXMA 4B3EA 1B4LA 2C9VA 1XSOA 2JCWA 2C9SA 2AQRA 2WZ6A 1Q0EA 3GZOA 1SDAB 2ZOWA 1IBFA 4A7GA 3RE0A 1SDYA 2WZ0A 1U3NA 1RK7A 3HFFA 3QQDA 4L05A 2GBVA 3ECUA 1Z9NA 4A7TA 1OZUA 2E46A 1L3NA 5KBMA 2XJKA 1P1VA 1IBDA 1HL5A 1ESOA 4A7SA 3H2QA 1YAIA 3LTVA 1TO5A 1UXLA 2AQPA 1E9OB 4N3UA 4OJAA 1SXSA 4N3TA 1QUPA 2AQNA
chains in the Genus database with same CATH superfamily
3IDXH 1HKLL 2OMVA 2R7EB 4POYA 1JNLL 4WWNA 1U92A 1XZ0B 2XRAL 4XMLL 4KHTH 2AKRB 3D2UA 2I5YH 4HKJB 5D1ZA 3TJHC 3IAQA 4WEBH 2DQGL 3EJPA 3KPMA 2D7PA 3TM6A 1CTOA 4AEHH 5IUCA 1H6EA 4PJEA 5E8OA 4IHOB 4PRHA 1ECZA 1XD1A 4F8PA 3SCMC 1INEH 3ZDYE 1MCKA 1A7QH 4HIIA 5EEXA 4KMQA 5F9DC 4UM9D 5E6ID 1MCDA 4DTGL 2NY1C 2A74A 4GG8A 4JDEB 1KPRA 2BS9A 4OZIA 4PRID 1MEXL 2PLTA 3U0WL 3ABMB 4K8RH 2X87A 4IGBD 1SOXA 4KMTL 4BCXA 3F6LA 4XNQA 1QW9A 4XMWA 3EOBB 1M3IA 4MNQE 1RUMH 1HIML 4OCYL 5FFLA 1I53A 5FKAB 2X5PA 3BKYL 5C2UB 1CGXA 1I7UB 4CC0A 1A6AA 1R17A 3OV6A 3QVAA 3NH7H 4AXWB 4LOEA 4L3EA 2VLMD 4X8CA 4GEIA 5CJBA 1XIWD 3IE9A 1BGXH 5DMKB 1IT9H 4YDKH 4QYAA 5EZJB 3DECA 3FTXA 3G5VB 2A6DA 1MCFA 3O45B 5CP3A 3UTZA 3QJFA 2PXYD 4W68A 3G5YA 2OMNA 3LIZL 1GW0A 5E2WL 3WY1A 4A2MA 2XWEA 3VQ1C 2YS4A 4JG0H 5DZAA 4KDVA 4MCZA 4ODVH 1KB5B 2EYTB 1J87A 1DQML 1MW1A 5F3BB 3DRTA 4LGRB 4ZK8A 2HA1A 1PAMA 4S11A 1WYJA 3GIZL 3S5LG 1YN6B 4G80B 1Q9WA 3BPOC 4X99B 3U2SB 4X6EB 2W1NA 3ZY7A 4JQIA 1RCYA 4P06A 4N5ED 3EYUH 4N2HA 4FXTA 5HDQH 3WIFA 5IMLA 5JZ7C 2MFNA 2WXNA 5EU5A 2E7LC 1SGKA 3MBXH 4CVWA 2DBLL 2XETA 4F3FA 5AVVB 5T1DH 5HYSA 4Y4KB 3H4FA 2UVFA 1PPIA 2NT1A 4H8WC 1TDQA 3P9LA 5J6SA 2J5WA 3BW9B 1E8XA 3HZVB 2ZCHH 1UENA 4NNPH 2FX9L 2WINA 4LSTL 1NFIA 5IMKA 1O5DT 1UFUA 3PL6C 4XCEA 1ZA6A 2QKSA 1T1WA 4TVPH 5TE6H 2QSCH 3KPLA 1XXFC 2Y24A 2CO7B 3MBWA 3OF6A 3COOA 4D8OA 1ID5I 5M94B 3EOTH 4XN1A 3ZHDA 3L8QA 2NXZB 1PG7L 4IOFD 2X2IA 1KACB 3LH9A 4GKNB 4PHZA 4B9GA 4I77H 4JFDE 4P2OD 3D85A 3JTTB 4OGQC 3ULVF 2J56A 4ATWA 3RFZB 3MNDA 4PBXA 4CMMB 1H8LA 1OB0A 3QI9D 4NKDA 3PGCA 3OZ9H 4NKQB 1G7QB 1VERA 2ORBL 2WXMA 2NNAB 1MFCH 2ID5A 5FR3A 3H9HA 4J3OC 2F5BH 3KGRA 5K39A 4QXGH 3P69A 3BWUC 3GM0A 1MJJA 3Q9PA 2SEBB 3V0JA 3FUMA 4G8GB 1YN7A 3MACL 2O93L 2AEWA 4RGOL 4EEEA 3JT0A 2QPEB 1J05B 3UCRA 4U4IA 3MGTB 4AG4L 4FA7B 2BXYA 1OGAD 4NO5A 1W8EA 2J73A 1RP8A 1OAYH 4XN7A 2KH2B 5D1ZI 3RX5A 5KVGL 1DJSA 4J8QA 4X7SL 4PWGA 1EVTC 4FOMA 3FO2B 3W9EA 3L6FB 4HWBH 4L3AA 2QELA 2R2EB 4Q74A 5KUMA 3GI8H 1PX8A 3AM8C 2X7LA 3QDHA 3CZNA 4UOW1 1XR9B 3F7LA 2HPTA 3RWGB 1QLFB 4ZBJA 5E1QA 2FK9A 4TQPA 3JWNE 4P5KB 2R7EA 4M1GH 4X4ZA 3P3TA 1XZ0A 3QWOB 3VAEA 2AKRA 3D3VB 4ADGA 2CBTA 4HKJA 4YR6B 3WDJA 4BK8A 4QRUB 4LIQH 2EC9T 4KI5D 3NCWA 1YYLL 2DIEA 3RA7H 1ILUA 4BSJA 4YWGL 4KKBD 1YPZF 1W0YT 4LASH 4TULL 1IU1A 1OWRM 4M1DH 4JZJB 3DURB 4PLKD 2X42A 4DGYH 4IHOA 2WANA 4WY7H 3DJZA 3FFCD 5FW7A 1NUNB 2Y36H 2D2CC 1RIVH 1X5FA 1BBDL 2QHRH 4JG1H 3L3OB 4JDEA 4GMSL 1HN1A 2OJ1A 3KPQB 3OHMB 1EJOH 1FAKT 4MA1C 4AE0A 1LQSR 2K6ZA 3MJ6A 2XSKA 1FRGH 5HHVH 1IE5A 2A9DA 3RPIB 5L2KE 4XPFH 2E27H 3DX3A 1FCCA 4WFEE 2E6JA 2B9BA 3EOBA 4TOYL 4TYUA 5FKAA 3CMOH 1I7UA 1AY1H 1CR9H 3TV3H 2J3SA 5BOZG 1NPUA 1QNIA 4AXWA 1GXEA 2XWJB 3Q0HA 2J1YA 4NN6B 3NCXA 4G6AC 4HAFA 4UYPA 5DMKA 4LLMB 4UANA 1GC1L 3SBPA 4HJJH 3QQXA 3FQNB 4NN5C 5EZJA 3G5VA 1XGYL 3O45A 1XH3B 4L2LA 2BIMA 3NK3A 4ZS7L 2B7DT 4OZ4B 1XR8B 3SE4C 2EECA 1G9EA 3PG2A 1PNDA 1F1DA 5GJSL 1Y0LB 1KB5A 2EYTA 4N86A 5F3BA 3VH8B 3UYRH 1DP0A 1XH2A 3QIUC 1YAZA 3QUZD 2JJSC 2Z7WA 1YN6A 4G80A 3U2SA 4X99A 4CC4C 4X6EA 5GHWL 1J1OL 2YA2A 5MERB 4LPYA 4HQQL 3LKOB 1P69B 5EIVA 4I8DA 4MS8D 3W5MA 2IDCA 3KYKH 4PJ8B 3GLEA 3KLLA 5TQ2H 5JYLA 3HNVL 4PP2B 3TWCH 4DP6X 4LLUB 1XEDA 2DQCH 4L9LC 1W2KT 3FO1B 4Y4KA 4UV4H 2YIHA 4AY0A 2OJZH 3VI3F 4LOVA 2ZP9A 3TEUA 3WIHL 4DUXA 4DN4L 3UJTL 3EYOB 5CF3A 3NIGB 4DPCX 3BW9A 3HZVA 2YD4A 1XHHA 4G7QB 2K9UA 2CO7A 3BGFB 3GIVB 1X5ZA 3NZUA 4UTBL 5I0DA 4JCLA 5T5NF 1Z9SB 2W9DL 4A2FA 4GKNA 1EHKB 4KJPC 1S8DB 3JTTA 4CADB 3RVUD 1ZKAA 3ZTNH 3RFZA 4CMMA 1A66A 5EUOE 1INDL 1G7QA 4POZD 4NUJB 1F4WH 2Q7NA 4NDMB 2CE6A 2NNAA 1HESA 4MLSA 2VH5L 2TSBA 1UM4L 2BHZA 5TH2B 5I9QC 1FCGA 3FRPG 1XV8A 2V5TA 2SEBA 1CLOH 4G8GA 2QV2A 1P7QB 3W5NA 3G08B 4CSSA 1J05A 3MGTA 4IBWA 4YE0A 1RJYB 1LM8V 5LNDA 4WKZB 1ORQB 2DL2A 2IADB 1OXYA 4EN2A 5DI8B 3FO2A 2X09A 2JKRM 1KGWA 3L6FA 5DZ9A 4DN3L 2R2EA 3CU7A 4Z7QF 4AYFB 4N9OB 4Z7WB 2JB5L 3X13B 1T89C 1XR9A 3RWGA 1QLFA 3ARED 4ZX3A 3VXRB 2ENPA 5D1QE 2JLLA 2WO3B 1SN5A 4P5KA 1KULA 2GIMA 2UXTA 4K4KA 3QWOA 1JRHI 1NIDA 4HMDA 4RWYL 3D3VA 2VUKA 4YR6A 3FTSA 1SPDA 4QRUA 2WUBL 2R9HD 3V55A 2K4WA 1JZ7A 3Q6FB 2OQJB 2WSKA 2X4QB 1FPTL 2QGBA 3Q43A 2J6EL 3M1BB 4JZJA 3H3PH 1JAEA 4FFZA 3DURA 2B15A 4G3YH 3FYEB 5AOJA 4L0PB 3M88A 3CFKB 4U3CA 2HLEB 4DEPC 3GJFK 3GSNH 2AQQA 5F88B 4PD4J 1Z9PA 1A2YB 4QYOB 3L3OA 4GQZA 1UD3A 3KPQA 43C9B 2YSTA 4PJ9B 4AK2A 4O9HL 4TPRH 3KXFE 2CJ3A 3MOAL 3RPIA 5E5MB 1RKRA 3KMDA 2GBTA 4WUUB 2Y7NA 3U2JA 2VDQL 4XBMA 1G1YA 1YQVL 2P48B 3CDYA 3QRLA 4AI7A 2NXYB 5IB2B 1SBSH 4WO4C 5ANME 3V4VH 3JTSB 2XWJA 1LL1A 3PQYB 3TJEH 2XWXA 4JDZB 4LFHG 4A67A 4PJGF 5F2FA 4LLMA 4I2XE 2IDFA 3FT9A 3ZYJA 3NDZE 2XICA 2ZYRA 3FQNA 4IJTA 1XSIA 1XH3A 3CFNA 5IUSA 2EZ0D 5HYQB 2Q7YB 4JFED 1JHLL 1FE8H 4OZ4A 1XR8A 1QKZH 3MLUL 3W1ZA 4OFYA 3I50H 3ECVA 2A99A 1KC5H 1IEAB 1Y0LA 5IM7B 3VVVA 1BF8A 2W0FB 3VH8A 1WE5A 1SYSB 5C0AD 2HCZX 1U3HB 4WDIB 2OK0L 5D96C 5IB4B 3US9A 4R8WL 2EH7H 5I1KL 1MI5D 5DRNB 5MERA 3LKOA 3DK0A 1H6UA 2HKAA 4EO5A 4PJ8A 1J10A 1HHKB 5AZ2H 3RVWC 4PP2A 3L3JB 3VWKD 1EAPB 2ZG1A 2YQGA 2ARJB 1HEHC 4LLUA 2ROYA 2D4DA 1IIKA 4PLJC 2J8UF 4RRPG 5AYUH 3B9EA 3V4PL 2F8XC 3FO1A 1V5JA 5C0ND 4NI6A 2HKFH 2E6PA 3BUDA 3EYOA 3QGVA 3AMKA 1ZTXE 5DFVC 4M48L 4PTTB 5C0BB 4IU3B 3RY5A 4AQ8C 1J9CT 1IC0A 3BUBA 4GEJA 4CMHC 1BYOA 1QWHA 2BNRB 5I76B 3UJIL 1K8DB 3GIVA 4E42B 1AZZC 1S3KL 2X0VA 1JYWA 5GGQH 2BRRH 3WGUB 1Z9SA 3MCKB 4RSVA 1S8DA 4CADA 1YMME 4JO5A 5IKCB 3S6CA 3D39B 1G6VK 1Z9MA 5C09D 4K23L 3UBHA 3ZGHA 4G8IB 3ZTDC 5T3XE 4NQSB 4NUJA 4NDMA 2CXKA 3FO0L 1RZ7L 4JQIH 3O11B 2Z91B 2W9LA 3D07A 5TH2A 4N90E 4Z7OF 4I18B 4WI6A 5ABAA 3BJLA 3DLQR 4AH2B 4YSAA 4MMXB 1A7OH 5C2BL 1P7QA 2KPNA 5FECB 3G08A 4X7CC 5F72S 3CBKB 1U58B 3RTQB 1RJYA 2BVYA 3RB5A 3UL4A 3DETD 1OSZB 4NOBA 5DQDL 3ARWA 3WJJA 4WKZA 2J43A 1ORQA 4LSVL 1DL7H 1ZHBB 5DVPA 2EO1A 2IADA 3TASA 1TJGL 2VXQH 5L0QC 5DI8A 3AFLA 5C9JB 5D1XC 4AYFA 5TDOB 4Z7WA 1YHPA 3X13A 1ML0A 3FCTB 3VXRA 4WV1C 2Z0BA 3OGCB 3N44B 4F91B 2L7UA 3VI4B 2DLFL 1X5JA 3VRJB 2K1MA 5EZIH 3F7QA 3WJMB 3Q6FA 1OTSC 1PZCA 1G7IB 2OQJA 4NXSA 3MLRL 2X4QA 4RDBA 5DD3L 4EIGB 5ICZB 2OXHB 3KJ4B 3EH1A 3M46A 2QHLA 3M1BA 1MDTA 5HHXL 4XXDB 3ARGC 2D9CA 4Z7VB 5ILTL 2ZSWB 3CFKA 3U4KA 3WHE0 2W9EH 2O5YH 2I25N 4UBDD 4JFWA 2ESVD 4ZAKC 5I6MA 5F88A 5LN8A 4FL4B 1A2YA 3IDYC 4QYOA 4WGKA 3HE6D 4XAKD 1PCSA 1E3XA 2DWXA 1J9SA 1RK0B 4YHZL 4P46B 4PJ9A 5J12C 4X7FC 5KAQF 4FERA 5E5MA 1YNLH 3QRGH 3BRDA 5JORB 4QRAA 2KUTA 4WUUA 3O9WB 3P4NB 4BQ9A 4ZPTB 1BQSA 3BT2L 3MKKA 1KV3A 1NAMB 1KWKA 2X10A 5HYJB 2VO5A 3WSQL 4GB9A 3GMOB 5IB2A 5KVDE 2WAHA 3FFDB 4AGPA 3JTSA 3PQYA 4LCIL 3DDGA 4XP1H 1F4HA 4JDZA 3RY6C 8PAZA 2BVPB 3FT4B 1G9NH 2E7HA 5HHQB 5JQ6H 4IDJH 1QUPA 4CUCA 2ZOOA 3LN9A 5T3ZE 5LWYL 3PWVB 2R29A 4Y4FB 5HYQA 1PF3A 2Q7YA 3ULUE 2DN7A 4PGZA 2ZNWA 1OEZW 4W1TA 1TQCC 3U4BL 5MENE 5JMOC 3D2UD 5IM7A 1IEAA 2M8XA 2UWEF 1CJYA 1PFCA 4QRPE 5D1ZD 2IFFL 4Z0BL 3W0WB 4AIZB 1SYSA 1M2VB 2CBOA 3D12B 4W9ZA 4HISA 1U3HA 4WDIA 4RX4A 4KY2A 3BE1H 4F5CA 3OPZH 2XXGA 3IPEA 5IB4A 5IB3B 2HRGA 5DRNA 2WKOA 2ZKHL 1OSYA 3IJ8A 4PRHD 4UTCA 1HHKA 3L3JA 2FEEI 3FU0A 1EAPA 4UUJB 5EFIB 2ARJA 5D7SL 4YHPB 3M86A 3FKUS 1N0XH 3ESPA 5BPPA 4KRLB 1F0LA 1A8ZA 1WH0A 3T8VA 3VX0A 4XPAH 4ZFFB 1H6FA 2KS0A 2FJHB 3EZJB 2PTUA 4UZSA 3JV0A 4PTTA 2GI0A 4IU3A 4WNSA 5C0BA 1JI2A 4KDWA 3UG3A 2BNRA 1GOFA 2E9IA 2J71A 2VR9A 1AOZA 2E7MA 1K8DA 4E42A 2OMTB 3WFEH 1JYXA 3VO0A 1KN2H 2E6QA 1OM3H 4HJIA 2NY0B 4PI2A 3VTAA 3ARDB 1MFDL 2Q7AA 4L3ED 3MCKA 5BW7C 3VVWA 3FBKA 1NBVH 1FH5H 5IKCA 2J8OA 3D39A 5FKPB 3BH9B 4NQSA 1OD9A 2BERA 2Y5QA 4S1SH 1PKQE 2Z91A 3O11A 4P9HL 3WG7B 4Q9QL 2X4RB 4A6YL 1KN4H 4I18A 3AJ7A 4TQHA 4X6CE 3QW9A 4XWOD 3N85H 3BN3B 4AH2A 2XZZA 4PJFB 3M07A 4MMXA 4FQIH 2VN7A 5FECA 4K3HA 1FHNA 1NUGA 1RZKH 1U58A 1PZSA 3RTQA 5DUPH 5DO2D 2Y7OA 2EDEA 5TFSH 3DGDA 1OSZA 4PG9B 3O3DB 4ZFGH 4GP8B 1L9NA 4LSQL 1F6LL 4MXVF 1QSFB 4OLYH 4Z7UE 5H37A 1ZHBA 3CZUB 2D8KA 2PTTB 3RLSA 1UWEH 3EZ8A 4EUPH 5C9JA 2H8PB 2ZWSA 1MFBH 3FUHA 3I85A 3NCJH 4ZTOH 5TDOA 1JZ6A 3BP4B 3BUQA 1JXKA 3BIKB 3FCTA 2WLMA 5C71A 3ARFC 4LVHC 4DZBB 5AQ0A 1YRKA 2D7NA 3OGCA 4HDIB 5JIDA 3LTVA 4EIBA 1I9JH 3VI4A 1A02N 3VRJA 4J23A 3RDTC 1V3JA 4X7EC 3ZKND 3WJMA 4OCNC 1TJHH 5G4OA 3PY9A 3MV9B 4JM2C 1G7IA 4X4ME 5ICZA 3OF6D 4PI0A 2OXHA 4XVTH 3HC2A 1M9SA 4LSUL 4YXLL 3O4LE 1WFTA 4LEEA 4OGAD 4DCQB 2FR4B 4XNZC 3WAKA 4AEIH 3W38A 1MWAL 1UT1A 4XXDA 3R7QA 4IBUA 1A3ZA 3LX9A 3D85D 4Z7VA 1ACYH 2ZSWA 3RTLA 4Q89A 5KYNA 4HPYL 2G3NA 5DFTA 1CL7L 1MCIA 1HEZB 3FZUD 1SOSA 2XKNB 1YG9A 2VDMH 4HEPG 3WLWC 1RK0A 3BSZH 3AG3B 1SY6A 4P46A 3IT8D 4X80L 4U49A 1MAML 4HETA 5JORA 2ZOUA 1Z0MA 3O9WA 3P4NA 2WQWA 4ZPTA 1KMGA 2P46B 1GIGL 1TENA 1KJ2B 1NAMA 2X38A 3IBEA 5HYJA 4BKLB 2IPTH 3GMOA 4C4KO 5I6XC 2J5LC 1PBYA 3FFDA 2XX0A 2QADC 3JWNC 2X88A 3RI5F 2BVPA 3FT4A 4JJ5B 5GZOD 2VDRL 3PP4L 4HC1H 3QPQC 4GQ9H 5HHQA 2X6UA 4M43H 4MXQC 3LB6D 4NM4H 2HKHH 2P52A 3PWVA 4FFZH 4Y4FA 1MCLA 1UADC 1JPTH 3TX4A 3Q01A 3TCLB 1GOGA 3UXFA 3QQ9D 1RU9L 4PWJA 5B1JA 4K07A 1LE5B 3KLKA 3RAJH 2DQHH 2YQ2A 3W0WA 1SUJA 3BEVB 4AIZA 2VN4A 1M2VA 3RWHB 2H41A 1UXSB 4XMKH 3O3UN 3I9GL 2FEDC 4HOZA 3L3KB 3MUJA 5AW7B 1A6VH 3TH2T 2WPGA 5IB3A 3Q9QA 1EGJL 1HHJB 4TS6A 5L9DL 4JE4B 1I9RL 3QZWB 2FHFA 4HUKB 5EULV 2XFXB 4Q4EA 2EDHA 4JGJA 1RSFA 2EDLA 5EFIA 5IROC 1QFUH 4UUJA 1IE4A 1DBAL 3GFUA 3B5HA 4JFSA 4YHPA 1JGVH 1FNFA 3JZYA 2BJML 4LSRL 4LF3B 2PPCA 4IKJA 3ZOAA 2VDOH 4BHUA 2CJUH 3ZT7A 4ZFFA 1HZLA 3LQAL 4AEFA 3LKNB 1MRCH 2WXFA 5DHVH 1QBMH 1CE6B 1TVHB 2FJHA 4AL8L 4DAGH 4I3RL 1B3IA 2LAGB 3Q1SL 4LEOB 3SDXB 4EBQH 3D4YA 4U1SA 3SB3A 2AP2A 3F58L 1UCTA 5KSUB 4W81A 3QAZB 2B0SH 2WWMD 1GGIL 2OMTA 1WAAA 2JELH 3MYZA 1BW8A 4QT5B 1R6VA 4XOBA 3ARDA 4TRPH 3TT1L 1T03H 3G5ZB 3U1SL 4A7GF 3QZWG 3GBMH 3LZPA 3VM7A 1RULL 5FKPA 3BH9A 3QRFM 3QEGL 3VWJB 3K91A 3F7RA 2Z3FA 2GFBB 2X4RA 3D4CA 4MA3A 2VXVL 2VOTA 4HUWB 5E99L 3UZEC 2CLZB 5C86A 3ZE0B 4K3EH 4BCZA 3U6XA 4PJFA 3NEOA 3MRPB 3CIQA 3RB7A 1T1ZB 2AJXH 2ITCB 4BQ8A 3ECWA 5E6YA 5IY5B 1BMZA 1AMYA 3K6FA 4AGNA 3QRBA 2WYTA 3LRLA 4I9XA 4OZHE 4ENEC 4JZNB 4S1QL 2I85A 2DDQL 2ZUYA 4XPTL 4Z8FL 2Q76B 4FZ8L 4J28A 3SPJA 1WZLA 4XWGL 4PG9A 3O3DA 4WLCA 3K8MA 2VRQA 4ZW3A 1MG3C 3FBQA 1MCHA 1QI3A 1QSFA 5GISL 5B7EA 2ZCKH 1KB3A 3CV5A 2PTTA 4FG0A 2NY3C 4N6RB 2HTKC 2H8PA 1PZUB 4HSCX 3T1WA 2Z31C 3D18B 3MOBL 4KK8C 5A3ID 4PJCB 4YDJB 4XO4A 1JFQH 1WQVT 3BIKA 2A4ZA 4HEPA 4DZBA 3KLSA 1HYRC 4HDIA 4Y4KD 2WXJA 3GRBA 2YN3A 4BK5A 1K9TA 4IJ3C 3WO3B 4BH8B 3CXHK 1I85A 3CSGA 4CDHA 3C09B 1RIHH 1N7ML 3X2QB 3LQAC 1DE4B 3MV9A 2BIOA 4KKZA 2GK0B 2CO4A 4DHLA 4H2AA 4RAVB 3UOAB 3MAWA 4DCQA 2FR4A 2K4AA 1BD2B 3MZGB 4M5ZL 2NXZD 3QNYB 4DOHB 4NHCL 4F2ME 1CFVL 5FGCB 3KL3A 4LU5H 1JXDA 3PV6B 1MHPL 3N42B 2WLYA 3NJIA 3QEUB 1J1PL 2MCG1 4NQCB 3PAYA 1ZLUH 1HEZA 4HS3B 1FORL 2XKNA 1DQKA 1NOAA 4MNHB 5I8KL 2X40A 1W8OA 5CILL 3L9RB 3S3DB 2IG2H 4L4VE 4AM0Q 4A38A 2UXGA 1OCZB 1F97A 1MJ7L 4OSUH 4G8GD 3DXAB 3NZ8B 1UJ3B 1T66D 2A6JB 4YUEL 5C07E 3APDA 1KJ2A 4U2YA 4OD2B 3IRZA 4BKLA 1FSKB 1W0WB 3UBGA 5D1QC 4TNFA 1JL8A 2ICWJ 3SYQA 4PJHE 1R0AH 1KELH 1T6VN 3DMMB 4JJ5A 3LQMA 5KN5B 2A6IB 1T04B 4WFFE 4K2UH 2N56A 2VZSA 5F7HA 4M7LL 3TCLA 3DTDA 5E2JA 2YQBA 1S4IA 3FQUB 5TQ0L 2W5PA 3MJ7B 4PJIB 2YK1H 3WIIH 1LE5A 4DPBX 4ZFOL 4MMZC 2WLKA 3D3VD 2VZTA 4BHUI 3BEVA 2YUZA 2FZ3B 5LBSA 2PYEE 3RWHA 1GYAA 5TPWH 1GGUA 1BZ8A 4NS0A 1IAII 1UXSA 4XE0A 5E8NB 4AGQA 3F5WB 3L3KA 4I0PC 1ZTXL 3MSPA 3JV4B 4Z7IA 1HHJA 2XI9A 2PPDA 3O81A 3QZWA 1L0PA 1V10A 3QJSB 3QUMB 2XFXA 3UAJC 3VGEA 5E4EC 5FM4A 3DOSB 1DJXA 4CKQA 1FQ9C 1CN4A 3LMJH 5DFWH 3FUNA 3B9KC 5JXAH 2YOCA 4LF3A 5E6RB 3S8FB 3FO9B 1ZMYA 3E7JA 2AJSH 2W91A 4JHWL 3LKNA 4QXUL 5T3XL 2WYIA 3QNXB 5KTEH 1CE6A 1TVHA 1TSHA 5F1OB 2R29H 1E28B 2PTVA 4LEOA 3SDXA 1QSEB 2R27A 3LQZB 1G7MB 1RERA 3E8VA 3GO1L 3Q6GH 4OM1H 1UB5B 5KSUA 2X4PB 1UZ6E 2NX5B 2H45A 2WWNA 4QT5A 3CK0L 1ZDSA 3RRQA 3VACA 2A77L 1CFTB 2NYYD 3G5ZA 4OD3L 1KCBA 2JJWA 1SF5A 2YGNA 4ODHL 4YVUA 5DS2A 3Q5OA 3VWJA 4FP8L 4KKLD 2GFBA 3TTYA 1ZSHA 5FW8A 4HUWA 4OI8A 1FL6B 3CWGA 1R1CA 2IEPA 3V52H 2CLZA 3EBHA 2Y7MA 3K2IA 3T0EE 5I6KA 4N0UE 1Y1UA 4OFYD 3MRPA 4HJSA 1T1ZA 1Q1JH 2ITCA 3VG0H 1T0MB 5F9OL 3KLQA 3ISRA 3VA2C 1RUKH 1UUSA 2XZCL 4JZNA 5IHBA 3VD4A 1BFTA 2FQEA 3D0AA 2Q76A 5FUZL 2X1QA 2DQUH 2H4EA 3IRPX 4OV5B 1OPGL 2H26B 4LHQB 1B4LA 4N6RA 4R5VA 2WNWA 3PWPB 1KENH 2YGQA 3ZZ1A 4BFFA 1SDAB 3D18A 5GRJH 4HZLB 4PJ8D 3RE0A 1PZ5B 4PJCA 2BWQA 3UH8A 4YDJA 2E8YA 5HYIA 5DD0H 3UDWA 4JREC 4PRNB 1AS8A 3MVSA 4HHAB 1D2PA 1B2YA 2R56L 3CX2A 1C5DB 1EXGA 2CQVA 4BH8A 2ZZUT 3THML 3VD2A 4PBVC 3VD5A 1RHHB 1F58L 4MYPA 1DE4A 4IRJD 1ZK9A 2XBZA 4OCSH 2ATKB 3FUEA 1RMFH 3ENEA 3HG1E 1T80A 2AXJA 2WMPB 1C5BH 2GK0A 2AZUA 4RAVA 1BD2A 4JG9A 3QNYA 2QFRA 3R4DA 1QNZH 4GRWF 3SIKA 2P8MB 1ZV9A 3IFOB 1EMTH 3PV6A 5JIQA 3QEUA 3UO1L 2OR9H 2VABB 4NQCA 4DQOH 2J21A 3CDFA 5D2LE 2IAAC 1KCSL 4HS3A 2GQHA 3MR9B 4MNHA 3LXBA 4FNUA 4QTIL 5DRZB 3LPFA 2NY5L 1HSAB 5TE7L 1GW6A 4JDTH 3L9RA 4WO0A 1KTLB 5FV2A 5T3ZL 4YBQD 3DXAA 5JW5B 3NZ8A 1P7QD 1YNKL 1UJ3A 3HRPA 3LRGA 2A6JA 1ZLSH 3RWDB 1FUNA 1SJHB 3DIFB 4K3DH 5AVZB 5JA8B 4PMEA 4I87A 1DLHB 1MELA 3ULUL 4OD2A 4AUYA 3WKQA 1I9IH 5CEZE 1J0KA 1W0WA 4R90H 2ZJSH 1SBBA 3P54A 3DMMA 1A6WH 4OQTH 2DD8H 5KN5A 1H19A 2A6IA 5I16B 1T04A 2XNAB 4YHML 1DQTA 2QBWA 1I3GL 2GT9B 3QDGE 4H8VA 3NABL 4YDNA 5LG1A 3VXRD 2X1OA 2FH6A 1NKGA 4PJDB 1UC6A 3FQUA 2MWCA 5DC4B 3MJ7A 4PJIA 4QJ4B 5HPMB 4Y9CA 8CGTA 4P9ML 4PV9B 2EXYC 3NFSL 4CDGC 2VZ1A 2FZ3A 3E2HC 1BAWA 5KJ7E 4KVNL 5A1AA 1BF2A 3OKLB 4PW9A 2J72A 5E8NA 5J3HD 3M8OH 4MNGB 3BYTA 2QPSA 3F5WA 5IBUG 4NIKB 1BJ8A 1ZPUA 3JV4A 4UTAA 4LVOC 5CGYD 5CXPA 2HYMA 1A4AA 1YO4A 5DRWB 3TXAA 3BPNC 2Z34A 3QUMA 3ZDWA 3MJ9L 5IEHB 3DOSA 2DQJL 1VFUA 5BOJA 5I5RA 2ADJB 3NJGA 3QHFL 2ZYHA 1OAZH 3B9VA 4NBYB 5C92A 3VD9A 3FO9A 2FWSA 4PJ9D 1OW0C 3QNXA 2C1OB 1KXVA 1E28A 4WUUD 4L1HA 1QSEA 3LQZA 2NY5C 1G7MA 1HOCB 1KY6A 4OF8A 1ET5A 1UB5A 2X4PA 2VDLB 3NZHH 2NXYD 1BQLH 3ILQC 2NX5A 2AQ1A 3Q3GB 2VITB 5JYMA 3ULUC 2K7QA 1ORSB 3PQYD 3P0YH 5HJDA 1CFTA 2BFVH 4KZEL 5JIIA 2Y7QB 2DMGA 5IJVB 4CU8A 4N2BA 4CKVX 4GIAA 3GNML 4BRVA 4NNXB 3WTTA 4PJ5B 1E3FA 3QCVL 1JYVA 4EDXB 1FL6A 4ZI8A 3DGCR 2B2XH 5HDWA 2IF7A 1CBJA 1R5IB 4J39A 4OH2A 1KZQA 1GL4B 4ZOBA 1T0MA 4UT6L 3TONA 1JK9B 2EXWC 3P30L 4OCLC 4KX8A 3HI6L 3A4FA 4LPTA 2F1AA 1M1XB 1U3HD 2W60B 1NLDH 4OV5A 2H26A 5DD1L 3EOAB 2LVEA 4HIXH 4RGMB 3DDFA 3PWPA 1DVFB 4OKDA 4AQ1C 4HZLA 5G5DB 4XAWL 1PZ5A 5KSVB 5E24E 4Y9GA 5EIQA 3GSVB 4DP5X 2Z4QB 4W9JC 1QLEB 3IFNL 1MAKA 1XSJA 3AADB 4PRNA 2PR4L 1L9OA 3ILPB 2VR8A 4ZD3H 3TT3H 2J88L 5GGRY 3QUXB 3FQYA 1C5DA 2J20A 3CNKA 3WN5C 1UJTA 1JVLA 2JQMA 2FYVA 1QRKA 3LDBC 2DJSA 2YRLA 3WN6A 1RHHA 1I3RB 5F6HI 5C0BD 1PZDA 4NZUH 4FG2A 4XPHH 2ATKA 2BNRD 4LAQL 2WMPA 4XHQA 5D2NE 1FGNH 4UT9L 5IJBC 2WLLB 3F12B 1H5BC 2GHWB 2LT9A 4KJQC 3KLHD 3GBNL 5JIKA 4JFVA 3WD5L 4JK0D 3D39D 2P8MA 4FTVE 1VHPA 3IFOA 5DZJA 5KVEH 4QHLB 1ND0B 3E9UA 2VABA 1ZHLB 3N3EA 4FXLA 2DI8A 1H3WM 3TJPA 2CU9A 3MR9A 5DRZA 3KL5A 1HSAA 3F85A 1KTLA 3D4ZA 3L1GA 4BYHA 3O6MH 1EBPA 2EC9U 4JPVH 2DLHA 5EU3B 4D9QD 5JW5A 1WWAX 3RWDA 3P11L 3WFBL 3CH1B 1SJHA 1KXQA 1F8TH 3DIFA 4R4FH 4WFHE 1DLHA 3RTQD 3B37A 5HVWA 4M6OH 3CPUA 4FABL 3UC0H 3HN5A 1PZ3A 5D93C 5ADOH 4G11A 3VFVB 4KTYA 1ERNA 2HG5B 3PRZA 3V6FB 5I16A 2XNAA 4PB0L 4FNQA 2ZICA 1QO3B 1NGWB 2GT9A 2P5WB 4M7KH 5IJKA 1MCPL 3S34H 2FGWL 4Y2DC 3HC3H 4PJDA 4WI8A 2VJXA 2W0PA 4P2AA 5HPMA 2A1WL 4YBHA 5I30H 1QHPA 3DHPA 4PV9A 5CJQH 4FQPA 2XV0A 5JW3L 1IEHA 8FABB 4HG4K 5BV7H 3OKLA 5MEPB 5JR1L 4RRPM 4KDTA 4MNGA 5EDSA 2C7UB 2MNUA 2GABA 5DRWA 5I75C 2WQSA 1C08B 4LRNH 4JO2L 5IEHA 1NEZB 1QZNA 4HWZB 5IGXH 3SZ6A 1TQTA 2ADJA 3DBXB 4RWHA 3GGWB 1DVXA 4GUPB 4HV8B 1UA6H 1NCHA 2SODB 3DBSA 4ONFL 2JV6A 4P46D 1FO0B 5I1DB 2C1OA 1A7NL 4FFYL 7PAZA 2VXTH 2LHAA 1TTFA 1E7UA 2W59A 3FK3A 1MUJB 3K1KC 3R8QA 3VRLF 1NMBH 3F7YB 3MRBB 3O9WD 1HOCA 5CEXB 2YPVA 3HBGA 3SDDC 3HB3B 3IB4A 4I1NB 4DERA 4FZEH 5HYJD 5IT2H 4TVPE 2B1AH 3VMNA 1ADQA 4Z95H 3C60B 3Q3GA 1T4WA 3BJ91 2VITA 4H20L 1J1XH 1R9FA 1ORSA 1RZIB 5LBSH 1WFIA 2CBMA 3T2NL 2Y7QA 4PQXA 2LAAA 4APQB 5IJVA 1I82A 5GSRB 1TTRA 1NEZG 5ITBH 4NNXA 5HVHB 4PJ5A 5F7YC 4Y4FD 4EDXA 2Q8AL 4MMYB 4BZ2H 3DUHA 2BW5A 2PUQT 1R5IA 2QPUA 5SWSE 1XSKA 2CGYA 5A43C 4NBXB 5CZXD 3KW7A 1JK9A 2EKSB 3AW5A 4OLUL 5DLML 5AVQB 1UD6A 4J3SA 2BINA 3CFUA 3PDOB 1M1XA 5F97E 2X0UA 5A6IA 2W60A 3IAPA 4IRZH 3VRIB 2GK2A 1YPZB 2EIEA 3BESR 4EF3A 1GJIA 3EOAA 3HMWH 2ZAGA 2BVOB 2DMKA 2F0CA 3CSFA 1ZVNA 2KI6A 1DVFA 1SMDA 3VYPA 1TIUA 1A14H 4G5ZH 5G5DA 3GMMB 1X6NA 5KSVA 1IFHL 2C9SA 4UDTB 3EYSL 2WZ6A 3GSVA 2Y22A 4KI5F 2Z4QA 1FVEB 2Z35B 1HE7A 2WK2A 3ILPA 4QLWA 3J07A 2A83B 2HUEA 3QUXA 3N1GC 4MD5B 3GI9L 4EUPG 5B38B 3VU1A 4Y1SA 3EBGA 1PFOA 1B2WH 5DMGC 4BIKA 1J5HA 1I3RA 1BFOB 5KG9B 2FQGA 1WITA 2CXGA 1T21B 2WXGA 1A7PL 2QGEA 5DHEA 3DRQA 3X11B 1I3VA 1CT8B 4CU7A 4DKTA 3LS5L 2WLLA 2VC2H 3F12A 2NY0D 3EFDL 3L1EA 3ARDD 1HNYA 1LEGB 1UURA 5D5MF 3TBWB 2EKJA 2IQ9L 2AJUH 3R0MA 4CAGA 4ZFZB 2ZCZA 4OCRH 3UTPD 2K8MA 4QHLA 5E9NA 1ND0A 5AOMA 5K59F 1ZHLA 2MMXA 3UABA 4JKLA 4ALAH 2DWDB 3RVVD 4E9WA 1I8IB 1C5CL 1CDJA 2NR6C 3RVTC 4WEEA 4E68A 5GRYA 5EU3A 1VGEH 5B38G 3HMXA 4HOXA 3CH1A 2WBJC 1EA9C 2J6WA 2F58L 4N0RA 4M6AA 1E6OH 2FX8L 4LESA 5F7LB 3RVXC 2R8SH 1BMWA 3SPCA 4JPIB 3DNKA 3NJKA 4HBCH 1QSFD 2WTRB 3VFVA 2WTPA 5J57B 5EA0L 5BRPA 2HG5A 4HEME 3V6FA 3CU1A 3FQWB 3FT1A 1QO3A 2IDSA 4J27A 1NGWA 2P5WA 3KH4A 3HFMH 3HS9A 4K3GA 4UILL 2ZKXA 4AMXA 3STBA 4FEMA 2FQDA 3QB7C 1HDMB 4YXHL 1U3ZA 5I24A 3VI3B 1H3VA 2NW2B 3QHTC 5DUML 3QQNA 4H8WH 3OBAA 4XHJC 4JFPB 8FABA 2LU7A 3WHE1 3MV9D 4K3JL 1XGTB 3ZIYA 4IM8A 3HS0C 5BRZB 5MEPA 1MCBA 3BT0A 3T9WA 2C7UA 2J1XA 1NH6A 3IN0A 3MLSH 4GAJH 4D94A 4K8RD 3GS0A 2VDKL 4OB5L 2I7OA 1SYVB 4W6YB 3ZE1E 3ZYZA 1C08A 3TF7C 1TMCB 2ZUQC 1NEZA 4HWZA 4XP6H 1AKPA 1JGIA 2YAMA 3DBXA 4MD0B 4AVJA 3GGWA 4GUPA 4HV8A 4KQ4H 1IARB 3GBEA 5F9WC 1FO0A 1DZ0A 5AG9A 1NGPL 3NIDF 5I1DA 5I5IA 4DP8X 4HS8L 2QQQA 4HT1L 1MUJA 4F58L 3F7YA 3MRBA 2GW5A 5CEXA 1ECYA 3QZPA 2LU4A 1MKFA 1TZGL 3WO4C 3O6LH 2IPUG 3EJZC 4DZ8B 1B4RA 3C60A 4LB8A 4H88L 4YPJA 1RZIA 4WSJA 4AV4A 5I1CL 4B9JA 4R7DB 1WT5A 2IIJA 3N40P 4HU8A 3CVHH 4F9LA 5ICYB 3B2VH 1CLYL 2KZ1B 4APQA 3ZKSD 5GSRA 1L9MA 1A5FL 1TU2B 4BINA 1JF5A 4N3UA 4Z7QB 1CU4H 4P5TC 1NC4B 3EHBC 1UOLA 4GAAA 1TYJA 2BY2A 4MMYA 2X1XR 2OPCA 2QVFB 4X6DE 1USQA 5FYKH 2F54B 1UM5L 2EKSA 3PIQB 4ZMOA 5FGSA 4JO4H 3PDOA 1FAIL 2MCPL 3VRIA 1U33A 2F74B 1YPZA 4BBWA 4JY5L 1ICTA 1N6UA 2BVOA 2GJRA 2LLNA 2O6CA 1N10A 2XUWA 3A5VA 5DURB 5C0RH 5DJDB 5AW2B 3GMMA 5LGKA 3EJQA 4P2QB 5B8CB 4UDTA 1UH4A 4PWFA 1R34A 1NGZB 1GMIA 2JSFA 2R0LH 3W82A 3ARYA 4YQXL 1FVEA 2Z35A 3C2SA 3N5AA 2BSBA 1YEJL 4NHUB 3HI5H 2A83A 3KWXA 3C75A 4MD5A 3HJ0A 3NSXA 2RH0A 4LEXH 2ZUXA 4PVMA 3CFIC 3U30B 5B38A 1AFVH 1J88A 2VN5A 1PSKL 4H0LC 4MAZA 2O30A 1BFOA 3V5HB 5KG9A 2V9UA 3HG0A 1T21A 2L3BA 1BIIB 2D7TH 1JDCA 4Y5VB 2Q5BA 3HHSB 3QEQE 3X11A 1DANT 1CT8A 3Q06A 1GKEA 2GSGB 2QVIA 1FNSL 1RD6A 4JFZH 3EBAA 1LEGA 4XB8A 4PJBB 4XP5H 1O7DE 3TBWA 4AZ8B 4D2NA 2F9BT 2K6YA 2AHIA 3LZQA 1MCJA 1UVQB 4OFDA 4ZFZA 5CEZL 2D73A 1EZUA 2FD6H 5GGVY 1AR2A 4TM9A 3L4ZA 3VWJD 4IEFB 4FQCL 5A2FA 5C0EB 2EIDA 1ZLUK 2LTQC 2DWDA 2NY7L 5L7XH 1I8IA 4GFTB 2G9KA 1VAHA 4GI9A 5ALCL 2XBDA 3TZVC 1HILB 3FSAA 2MEJB 2E74C 2BVEA 1NAML 4J3VA 5FK9B 2MQ0A 1EFXB 2AK1H 3EO9L 2GCYB 4JPIA 1T0OA 1TJIL 1V05A 4QJ3B 1ACCA 5EU7E 3WNNA 1NLBH 1GHFH 2WTRA 2JCWA 5J1AB 2YFOA 5I1HH 2BPBA 3QNFA 1LILA 3L95B 2F8OA 3FQWA 4Q56A 1RK7A 5E6IC 4FFVD 3ECUA 1RZJL 1L6PA 4MYWB 1CTMA 1QHOA 2CO3A 5A7EA 4PRHE 4JQVC 2J8UB 2I9LB 2VQ1B 1HDMA 5JPNC 5AZEL 4JGNA 4IMKC 4IGBC 5I1IL 3VXSB 4I9WE 2NW2A 3VI3A 1DQJB 5EWIL 4JFPA 1R3HB 3MLVL 2VLRB 4G42B 1XGTA 3HVDA 4LSPL 5BRZA 4KXDA 2A38A 5DWPA 3V0HA 4LQFL 1A3LL 4FYQA 4TLTA 5FGBA 5L4IA 4IBVA 1BD2D 3F83A 1XIWC 4CILA 2J1ZA 1E90A 1SYVA 2R69H 3UJJH 2F8IA 1K5NB 4RFOL 1EJ6A 5JHDB 2PWGA 2CBPA 1WAEA 4OJEH 2ZXEB 2PXYC 2MHAB 1I31A 1Z9OA 2HFGL 2JI2A 3NA9L 4KROB 4L8BB 3MGOB 4MD0A 4ANKA 4B0MB 3VD1A 3IU4H 1YUHB 4A7UA 1YJDC 3AU0A 1EZVY 1U8QB 1NAKH 3DXAD 5FGRA 3JV6B 1ZVHA 4XNXL 3RKDD 3OKMB 4Q2ZB 2VDPH 4UIKL 3DUUB 4J3XA 2K7PA 5EC1B 3AG1B 4FG6C 5JOPD 4CJ0A 4YXKH 4DZ8A 4MAYB 4KXZI 2YGOA 4N5EC 2HRHA 3L2MA 1I8MB 2WQVA 1Q38A 5HGBB 4R7DA 1IM3B 3GRWA 3DMMD 4DEWA 5ICYA 1N19A 4RAHA 2YC1B 3K2MC 1ZPLA 2Y07L 1TU2A 3HLAB 4HA1A 1RK1B 2YD7A 2YUVA 4QHUB 2QTEA 4Z7AA 1NC4A 4P05A 5HHME 4DKEL 5E2UH 2B4CL 4FXKC 2C4XA 1AC6A 3SD5A 1BQHB 3ZDZB 1KBBA 5IFAH 4MZ2A 2BVTA 2WSDA 1ET8A 3P3RA 3HLKA 3CFEB 4LDCA 2L04A 4LSSH 3CVIL 3II1A 2F54A 4R83A 3PIQA 1JG9A 2NZIA 3IDXL 4J3BA 4WTQA 1GTNA 4F24A 3HUJF 3WJLC 2F74A 4P4KC 4KHTL 4P2OC 2I5YL 5E2TH 1TZIB 2FT7A 1COBA 3QI9C 3SQRA 1X7QB 5DJDA 5EUOF 3HAEH 4WEBL 1Z3RA 1J5CA 4L4TB 4P2QA 5B8CA 1F5WA 2DJ4A 1NGZA 1VESA 4AEHL 2VMDA 1CMOA 4NWUH 3D1MC 4NHUA 1FFRA 3UC2A 1BQHG 3DSFL 4DK3A 4E41B 3GLDA 4KVCH 5D9SB 1A7QL 1FP5A 3QR1A 3V5HA 1RUQH 2XU9A 1J8KA 1BIIA 4Y5VA 3LHPH 1VFAB 3HHSA 1Q94B 1FYHB 3HE7D 5D7LB 1M56B 2AXHA 2GSGA 2DJMA 2NX5D 2QKIB 3EO0B 4K8RL 4AJWA 3CQFA 1SEQH 4RA3A 4PJBA 1J8HB 4G70B 3VTTA 4AZ8A 5JXEA 1UVQA 1ZSDB 4XMTA 1RUML 1VEOA 1WV7T 1CI3M 5F7FA 1S9YB 2HH0H 4IEFA 2R0KH 5C0EA 2QJDA 5ECGA 3NH7L 1F6FB 4JR9H 2O61B 1FF5A 4ZMVA 3X3FL 7PCYA 3EADA 3T09A 1BGXL 1A7RL 2EDJA 1IT9L 4FS0A 4Q58C 4ZDHB 5I1AB 2OS7A 4YDKL 3ULAB 1HILA 3KGSA 3MV7E 3IXTB 1W15A 4KKBC 2UWEB 3POCA 4MB1A 5FK9A 4F57H 1EFXA 1NGQH 1SRDA 2GCYA 5CFHA 4DPRA 2A4CA 4PLKC 3PAZA 2FECL 3OPUA 4JG0L 5J1AA 3SDCB 4FKEA 4ODVL 3PWPD 3L95A 3VXMB 1J8SA 1N67A 5CBEB 1BF5A 4MZRA 1ADWA 2AC0A 1CXIA 1KFAH 4MXWH 1HNFA 3FHEA 2JJTC 5D2NC 1SF3A 5HDQL 2J8UA 2I9LA 2VQ1A 5I74C 4F8OA 2L4OA 3GTTA 3VXSA 4BXVA 2BM3A 3MBXL 1DQJA 1KGIA 4MHHG 1R3HA 2AXGA 3BQVA 2VLRA 4G42A 4H8PA 5T1DL 2WVUA 4LCUB 4X83A 1P4IH 3TVMB 5IBLC 3SDAB 3H0TB 4X5QA 2ZCHL 4NNPL 3IGLA 1E9QB 1K5NA 1FWXA 2EEFA 3CHXA 5JHDA 4TVPL 1QEXA 5TE6L 2QSCL 2AJVH 4G7SB 1ANUA 4L8BA 3MRQB 2MHAA 3EOTL 3TPKA 3A3YB 3MGOA 5EOCH 1LXMA 2MTPA 3SPVB 3QUYB 4YS4A 5MEQB 4MGXA 4I77L 1DVTA 1YUHA 3C8DA 3HG2A 2QV4A 3G5XB 2Z7UA 3EF4A 3OZ9L 1U8QA 3JV6A 5GRUH 4O5LH 2OI9B 1MFCL 3OKMA 2HT3D 1DN2A 2ZUWA 3L54A 3BKCH 4JB9L 4Q2ZA 2F5BL 2E5EA 3QUZC 3DUUA 1E4WH 4UWQB 5EC1A 5BXFB 2VUYA 2FO4B 2ZX5A 4QXGL 5KSAD 1N5YH 4MAYA 1SLUA 1I8MA 5HGBA 4MS8C 1IM3A 4YDZA 5MP6H 2YC1A 4X9FA 1E5AA 4FCHA 2VL4A 4WIQA 3HLAA 1L0YA 1RK1A 3GKWH 4QHUA 2BS8A 2NMSA 2WXRA 3QT2A 4P2RE 1JGUH 4XO9A 2EE9A 4N6QA 3D30A 4U1HB 5ICXB 1BQHA 2PN5A 3ULVH 2C9RA 1PW3A 4HWBL 1G7HB 2O5XH 3CFEA 3GI8L 4IHBA 1EH9A 2KL6A 4GIOA 4RMUA 1MVYA 2OL3B 3ARQA 5EO9B 3MA7B 1KT2B 1ZXQA 5IBTH 4KQ3H 4YPGB 2H32B 4YHYB 2IH9A 1Z1WA 4Y9FA 4IQHA 4M1GL 4K71C 3IMWA 3V95A 4GOSA 3N41F 5B3NA 4GRLC 3OHXC 1PQZB 3RVUC 1TZIA 2A9BA 1AD0B 5KYYA 4LIQL 5EBLB 3SD2A 4NIYE 4TUKH 1X7QA 4POZC 3AT8A 2Z6FA 3RA7L 4L4TA 3Q2WA 4LASL 1AGBB 1ROCA 4M1DL 2HN7B 2IV8A 4M7LT 4Z5RA 4JPKL 1D7DA 2ADFH 4DGYL 1B6DA 4MB4A 4WY7L 5DWUH 2P24B 5C6TH 5GIRB 2GKIA 4E41A 1F18A 4ILDA 3JBG7 5D9SA 2Y36L 3QZOA 4WK0B 1RIVL 4TQIA 4JGMA 2MSPA 4GQQA 1NMCB 4JG1L 1KDIA 1XGUB 2DKSA 3BDBA 1EJOL 1IC4H 1VFAA 5D6CB 1Q94A 4UNVA 5D72H 5D7LA 1IFGA 3QE5A 1FRGL 1GGBH 2QKIA 3EO0A 5DJCB 4FDWA 3O3AB 5HHVL 2V37A 4KXZH 3ERXA 1TEFA 4XPFL 4ZTPH 2E27L 5I19H 1J8HA 3AWGA 3SKJL 3PNRB 1BWMA 1ZSDA 1Z66A 4PLNC 3AREC 3CMOL 1S9YA 2ED7A 4KXBA 4PJ5D 1CR9L 3TV3L 3V9FA 2XV3A 3DO7B 2O61A 2M26A 1UKSA 3T0XA 2YD6A 1N4XH 1O75A 2KQMA 5I1AA 4ZDHA 3QJRB 5CJ5A 4HJJL 3VNYA 1KV7A 2CKBB 3KYNB 3MJ8B 3IXTA 3PJSB 3PXJA 4JMXA 4XNUH 5FYJH 1OWWA 5EN3A 1CF1A 3B2PA 1KWGA 1AO7E 1RHFA 2UWEA 3EJSA 3G5WA 1KNOB 2YGPA 5A2LH 1F3JB 4U1IB 1DCEA 2QSVA 1XMWA 4M8UA 4Z3GA 2O6DA 2FT6A 5FYLD 1NUDA 4B3VA 2ISDA 3SDCA 3CBJB 4UI2A 4G6JH 1BVKA 1M4KA 5IG7B 1YCSA 1DVFD 4MKTA 2DEYX 4GKSB 3KJ6H 3VXMA 1TTUA 1MRFH 1FNAA 2H6PB 3O0RH 4OUUB 5CBEA 1O7SA 3NA4A 5EOQH 1OP3H 2OMBA 4MA7H 3PWUB 2XN1A 2PKDA 2OYKA 2N3JA 3QUXD 1B6UA 4NENB 2ICCA 7FABH 3BCFA 3C5ZB 3KYKL 2HTLD 2BP3A 4HK3J 5TQ2L 4D7BA 3ELQA 3TWCL 3X3GH 2CO1A 4OT1H 4FTDA 2DQCL 1L7TH 4PJAE 4UV4L 4ZSOB 4LCUA 5I23A 4KFZC 1WICA 3TVMA 4XP4H 4L8SB 3SDAA 3H0TA 4AYID 4ENZA 1IZKA 1P4UA 1UD2A 1MQ8A 5L88H 1E9QA 2AEQH 4JUSA 5E56A 4N24A 1K8IA 4DVBB 3N1MC 3V79C 3MRQA 4PBWD 1WA1X 2DIBA 5KSBF 2JTYA 2ZUVA 3SPVA 3QUYA 5MEQA 5E8EB 4MTMA 3ZTNL 1BPLB 3G5XA 4LCWE 2OMUB 3IDMB 2E8ZA 5DQJB 1F4WL 5FF6B 4NBZB 2BHYA 2B14A 1PIGA 4B41A 3DK2A 5BXFA 4XN5A 2WOBA 1BXVA 2FO4A 2F1BA 1NCWH 4L1DA 3DVGB 2IMMA 2AV7B 1EO7A 2WIMA 1CLOL 2ERJC 4NZJA 4WKXA 4Y89A 3WE1A 4OLXH 4YHIB 3ISWA 2HXAA 3V4LA 5GGTA 1G0DA 3LVTA 2WO4A 3VWKC 1BVLB 1A3QA 1GVIA 4ACPA 4NCC1 3CHSA 3S5ZA 5H2BB 2XTJB 3F2LA 5ICXA 4B7LA 4U1HA 4UAOB 4W9LC 1BQUA 2E0PA 3WEXB 2V5SA 5I1LB 1MPAH 5I0VA 1U8NB 4GAGH 4QIRA 1G7HA 3H7BB 1MIMH 1NWPA 2VM4A 4FQQB 2OL3A 1SXZA 4HJGB 5EO9A 3MA7A 4YDLC 3DVNB 1F11A 1KT2A 3CHPA 4HCRA 2EDNA 3VSUA 4YPGA 2H32A 1A4KB 4CBPA 3WU1A 3V0VB 2NY1B 4KK5D 2CMRH 2EEDA 2WNGA 4QKTA 5CD3B 4GMTH 3U9WA 1RAMA 5T1MB 5DYOB 1PQZA 2BIHA 1P4BH 1AD0A 3CX5K 3WMQA 5EBLA 3MV01 3NIFB 4U3HA 5E9DB 1G6RH 5H8DA 1UUNA 1OAXL 1UOKA 1DVQA 2MTAA 5HY9B 5K9JH 2HN7A 3H3PL 3UZQB 1QFOA 2ZAHA 4G3YL 1SVZA 1DR9A 3EYQD 2D7QA 2P24A 1N70A 5GIRA 2WXLA 3GSNL 1L5GB 1P6FA 3QULB 3QXAB 1QX1A 3TEZA 1XGUA 5LO7A 2J2ZB 3WEMA 5CN3A 3DETC 3HB3D 1ZGLB 2XQBH 5D6CA 4Z7UF 2BSSB 5DJCA 4TPRL 1P1VA 3C60D 3D5OF 3O3AA 1R3JB 5I6PA 5MHSD 4U0RC 3HZYB 3JWNH 1E4JA 1WLHA 3P3YA 2J57A 2BW4A 2V7HB 2ZYSA 5EU6E 4APQD 5E6ZA 4L2YA 1I1AC 2RQ8A 4A37A 4FD0A 1SBSL 2WBXA 3V4VL 3L5XL 2XV2A 3AVEA 3DO7A 3ARVA 3SKUD 3QYMA 3MXWH 4Y0GA 3BPOB 4GO6B 3M45A 3TC9A 3GLZA 1VFMA 4Y8DC 2WP3O 4EDWH 4JFFE 4OI7A 5FFGA 4L9DA 1EVUA 3MJ8A 2CKBA 3KDMB 3KYNA 3PJSA 3UTSB 3ZQWA 1OD7A 2WXQA 3T6ZA 1KNOA 1F6AB 1F3JA 1FE8L 4U1IA 4TV3A 5IQ7H 3ALPA 1X4ZA 2XVBA 3OC8A 1QKZL 4I7ZC 4P04A 2IV9A 5D71L 3I50L 2Y72A 4UV7H 5B1KA 4LVNC 5I0YA 1KC5L 2XIBA 3QZLA 5IG7A 3NCYS 4UBDC 4GKSA 2G75B 2FBOJ 1E0OB 1SXAA 1V3LA 2H6PA 4OUUA 2JB6B 3HE6C 2F7IA 4ES8A 4N8VG 4IBLT 4NZRL 3PWUA 5GS0D 4DO5A 4A7VA 4JFTA 2CNYA 4CBZA 1PD6A 2NTSP 2E9WA 4NENA 3IM1A 4HGWB 3C5ZA 4QXVA 5AZ2L 4RSYA 1EBAA 1O7DC 2Z8VC 2ICES 2JKXA 2UYLB 5HHOB 2F7OA 4CU6A 1KBWA 2VLJB 4FEIA 1II4E 1MJ8H 4ZOAA 5AYUL 1FNGB 1ONQB 3K7UA 4XX5A 2P4AB 4S1RL 4ZSOA 4M7ZC 4FQLL 4XMVA 2HKFL 2F53B 4L8SA 5D70H 4WUUE 4DESA 2YQ3A 1OTUD 3KLAB 4Y19B 1NM4A 4N87A 4PJXE 2F7PA 4DVBA 3WNKA 4D9RE 4XVJL 3VXNB 1YLBB 5GGQL 2BRRL 4J6RH 4HUVB 3OZLA 1CQKA 5E8EA 5GGSB 5T1KB 2VQUA 1J7VR 2X1PA 4F8TA 4X9IA 2OMUA 3IDMA 5D1ZC 2VDNL 5DQJA 5FF6A 3SO5A 1A0QH 4BWTA 4B6ZA 2YPVL 4DGIH 3FSVA 3WI9A 3LJ3A 4FQ2H 4V1DB 1CFBA 1HZKA 2VDLL 1ADQL 3DVGA 4J3OG 2AV7A 2H7WA 2YLKA 4V2BA 1HXYB 1A7OL 5LKNA 3BQUB 3BKJH 3CFCH 3FPYA 4YHIA 3NPZB 3V0FA 1BVLA 4M8RA 4IOSD 5G4NA 4H26B 2VSKB 3WNPA 2A74C 5J13B 4XMUA 5AYTA 5J1TC 1WC7B 3QJHB 1KCUH 4U1NB 4UT7L 1DL7L 5H2BA 3RIAF 2N1TE 2VXQL 3CVDA 3WEXA 3ESUF 5I1LA 5D8JH 5DVMA 2VR5A 1U8NA 5IVZB 1SVBA 3H7BA 3KS0H 4JCWA 1F3RB 4FQQA 4HJGA 2GG1A 1B90A 1Y6KR 4YBLC 4GIPD 3DVNA 4OLEA 2R83A 4HIJB 4U7MA 4F15C 5LVEA 1D6VH 1A4KA 1WWBX 5BRZD 3V0VA 4ODXB 1IC7H 4ZNCD 4GI8A 5CD3A 1JZ4A 5T1MA 5DYOA 2NUTB 3ZLQC 2Q10A 5EZIL 2DKMA 2P47B 5C3TA 1IX2A 1FL3B 5E9DA 1JPFB 4LMQI 1KTDB 1VFBB 4KJWD 3T4AB 3ZL4H 5IESH 4GRWB 3S0PA 3NIGF 2KQNA 5HY9A 2V2WB 2NSXA 3UZQA 1CFNB 1U8PB 2FHCA 2W9EL 1L5GA 3FSOA 4OZHF 3QULA 3QXAA 1NM9A 2NDFA 4NN5B 2J2ZA 3MXVH 3QS2A 3WTUA 3PJNA 1ZGLA 2FNWA 2YKKA 5AYQA 3KPRB 3BWSA 3HIZA 2BSSA 1R3JA 1YNLL 1AVAA 1P9MA 1Q9KB 1YSOA 3QRGL 3HZYA 3T3PB 1MVFA 2V7HA 3WV0A 3HW7A 3ZW3A 4AYEC 1L9QA 4ZX4A 3IU3B 1S7XB 4N8VA 1D5XB 3I6LD 1NC4D 4XP1L 1UWGH 1JI1A 1TNMA 1G9NL 3V5DB 2C34A 4LBEB 4WK4B 5KANG 5JMRA 2QPDB 5JQ6L 4IDJL 3HMXL 1CLCA 3KDMA 3UTSA 3C2AL 2F54D 2E7LA 2EEXA 1TQBB 4F20A 4YLCA 4H8UA 1JYNA 2EYRB 1G5GA 1YEFH 3O3EB 1F6AA 1VADB 2VR6A 3BPLB 3P40A 3QXUA 4QOKB 4OGAC 5AB2A 4WSGA 1G84A 3P4LA 2H2PD 5I71C 4F33B 2YXVA 3WCYA 2G5UA 2G75A 3L2NA 4KKCD 5C08B 2YLHA 2YOAA 3IDJB 2JB6A 3FZUC 4P2QD 3BE1L 3OPZL 1PD1A 2DMHA 4WJG3 3R7RA 3CZGA 3LZFH 4Z7VE 5DU7A 1P1ZB 4HGWA 4L05A 5EF3A 2YA1A 1EAQA 1FYTB 3BYYA 3MC0A 2UYLA 4XT1C 1NCBL 5HHOA 1L7IH 3VFRB 4EZJA 1N0XL 2VLJA 3CFJB 2IBGA 1FNGA 1CXLA 1ONQA 1PS3A 2CA3A 4F92B 1BEYH 2OULB 3FB5B 4PSRA 2F53A 2C8NA 3EGXB 2QQKL 4ZS6D 5ENWB 3KLAA 4Y19A 1LP9E 5JXED 5BZZA 3IPBA 2R0WH 3ARTA 3LIZA 1HWGB 3SQBB 2XXMB 4WEUD 1IAKB 3RBGA 1KBGH 4RMWA 4IRSB 3VXNA 3WFEL 1KN2L 1S46A 1OM3L 3VFSB 2CIIA 4HUVA 2HT4D 1N26A 4X50A 4GT7A 3TH3T 5GGSA 1OE3A 4BFKA 5T1KA 4ANWA 1NBVL 1FH5L 4G6MH 2XVKA 3QXTA 3PYCA 1NMAH 4NGHH 4F7PB 3FNKA 4S1SL 1G9NC 3CBRA 4V1DA 1KN4L 3IBOA 5D7IB 2Y2TA 3L9EA 1EFXD 4U1GB 2K3HA 3BO8B 3N85L 3FUDA 3WL9B 1NGXB 5IVOA 1HXYA 1OALA 3V4UL 2EE6A 3BQUA 3W0WE 3DX1A 1RZKL 1FZJB 1PVHA 4B5ZA 1WIPA 4H26A 5TFSL 3HOGA 3GXPA 4RDQG 4F7MB 4ZFGL 1WC7A 3QJHA 2VNCA 1MFNA 3CQQA 2DLTA 4OLYL 1UH3A 4U1NA 3HZMB 3QQDB 3FQ4A 3PAUA 1UWEL 1U2YA 2FB4H 3OB0H 2HT2D 5IVZA 1MFBL 4ZTOL 3VXSD 4RVBA 4X8JB 4FQXD 1M9WA 4HIJA 2YWYA 4OJFH 2ITDB 5DJ6B 4DF9A 2WWMC 1UZ6F 1K4DB 2VLRD 5HVGB 3EUUA 4ODXA 1W72H 3T8XB 1SHMA 1I9JL 2LGNA 2NUTA 2DYPB 1OZTG 3ABLB 1TJHL 1FL3A 1E4KC 1JPFA 3ZO9A 1KTDA 1VFBA 1DBMH 3T4AA 5JHDD 1KG0B 2P5EE 3BUIA 3KVDD 4UZUA 1TSRA 5FO9B 4Y4HB 4ABVA 1WDAA 3MFFB 4JO1H 4KROD 5GS0L 2V2WA 2CKNA 5D7KE 4AEIL 1CFNA 2X53A 4KPHH 1ZVYA 2F5AH 1U8PA 3L4WA 3MV8E 1PJ9A 5IJDC 4QRRE 1ACYL 4H0HB 3KPNB 1E67A 4K94L 3HAEG 4ZOEA 4KK6D 1MRDH 3BUYB 2VDML 2WNKA 3BSZL 4WHCA 2BP5M 3KPRA 4TKWA 3MLYH 3BP7B 4MAYD 2G5BB 3QYCA 5ESVB 3S2CA 3EJCA 3KWVA 4OF0A 1Q9KA 1DQDH 2VWEE 2DQIH 3SE4A 1XH1A 2EDDA 1IM3D 1J0JA 1MCEA 5A3IC 2EUVA 3FQRB 4WWOA 2YPLB 1JE6A 2DRUA 4GPVA 1JPEA 2IPTL 5KVEE 3IU3A 1S7XA 1AI1L 5F0JB 1D5XA 3QIUA 3ES6B 3S36H 5EO1B 4Y4KC 2JJSA 4N20A 1CF8H 1OARH 4Y2OB 4YE4L 1OF2B 3V5DA 1MF2H 4LBEA 5J11C 4HC1L 4GQ9L 3DJTA 4M43L 2YRPA 4NZ8A 2HKHL 1UGKA 1V8HA 3IMTA 3ZZQA 1L9RA 1JPTL 2EYRA 3O3EA 4G6KH 1VADA 4QOKA 2HVKB 1KGJA 1M7DB 1L4IA 2NXZC 3LPOA 4JRYB 2DQHL 3IJ9A 3I3EA 5E0FA 5K9QG 3RFZC 2AQ2A 4F33A 1NINA 4JNXA 5C08A 3FU9A 4XMKL 3IDJA 4L4TD 4WJ5B 5D2LF 3KYMB 1A6VL 2JH2A 1C7TA 1DO6A 3G04B 1A6PA 3KH3A 4AMKL 4GT0A 2VDQB 3SBWA 4ZZKA 3VFUB 3A6OA 1P1ZA 3QDMB 4LCYB 4E41D 2B1HH 3NCCB 4A68A 1QFUL 1FYTA 1WFOA 3VFRA 2ITFA 1ACXA 4KHXH 2EABA 5I5JA 1N6VA 2VDOL 4PGBB 2CJUL 2R59A 5D7LD 3FB5A 1QHQA 2Z9TA 1MRCL 1V55B 3LH2L 3GPEA 1QBML 4RESB 4DAGL 3OXSB 2OMYB 2I9TB 3EGXA 5CLWA 1J8HD 4HHWA 4EBQL 5DMIH 5ENWA 1QP1A 2B5IB 1GYUA 3KM2A 3ZQ9A 4PGJA 3QG6B 2OYLA 1BXXA 1QPKA 4NLAA 1JBJA 3SDYH 3WIAA 2B0SL 3SQBA 4HJ1A 1DSFH 1IAKA 3QR0A 1R3IH 2JELL 2A4EA 4IRSA 3F01A 4Y1AB 3VFSA 3KZ8A 1NCUA 4TRPL 3OAZH 2QPFA 2XFGB 3BDXA 2OYPA 3F6JA 4RMSA 3GBML 4KRNA 4N0FB 1V7NH 1T22B 4TUUA 2ZQKA 5D1XB 4ELMB 4F7PA 3QPXH 4XNMB 4EI5C 5D7IA 4B0MM 3VXPB 2ICWI 4WV1B 2BZDA 2EDWA 4JZJC 3BO8A 4TNVF 3WL9A 2DEWX 1NGXA 1TZ8A 4LLQB 2AJXL 2HX8A 4KK9D 2QVKA 3GRWL 3SDCD 3ZL1A 4C56E 3V4PB 1UXMA 1FZJA 1IGCH 2CPUA 3VXMD 3HNTH 3VFMB 2CUIA 4B95C 3H9SE 3WIHA 1PX4A 4F7MA 4FNLH 2O5ZH 2V17H 2HFFB 2RCSH 4WENB 2ZCKL 3HZMA 3QQDA 5AENA 2JI1A 1JFHA 2PETA 4MLIA 4O02H 2EVJA 1UM6H 1AHMA 4X8JA 2WLNA 1H9VA 2AJZB 1JFQL 1PL3A 1RI8A 4EXKA 4HF5H 2ITDA 1JTOA 1K2DB 5DJ6A 2COQA 1K4DA 3MNZB 1L9PA 1KYOJ 1UZ8B 3IDYB 3S7GA 1EO5A 2CNZA 2DTMH 4TLUA 5DT1H 1QUNB 3T8XA 3TVMD 4NN6C 1UFGA 1LO3H 2DYPA 3GXDA 4X4KA 3SDAD 4Z3JA 2H9GB 1AQ8A 3LY6A 3E3QE 4GS7B 2J55A 2DM4A 5CINH 3K71B 1T20B 5B1AB 1KG0A 2I27N 4U0QB 3CDZB 4KKLC 5TF1H 4P5MB 1QWNA 4Y4HA 5FO9A 3ZGIA 2AJYH 3MFFA 1DBBL 2LU5A 5FCUH 3T5WA 1SM3H 1A6UL 1YMHB 3ZO0A 3QUYD 4AX3A 2EIMB 3NCEB 1AR1B 1LMIA 5AW3B 4LU5L 4B9IA 3KPNA 3IE4A 1S3RA 3BCDA 3TEXA 4OGXH 3B8SA 3VA6A 3BUYA 4ZRGA 5DD5H 1ZY9A 2CDEB 4PFEA 5GSVB 5EEZA 3S4SB 2MCAA 4CVXB 3SE6A 3BP7A 2G5BA 2C7FA 2IG2L 5ESVA 5CR1A 3O2DH 3E6HB 2H0EA 4OSUL 1D5IL 1WWCA 1ZS8A 4PJ8C 1Q8MA 4JZOB 4MJJA 1TZOA 2Q3XA 1AXTH 1JXGA 3FQRA 2KKQA 2YPLA 4NAMA 4KZCA 1MW0A 5C6PB 3ZDYB 1Z32X 3WTWA 4M6NL 3ES6A 4BQ6A 5EO1A 3LYRA 5FUOH 2F7QA 4HPOH 2X3AA 3P0VH 1R0AL 2DQEH 1KELL 4Y2OA 1OF2A 2WCGA 1GZHA 3CZFB 3CC5B 2OTPA 2BY3A 4Y16C 3E1ZA 1BLNB 4K5PA 4BK4A 2J6EA 2YMXH 1IJNA 4FNTA 4K2UL 1GPOH 4OM0H 4PJ7E 4YO0B 5IB1B 4PMFA 5E8DH 1DANU 25C8H 3BGFC 1KB9J 2HVKA 4MNQB 4X98B 3S4SG 2YK1L 3JUYA 1M7DA 3SY0B 3I6GB 3WIIL 4DO4A 1OAKH 3TYGH 2V3FA 2EIKB 4JRYA 1UCBH 4QMEA 3V10A 1HSBB 4ONGH 2NQCA 2FO8A 1EZLA 4XNBA 5T5FH 1F00I 4JFOB 4AQ8A 2R4SH 4WJ5A 1DQLH 3KYMA 1OP3K 3OG4B 3G04A 3QAQA 3UX9B 3VFUA 4MX7B 3RZCC 3QDMA 4LCYA 2V3EA 1FZKB 1S5HB 2PP7A 4PSPA 3LMJL 4NQCE 3TCXA 2NTFB 1CLVA 5L8LB 2IDQA 4AUUA 1ITBB 1JPGB 4PGBA 2DLIA 4R9HA 3GINA 2AJSL 3B7YA 1LTXA 4B9ZA 3OXSA 2OMYA 1ZRUA 1KBVA 1FLRH 4L3FA 3Q6GL 3LAFA 3DPBB 4P2YA 4R4BB 4OM1L 3QG6A 1SMAA 4WW2F 4Y1AA 4ISVB 4Q7DA 2ZUUA 5BCAA 5C3LD 1JTPA 2Z7ZA 3STZB 1P7BA 4N0FA 2YPKB 1T22A 5D1XA 4ELMA 3JYCA 5EF1A 4KVPA 4XNMA 1MFAH 4N2CA 4E9RA 5IOPB 3VXPA 3V52L 3W2DH 4WV1A 4PJIE 3QO1B 1ASOA 3L4CA 2IWFA 3WFDH 3GHBH 4LLQA 1Q1JL 3H2WA 4M3JA 3QCUH 3VG0L 1KUMA 3V4PA 4KGLA 1RUKL 4YHKL 3RDTB 5KYWB 3VFMA 3NRPA 4FGMA 4JM2B 5DHDA 2DQUL 5B3JE 2HFFA 2Q2LA 1JVKA 3V5KA 2WVVA 5FWRA 1NFAA 4PJ9C 4UOZA 1J9TA 3FHAA 1CO1A 1KENL 3KBEA 2OSXA 3RNKB 5GRJL 2YUWA 2Z64C 3W37A 1YY9C 2AJZA 3UBFA 3JYBA 5FYKE 1K2DA 2AV1B 2FTAA 3MNZA 5I15H 2E4TA 2NXYC 2X2YA 4RMVA 3W11D 1UZ8A 3MRKB 2YAFA 3B43A 3TBBA 1QUNA 2M1KA 1X5LA 1OP5H 2H9GA 5AAPA 3B2UD 1QSEE 1BBJB 2IFGA 2LABA 4A6YB 3K71A 2EDXA 4BDVB 1T20A 4OCSL 4K15A 4UNTA 1RMFL 3CDZA 3NCBB 1HC1A 4P5MA 1C5BL 3SDXF 2BZCA 4OJYA 4DO6A 2HRLA 1YMHA 3WNIA 5I6XB 2LQRA 2J5LB 2Q3ZA 4PB9H 5TE4H 4W4OA 2QADB 4GXVL 4HCFA 4CN1A 1A8JH 1AGEB 1EMTL 1OAQH 1KJMB 5EHFA 2OR9L 3ELAT 4LGSB 4DQOL 4YEEA 2FX9H 3LSOB 4LSTH 3D69B 2CDEA 2HZHA 5GSVA 3S4SA 4CVXA 3K6OA 4FLQA 4JDTL 1R5VB 3E6HA 4O4YH 5AVUB 1PG7H 4JZOA 4K3DL 1LHZA 1LD9B 1EEYB 4G9DB 1MREH 1I9IL 1TVDA 4O2CB 2IJ0C 3K74B 3S97C 2ORBH 3TURA 1JWSB 2ZJSL 2ZX9A 1E5YA 4A7SA 3ZRSA 1A6WL 4OQTL 2DD8L 3JWNG 3CZFA 3CC5A 3SO3B 1CDIA 3LEYL 3QWNA 2B3IA 4AQZA 1BLNA 4OD1H 2IBBA 5L2KB 4FJZA 4RGOH 4YO0A 1CXHA 5IB1A 4Q6KA 1MWAB 5B39G 2NY1D 1SHWA 4MNQA 4X98A 2YJLA 3AWFA 3SY0A 3GJFH 3I6GA 3OLEA 3BWAB 2DM3A 2AITA 1GZPB 3LH8A 1JV2B 3OKYA 3PWJB 4KOBA 2HJLB 1HSBA 4WWKB 2QSTA 5E9DD 4JFOA 3S3BB 3M8OL 1G0YR 4ZUSB 2IGTA 1IMHC 4I18C 1HU8A 3N04A 1HWWA 2FCBA 1GGTA 2ZWZA 4MMXC 4MX7A 4JKWA 4QWWC 1DTUA 5J9PB 1KLUB 1FZKA 1S5HA 4MFHA 1NCTA 2IWKA 5F9JB 5HVFB 4UM8B 2NTFA 1CD1B 3GTVA 4J1UB 5E2VH 3JSSA 1OAZL 2UZPA 2X6CA 1JPGA 3U2IA 3MHZA 3U83A 2F8VA 1AC0A 3ARSA 2VDRB 3MTRA 2D3LA 4NQDE 2ETWA 1TF4A 1ZWIB 1MLBB 1EK3A 3GQFA 1KXQE 2XTLA 3P2DA 3DPBA 4FULA 1IBGL 3ABKB 2HVJB 4R4BA 2WIIB 3M1OA 4XZ4A 5A2JH 3NZHL 3O2WH 4PH8A 1BQLL 2JKNA 1B4TA 4ZMWA 1X5IA 5F7NC 2EYSB 3P0YL 2BFVL 2FJGB 4ISVA 2R4RL 2DQDH 4R5XA 1HJBC 5CP7B 1ZLWH 3STZA 5J4MA 2YPKA 5JZ7D 4YSSA 3UTSD 4WUKH 5AKSA 5IOPA 4EJ1C 5DJZB 2B2XL 2ENSA 1O0VA 3KJ4C 5L2JB 1HJCA 3QO1A 5EMYA 5AWNL 4JKPL 5IMMB 1QRNE 2JJVA 5FM5M 2DYRB 2E4FA 4PIBA 3KE0A 2AI0H 3W9DB 2NCEA 3RDTA 5KYWA 4H2CA 4S10A 4FL4C 3OSVA 5EUOB 2BDNH 4JM2A 2QDWA 4KZ0A 3H8NA 1NLDL 1XSOA 4Z18A 1R3LB 3FL7A 4PP1C 5FWQA 5FDWB 4HIXL 3HKZA 4Y1TA 4RISH 4NKMB 2XN9E 3WEBA 3ZPDA 5I1JH 3RNKA 3O9WC 2GITB 3V9CA 3EO1B 5B1BB 2VXSH 2XWCA 1TXKA 3BVDB 3LZOA 3Q8EA 5HHOD 2VLJD 2AV1A 4WI4A 3VSQA 2LFEA 4ZD3L 3UBXB 4KUZL 2W07B 3TT3L 3MRKA 2UV3A 1UG9A 4J3OD 2CHXA 2ZX8A 3IF1B 3CD4A 1U8LB 2F53D 4R7XA 1NIAA 4QHNB 4HIQA 1UASA 1KGCE 3IXAB 2XN0A 1BBJA 4A6YA 1B0IA 5E4OA 1VLXA 4NZUL 2EDBA 4Y19D 4BDVA 4XPHL 1X7SA 3QFJE 1EXHA 4Y4FC 4PD4K 3HNVH 1P53A 2W0KA 1U9KA 3Q13A 1O6SB 1J0YA 4HKXA 4FI7A 4OCWH 3UTOA 2PF6A 5D1QB 5B1JC 1KIPB 3CLEH 1PZAA 3Q2NA 5T1KD 1VCBC 3OR6B 5CZKA 4AIEA 5DVLA 4BSWB 1AGEA 5CZXC 5KVEL 4NI3A 3SHSA 4YGVB 1KJMA 3O2VH 3L4TA 3OG6B 4BFGA 4YFEA 2V5MA 2YD5A 3LSOA 1DVSA 4KAQH 5FHBH 3D69A 4FE9A 2RQEA 4MVBC 2X89A 4V1DD 5F7DB 4H4NA 1XDTT 3UBXG 2L7EA 5FM8A 5I0WA 2X9XA 1R5VA 4JPVL 4UTBH 1M1SA 2JK5B 4JGUA 3EXLA 3BQUD 5A2BA 2I60H 3UIZA 1DDTA 1DVUA 4MMZB 1F8TL 1LD9A 2NY4B 1FLTX 1EEYA 3ZMNA 5LB1A 2UX6A 4G9DA 3SYAA 4GUOA 4O2CA 1JWSA 4M6OL 1ZLEA 3UC0L 3L4UA 1MQKH 5ADOL 4I0PB 1SN2A 4FXGB 1A25A 5IVNA 2ZP8A 4QPEA 5LN4A 4D9LH 3U4AA 1YC8A 3KXFB 3FSWA 2CJTA 5L2KA 3VX1A 5E4EB 2DIAA 4Q6IC 4ELDA 3S34L 5DVNA 1MWAA 1BYNA 2DIJA 3HC3L 2V7NB 5CZVH 2YA0A 3B9KB 2EEBA 4GP5B 5I30L 3ZUCA 1RZPA 3ARDC 1QFWH 1SOQA 4FI6A 3BWAA 5CJQL 5ANMB 1GZPA 1JV2A 1OT4A 3PWJA 4XBEH 4GG6F 2HJLA 4WWKA 5DJ8B 3H9YA 2OMZB 5EIIB 5BV7L 4JJHA 4I2XB 4TTDD 4ZUSA 3RVVC 1N8OE 4Z1PA 4LAJH 1FIGH 5DO8A 2PP8A 3X17A 4PVLA 2GC7C 1FNLA 4LRNL 5AUMB 5J9PA 1M6OB 2G3MA 1KLUA 3VGGA 5IHZB 4NNYB 5F9JA 1YJDH 5IGXL 4UM8A 1CD1A 5FOBB 1F4XH 4J1UA 1UA6L 5F1SA 4FHKA 4TQEH 1DJYA 3ZYOA 3RYMA 1FPTH 3KPRD 4BQBA 3UZEA 1ZWIA 1MLBA 1V7MH 2BOLA 1QI5A 4EIZC 3GEFA 3BOVA 1NMBL 3G5YB 2HVJA 2DMCA 2WIIA 6CGTA 4R26H 4L5FL 4FZEL 4MZ3A 4N4YB 5IT2L 4XBPB 2B1AL 3FPXA 1JMZA 5FHAH 4Z95L 4ZFOB 3QIUD 4MCZB 2K0RA 1J1XL 2YAHA 2EYSA 2FJGA 4BK5C 2VE6B 1I85C 4A7QA 5CP7A 1E5BA 3MOAH 2AEPH 5C7XH 1JN6B 5B21A 5ITBL 5EDXA 2P5WE 4P3DB 1EGJA 3QG7L 4X5WB 2BXZA 4G9FE 5DJZA 3ZRFC 4HOMA 1XF5B 2ZXQA 5L2JA 4BZ2L 4JREB 4QOKD 1INQB 5I1EL 5IMMA 5DA4A 4H0GA 1ZANH 5GZNA 3N41B 5K1JA 3W9DA 4UF7C 4JY6B 2XV6B 4HUCA 5HJBA 1XBRA 1PEWA 1YMMB 2X6VA 5CNHA 1IQWH 1SXNA 2VR7A 2UY7B 5EUOA 1LWHA 1TG8A 2Y7SA 2K6WA 1XB3A 1R3LA 2YBRB 3VFPA 5FDWA 3HMWL 4NKMA 4XOEA 3UPAA 1BJMA 3MCLL 3OB0K 4G5ZL 4X5PA 4ETQB 3ULVE 2GITA 3EO1A 4UMSA 4E9YA 3H42H 1FYTD 1NBZB 3VGDA 3FB7B 4ZX5A 2ICEB 1GY1A 4L48A 3UBXA 2W07A 1XB8A 4ABQA 3SZKC 3IF1A 1U8LA 3MRCB 3RUGE 3NACH 4QHNA 4POUB 4DP1X 3IXAA 1B2WL 4TUJB 4AW7A 3H55A 2D3VA 4C55A 2ZG3A 3S5YA 4AZUA 1QR4A 4WCYH 3B7UX 4WI9A 1SLWA 1KBKA 4IRSD 1O6SA 2VC2L 3TIDB 1GH7A 2AAAA 2EE3A 5D1QA 1KIPA 4XI5C 5CR8A 3OR6A 4BSWA 5D6DC 1JZ2A 1P2CB 4OCRL 4YGVA 3HJEA 1WAPA 1VKXB 4GSXA 4UINH 1EEZB 1H8OA 3EJYC 4ALAL 4W9IC 5F7DA 3VU2A 4BCYA 1T7YA 2Q20A 4H1LH 3MRNB 1HCFX 4WFGD 4MS6A 1IBZA 4YSQA 2JK5A 4PJ6A 3TBCA 1VGEL 4F9PA 1ZT1B 2OV0A 2HWZL 4MMZA 2N7SA 1W8NA 1ZS2A 3SE8H 1IBFA 2R8SL 1HHHB 1CL7I 2BOCB 4MJIE 4HBCL 3ZVVA 4I0PA 2XJKA 3RX8A 4FXGA 4LVOB 2W94A 3SBRA 1MCCA 2OAAA 4G6FB 3BPNB 3KXFA 4XGZB 1LMKA 3E3QC 1MCSA 3V0GA 4JQXC 4OBRA 4HALA 2MNJB 1NIEA 2AQPA 3QAZC 5FYJE 1IC1A 5AAWC 4ADIA 4PY7B 2V7NA 1KZYA 3A67H 1VSCA 3B9KA 3NQKA 5ANMA 2DYPD 4KI1A 4H8WL 4KMLB 5DJ8A 2OMZA 2VQ4A 5EIIA 5JPMB 4I2XA 3JTBA 4LP8A 4Y4HD 2N0KA 3MLSL 2MOVA 4GAJL 4G7VL 3MLZH 2DI9A 5KSBB 3OJ2C 3RI5K 4XN4A 3GK8H 2QVTA 1L3WA 1M6OA 2ED6A 5AUMA 3S5LB 5IHZA 3KPPA 1O6TA 4XP6L 1HQ4B 5MENB 4NNYA 2AQ3A 4H13C 3LHAA 1PKOA 4OCMC 4QRPB 5FOBA 4AENB 2WCPA 3EBIA 4KQ4L 3C08H 4Y2LA 1AXIB 1TQSA 2AMGA 4ALAC 5HHXH 1BWWA 3KPSE 4C59B 2RALA 4FFVC 2C3GA 4HK0B 2A9NH 2NZ9C 5ILTH 4MJ5B 4EOWH 1NWOA 4X8XA 2YPLD 2DM2A 2PW2B 4X5XB 3UDWC 4XBPA 2YJQA 1GGYA 1EZVX 3O6LL 3VXUE 4ZFOA 2VKXA 3H53A 2DLGA 5CJXA 3FT0A 4WAFA 4RGNE 3QDJE 3OAZK 3CVHL 1BECA 2VE6A 3BEWB 5EB9A 3BD5A 5DXWA 2H1PH 3QO0B 1JN6A 3QIBB 1JSYA 1T1XB 1CU4L 4P3DA 3RVWD 4X5WA 1FFOB 3L48A 1XF5A 4GBXB 1T2XA 4GO9A 2Y6SC 1INQA 2ZD0A 2XPGB 1G9MC 4ORGB 5FFOA 1XFPA 3RWCB 4JRYD 2EE0A 4U33A 5FYKL 1KJ3H 1RY7B 4JY6A 3LDBB 4QNPF 1YMMA 5A2AA 2UY7A 2RMNA 4O00A 3DOHA 5LCVH 2YBRA 1PKQB 2E75C 4DW2L 5C0RL 2V9TA