1E9QB

Crystal structure of bovine cu zn sod - (1 of 3)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
151
structure length
151
Chain Sequence
b'ATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDDERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTSTGNAGSRLACGVIGIAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE
publication title Conformational Variability of the Cu Site in One Subunit of Bovine Cuzn Superoxide Dismutase: The Importance of Mobility in the Glu119-Leu142 Loop Region for Catalytic Function
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 41
structure length 151
sequence length 151
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2000-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1e9qB00
2WWNA 3QQDB 2WWOA 2VR7A 4MCMA 1ESOA 2WYZA 1DO5A 3LTVA 1YAIA 2ZKWA 5KBKA 2JCWA 2VR8A 1OALA 1JK9B 4FF9A 4N3TA 1Z9PA 1F18A 4OJAA 2AQSA 1OZUA 4L05A 1XTLA 3ECUA 3L9YA 1P1VA 2Z7ZA 1EJ8A 1TO5A 1XSOA 4MCNA 2Z7WA 2XJLA 1E9OA 2AEOA 2WZ6A 1YSOA 1IB5A 1SXCA 2AF2A 2E47A 1XTMA 2WYTA 1E9QA 1BZOA 2AQRA 4A7GF 2C9UA 1SXSA 2GBTA 3GZQA 2WZ5A 1BA9A 2K4WA 1SXNA 3CQQA 5KBLA 1MFMA 1F1AA 1QUPA 1OAJA 1SXZA 3K91A 1E9PA 1Z9NA 3H2QA 2GBVA 1YAZA 2XJKA 2VR6A 1F1GA 3CE1A 1OEZW 1IBHA 3RE0A 2JLPA 3F7LA 1CB4A 1PTZA 1RK7A 2ZKXA 1IBBA 4U4IA 2WKOF 1U3NA 3HFFA 2WZ0A 2E46A 5KBMA 3SODB 4BCYA 4BCZA 1CBJA 3H2PA 3GTTA 1UXMA 4A7VA 5CU9A 1SXAA 2AQPA 2Z7UA 3KM1A 1IBFA 1AZVA 3MNDA 1SDYA 3GZPA 1TO4A 1JK9A 1IBDA 3HW7A 3GZOA 1B4TA 2SODB 1DSWA 1UXLA 3ECWA 2C9VA 3T5WA 1SOSA 2ZOWA 3KH4A 3S0PA 1SDAB 3KBEA 3KBFA 1E9OB 1SPDA 4N3UA 1S4IA 2Z7YA 1SXBA 2WKOA 3CQPA 1E9QB 2Q2LA 1N18A 1PZSA 2C9SA 1F1DA 2R27A 1L3NA 2V0AA 4OH2A 4A7GA 3QQDA 1FUNA 3GQFA 2AQNA 1COBA 4BD4A 2APSA 3ECVA 3MKGA 1HL4A 1B4LA 1E9PB 2AQQA 1HL5A 1N19A 2GBUA 3HOGA 2NNXA 1PU0A 3GTVA 1OZTG 3KH3A 4B3EA 3F7KA 3PU7A 4A7QA 3L9EA 2ZKYA 2AQTA 4A7TA 1Q0EA 1JCVA 3KM2A 4A7SA 1SRDA 4A7UA 1KMGA 1EQWA 2LU5A
chains in the Genus database with same CATH superfamily
5I74B 4K15A 1HAUA 4MQXC 2MWCA 1WWCA 3DUUB 3QFJA 1KG0B 1GJUA 2CDEA 5HVFB 3R19A 5AB1A 1ZEAL 3LIZL 3IN2A 3L3OA 1JK9B 5IJDC 3RWJB 1LGVA 4NPYB 3HLAB 5HDBE 2HFEB 3VXRA 3MYJB 2HWZL 3JZYA 3DGGA 4QNPE 4NO5A 3LN4B 4KRPC 2CHDA 3DOIA 1UH4A 1DJHA 1E6OL 3JUYA 2JFCA 3QCVL 3FYEB 1JZEA 1KIPA 1LO5B 1MNUH 5IGXL 5LHDA 3Q2WA 2WYTA 2A9NL 4NO2A 3JYCA 2NUPB 1E8WA 3V0AC 2X2YA 4XB7A 1KGWA 1C8PA 1XCXA 3WFDL 4PWJA 4Q56A 2ZCHL 3BD4A 3UAJD 1DVFB 2W65B 1RZPA 4DVBA 4NUPA 2Y36L 2WB7A 3PCYA 3DPDA 3QK0A 3WKYA 1UT1A 4QKXB 2HRGA 1A7PH 1CYGA 3DTXA 5EZJB 2R51A 3T0WA 4XN9A 5D72L 2YD0A 5EU6A 2E7LC 3VFVA 3QUXA 5HHOB 4U6HB 4X5RA 3VAEA 4AQOA 1AFVL 4V1DB 2FJUB 3D5OF 5E1IA 4KK6C 2VLKD 2HRLA 2EC9T 1UEYA 4WUKH 1LEGA 4AUYA 2ZG3A 3FT3A 2ICES 1QFPA 4KGLA 2VNCA 1S8DB 4NFCA 2RTTA 4NN6B 4V33A 3S37X 4WWKD 3NOIA 3OGOE 4OVUA 1HH6A 2J56A 1GJIA 4ZUVB 3TCXA 1CPUA 5HDBB 4H8HA 5D1XE 2O5XL 4G6KL 3QIWD 5IB3A 4NQCA 3HE6C 5HGHA 5AVZB 4ZNEE 4KMTH 4JFFE 1T1YB 4PIBA 2Q7NA 4K2UH 5DRNB 4XXDA 1EO8L 1K6QL 4F2ME 3QDMD 2R0LL 3WKPA 1RZ7H 5T1JA 1GYAA 4KUZH 1SY6A 1G6RA 2XFXB 3ZW3A 1MHPH 4Z3TA 2YMTA 3T3MF 1WK0A 1HE7A 3VXUE 5CLWA 4PJXE 3V0WL 4A7TA 4KU1A 4B53A 1L9RA 1JPFB 4FXGC 3MBWA 4IBWA 4HUVB 5I28A 4HU2A 4GAYB 2A9DA 3TIEA 2RBLA 4AE1A 1PKQA 1U4FA 4NZFA 4XRCA 2LTQC 3MODL 3CVBA 4XZUB 3U4AA 3CHXA 4FNQA 2APWA 2VC2B 3WSQL 1D5RA 1QBML 2KZWA 3PJLA 3WNMA 1KGCD 3UROR 4GW5B 1DVZA 5FGRA 4KROC 4CC1A 1AGDB 1ZE3H 1ROCA 4FRWA 4PGZA 1U6AH 3B5TA 4Q8BA 3NDZE 3ILQD 2D31B 3EZJB 1ADQH 4P05A 4URTB 4HZLA 2DQIL 2EECA 3ASOB 4N25A 5DJDA 5CP3A 5IHUL 1T7XA 3E6HA 4PV8A 3V4PL 3DK2A 3N85L 2GUYA 4D3CL 2FSDA 2UYLB 3HN5A 5IQNA 1DANU 3TTSA 1HQ4A 2OJEB 4PJEA 3G04B 4S0SD 4XBEL 2BNQE 5D1XB 3AY2A 1KJ3H 4A2DA 4WO4D 3TO4C 2V2TA 1NIDA 5IUSA 4JFFB 1LHZA 3AAZA 3LN5B 3PQYD 4YZFF 3CC5B 3ZIMA 3VGDA 4F2MB 3EGXA 4X9GA 3HC0B 3B34A 3ZTNH 2VXUH 2Q3AA 4ODVH 5ICZA 4WTQA 3FUJA 2AQ1A 5J56B 1QSED 4J3OH 4LPCA 1QWHA 3VXUB 2Y1AA 2AXGB 4PJXB 5EBMA 5K9JL 1PG7W 5EDSA 1ET5A 3IFLL 2H7WA 3AABA 3OKKA 1HIML 4UANA 5D6CB 5AVRB 1FFNB 5IVXE 1HH9A 3SY6A 5LGKA 3LKNB 4NGHL 1OL0A 2ZUQB 5GIRA 5E8DH 1FC2D 4WEUD 4QHMA 2IO5A 5EO9A 1JDDA 2E76C 4F7TB 3KXFD 2V5MA 4AQ8A 3QSKB 1D5ZB 2JKLA 3LV3A 3PFQA 4MASA 4LEXL 1SOSA 2XG4A 2VJ0A 1CLOH 2FX9H 5JQHC 4MXWH 1E9OB 5IEHA 1J9CT 1Q1JH 3LVTA 4XN5A 2BJMH 4PWHA 8PAZA 2RFXB 1A8JH 3B2PA 5LG1A 1KBWA 1CLZH 1INDH 4DZBA 4BK5C 2ZX5A 5EG6C 3VFMA 2GJ6E 4L37A 3LS4H 3H3BC 3M46A 4LIQH 3AREC 4HMDA 1KB9K 4TUOB 5C08A 5T5NF 5HYJA 3TBWB 2PYEE 5HI4D 3H0TB 3W57A 3FT2A 2NXYB 3AITA 3HOGA 1A8ZA 2EVHA 5KEZA 2YUZA 4Q6IA 5DK0A 4ZODA 2WZPA 1G7LA 3SE9H 1XBDA 3KLAB 4WI7A 2BNQB 4P4RB 5DSCA 2AQ3A 3WHE0 1I3VA 1PQZB 1BCIA 2X09A 2ZTBA 1FE8H 1YC8A 2A74B 4I18A 4OT1L 2AK4D 5JHAA 1BFVL 2C3GA 4MJ2A 4G8GD 1CDJA 3DRQA 4O58H 1MFEH 3ZE2F 5FWQA 2EXWD 1MCOL 2ZSWB 3VFWA 5SWZD 1F6AB 1LMKA 3HEIB 2CKBB 2N0KA 3O11B 4N1EA 3SYCA 3W3BA 2J88L 3DX9A 5TPWL 1D5XA 2VLKE 2YN3A 3K2UL 4Y16B 4G80A 3H9ZA 3REWB 1P9MA 3LKPB 2VN7A 3WE6A 1X5AA 5JXAL 2QFPA 2XFGB 5C7XL 5IVXB 1NCJA 3QXAB 5CJ8A 3KLSA 5ANMA 1G9NH 3RDTD 4XMZA 5I8CB 1EJ8A 2Z7WA 3CPUA 3BVXA 4XPTH 4DTGH 1UOLA 4IW4C 4W1TA 1FIGL 1ZTXL 4FQXC 5I1DB 5KSBA 1JV5B 3FFCD 4N2CA 3ZOAA 2VCOA 3WHE1 2YGNA 3QC6X 4WRLA 3M17B 1EZSA 1AHWA 4KNUA 4ALAL 3Q8CA 4YSPA 3B9KD 3CH8A 1QHQA 3BKYH 1O7VA 1NKOA 4JUSA 4P2OB 2N7BA 4XVOA 1SEBA 3UBHA 1RZGB 2BRRL 3HRZB 3LB6C 4U4BA 3GMLB 5ITBH 1IBHA 2GJ6B 4R96B 5KSAD 3VVWA 4MA8H 4EJ1C 2BCMA 4LGPB 2WD0A 3NFSL 2J8HA 5IHBA 2PYEB 1E8XA 3JYBA 4NM4H 3MUUA 1MHEA 2ZJSH 2AEPH 1WA2X 1FG2B 1NAML 5JW4R 1NPNA 4HKBA 3L3KA 1UXMA 2O5ZH 4NQVB 3S35X 1CXEA 4MS8C 3ATDA 1DJZA 3P3TA 3R0NA 3SKNB 1TENA 2IH9A 4CC4A 2I9LA 4AV4A 3NSYA 1KYDA 1UM6H 4OJFH 1KGCE 2F15A 3OKLA 1TEFA 4QEGA 1OGSA 2EE0A 3D3VE 5TGBA 1NMCB 2JCCA 2VLKB 3PFUA 1CZ8L 1S4IA 4RMVA 5GHWH 4HIJA 4FP8H 1T0MB 4BFGA 1EZVY 2A6JA 3F85A 1JL8A 2AJXH 1XR9B 2V5TA 2LAAA 3LN9A 5HYFA 2YA0A 3GXNA 1UASA 3IJSB 1ZWIB 1FHGA 2DLFL 1V55B 5EU5A 4X6FA 5FKPB 1T5XA 3QEHB 1ZHNB 1DBBL 3QIWB 4IRSB 3KPSD 4PG9A 3QI9A 4QRPD 1TZ8A 2W1NA 3ARDD 3EO0A 1SYVA 2HH0H 3OHXB 4DEPC 5I15H 5ID1A 1DQQA 1LDSA 5DUML 2COVD 3ULUL 4HIEB 4MTMA 3WG7B 2W60B 5T3XD 2EXYC 2J6EL 3ZGHA 1X5FA 4BQBA 1JCVA 3T0EE 1WH0A 5LLIC 1KMGA 3U6RB 2DWXA 3R1GL 3V7MA 4LRNL 4M1CD 5JPMC 3CUPA 1M53A 3GSNL 4PRDA 2PWEA 3RIKA 2JB5H 4R83A 3WXWL 3CTTA 4GMSH 5IB5A 3MCLH 1BIIA 2CO7A 5CMAB 1ZLUK 3O2DL 1IVTA 3IDYC 1C08B 3BQUA 1DQTA 4MA7H 4NZTH 5DRZA 5FV2A 2J5WA 1KENH 3R4RA 4CRPA 1FI8C 4LLVB 4FQQB 4H26A 4BK8A 1R0AL 3OLIA 3L3JB 2CUIA 1DZ0A 4RMSA 4XHJD 5E1HB 1CF1A 4R97B 3FRUA 3N43F 4L1DA 3O4LD 5D7KE 1MH5A 2CR0A 3D3VB 4GG8B 3GHEL 4NLHA 4YPJA 1CGUA 2MHAA 1SMAA 1NCGA 1WUZA 4DCQB 3PJNA 1YDPA 2QR0B 2BH0A 3QIUC 4MLIA 3UDWA 3UTQB 4ETQA 3GUTA 2YS4A 2V7NB 4ICWA 5DZOA 3RDJA 4FQJL 1QFOA 4UQ9A 1J5OH 5E4EC 1G1KA 2AV7B 3KWUA 2OI9B 3FU7B 3OWRA 4ZUWA 4FFYL 1CLYL 3HC2A 1M9SA 3PWVA 4TRPL 3PPEA 1M1XB 4NQUA 2AK4E 5T3ZE 4WFED 5SX5K 5BZDA 3KDPB 1A2YA 3BPNC 2RQEA 5GS2D 1ORQB 2ESVA 3T0EB 2W9LA 5I1KL 3P3YA 1LO3L 3GMPA 2XKNA 2N7SA 4OSUL 3JV6A 3KLHC 4Q0XL 4JDEA 3PWNB 4EI6B 5HYIA 2R2EA 4LNRA 4R0LC 5FYKE 2GUOB 3FQUA 3KDMB 1AS8A 4G42A 5I24A 5EWIH 5JW5A 3FU6A 3WTUA 2EE3A 1T66D 1XF3A 1T1ZA 1VFUA 4F37F 5LUMA 4RDQG 3X1NA 1ONQA 4JFSA 4MXQC 1SEQH 3KEHA 5KVDE 2F7OA 3GXUB 2WYHA 3TC9A 2ED7A 1UADC 3GIZH 1W72L 1ZHKA 2WVSA 2R4RH 1EEZB 1DFXA 3C8KB 3H7BA 3HBPA 5IMMB 1CFNA 4K94C 4XPAL 4ODUA 5MEQB 5CWSB 2QTEA 4PJHA 3PV7A 3C60C 1COBA 2JMRA 4N1CA 1NL0L 4BK4A 4YQXH 5TDOA 4AIEA 5I1GL 2VKXA 5J6GA 2VDML 4GIPD 5GXBB 3VW3L 4IIQB 3ZIYA 1DN0B 4MGXA 4XMUA 5JORB 2P9RA 5E99L 3OR6A 2J8UA 5A2KH 4FQCL 3IDNB 4MHHI 1J1OL 3IB4A 4ZUSB 1W0VB 4CILA 4XTRC 1MAJA 1TJIL 3O0LA 3RGVD 2XV2A 5D4IA 2ZCLH 3ZLQC 2Z1KA 2EKSA 1HXMB 4WW2B 5K39A 4I1RA 2WYZA 3WKML 4E2OA 5BS0D 1OAQH 3CN4A 2R69A 2AK1H 3FB7B 3QUYC 4MWFA 1S7RB 2Y7QA 4PJEF 5EBGA 4YHLL 2AK4B 2H26A 3EFOA 1EH9A 4F3FA 3VWJD 4GNKB 4PJGE 4L5FH 4F7PA 5DT1L 3EOTH 3FSAA 3IJEB 3UO8B 4JFXB 5AVYB 4DNLA 2LU3A 1C8QA 5DUJA 4OFIA 5GZOA 4G1MA 2N7AA 3IMRA 3D39A 3OKMA 1SVCP 4I0PA 4DGWC 1CFSA 2V2WB 1I8LC 2WN2A 3FO1A 2NY2C 3K7UA 2HMID 3BSZA 3RDTB 1TJGL 2IALA 1FWXA 1UXWA 2JQMA 1DDHA 3QORA 3N0AA 3KPSE 5DDHA 4WHTA 3HN8A 4Z7NF 2BP3A 2Z8VC 4BV1A 1A1OA 3EYVB 3ARYA 3IGAA 3V0FA 5BV7H 1P7KA 2Y7OA 5T3XE 4HWBA 1KN2L 2ENSA 2WQSA 5JHMA 4C56E 2VN5A 1JERA 2FEDC 1GC1H 5B7MA 2F68X 5SWQB 2Q8BH 5DU7A 1NFDE 3K1KC 4OLYL 1HHHA 1OP3H 2AV1A 2HLAA 1OXYA 2R0KL 1J5DA 3L3IA 4QCIB 2OX5A 3HW7A 1F4XL 1T04B 3GNMH 5IBLC 3TN0C 3ZDWA 3ECWA 1XIWC 1YEKL 3PJSA 4ISVA 3ULSB 3Q6FB 4PJGB 4I3SL 1LK3H 3H3KA 5I73C 1EZLA 1RULH 1TCRB 1UZ6E 4R4ND 3JWDH 4PJCE 5I71B 1B4JL 1KJVB 3TFBA 1FZJB 1QG3A 3O4LE 3VTAA 4Y2DD 4S0HA 4N0FA 3ZTJG 4KQ3L 2OS7A 2Y1VA 5D7SL 1IEBA 1GZHC 1HL4A 1BEYL 5CP7A 4KDWA 3LS5H 4PSRA 1KJ2A 3AU1B 2XUWA 5DS1A 3QEUB 4WI0A 3EJJX 3RX9A 1M57B 1TPXB 1OB1A 2KS0A 3KPSB 4QWWD 5HGAA 1WFJA 1ZLVK 4P2QE 1RUQL 4UQEA 5F7UA 3R8BB 3B1UA 1U8JB 3HFMH 5C8JA 3QDGA 3MPCA 5KSBF 2VR7A 4MCMA 1ES0A 2VO8A 3HUJE 1ZLUH 4M62L 4TUJA 1EEQA 1IC7L 1L0PA 3UZEC 3X12A 2A6KA 4M6OL 2NDGA 5J5EA 4C56B 2DKSA 1TLMA 2X88A 3BFOA 2BSDA 5ADOH 4PJIE 4TXVB 2ARJB 4RZCA 3RL1B 8FABB 5B38G 3FU3A 4CADB 1NFDB 1YEEL 5DJ8A 2D0HA 1OZUA 2AQ2A 2DWYA 5MEND 4FOMA 3HZMB 3NEEA 4R7XA 3CDGB 3H42H 2BY2A 2R4SH 2E7DA 3RJOA 4MS6A 4HKZA 4F9PA 3LNEA 2D03L 2XQYA 4L9LC 1E2VA 4H5SB 2NW3B 4LCUA 1RIVH 1M7IB 1MWAL 4LRIA 3K6DA 1MCKA 3SCMD 2F53D 4UYQA 2FIKA 4NENA 4N6RA 2XACC 4CJ0A 3S5LB 2IQAA 4PJCB 3G9VA 2XWRA 2FDBP 3O4LB 3KJ4B 4XNYL 5KANI 4QRTB 5D7IA 4GLRH 1M3IA 5BO1L 3OXSA 1X5JA 1T5WA 2Y3NA 3GI8H 4UOJA 2JCCF 4RSVA 3IRCA 1X4YA 4KBPA 1Q4NX 2OQJB 4PJFA 5E8NB 1S9WA 5FX3A 3GKWH 5IHWA 3FO0H 3JVGA 5HGDB 1UH3A 5SX5H 4UU9A 1K8IA 4P06A 2XYBA 5ETUA 4HIIB 4XCYB 4EN3D 3BGFC 4E9LA 3IFOB 5FCSH 3FBKA 3V0VA 3D0LB 2M2DA 2ZXQA 4P2QB 1GHFH 2DQUH 3FRPB 1BVKB 4XB8A 2Z4QA 4MDIA 2R1WB 3HUJB 2BW4A 1IAIH 5KVFL 3I3DA 5GRUH 4G8IB 3PWJA 1TF4A 3RZCC 2CBPA 2DJUA 2X42A 1UURA 4PJIB 2JI2A 5D2NE 1FO0B 4ZAKB 1I9RL 3BVTA 3EYUL 4QOKD 1QKZH 4K4KA 3GPEA 3UP1A 1PNCA 2WN3A 5HYSB 3V79C 4UTAL 4XPHL 4CMHB 4TS6A 4H25B 1LEKB 5CIPH 2AQNA 1OM9A 1DFBL 3IDIB 3VQLA 1T0OA 4PW4A 2OR8A 4ZFOA 3N41F 5I2IB 4Z7WE 1ZA3A 4JFPA 2OTUB 2RAMA 2X4SA 3AWEA 4R5TA 3QR0A 4WI3A 2G5BB 4J1UB 1BBJB 1RH8A 3HNTH 3KYOB 4ICXA 3CPLB 5DC9B 5IP4A 4WFHD 4G8AC 3BN9C 3C2SA 3SKMA 1AP2A 4XMPL 4RLDA 1PGRB 1A6ZA 1LO0H 3CGTA 3PDGA 2VSKB 1T1WB 1R1CA 3EGDA 5GJSH 4MZRA 3SE3A 4PS4L 4L8DB 1FZKA 1KCSH 3KZ8A 4Z7UE 2EDEA 4ZFQA 5C07A 2GC4C 1CDYA 3QUZB 1NGWB 3GMRA 4JKPH 4PBWD 1INQB 4FHBD 1FPTL 5ENWA 5DD5H 5E5UB 4GUPB 4OLUL 4ODXB 2OXHB 4WFGD 1TTAA 2JJWA 4G6JL 2F7IA 3B7UX 3IPEA 2VXTH 2XJLA 3GMQA 1BMZA 3VWJB 3E38A 2HPTA 1EX0A 5IB1B 4A67A 2V17L 5IF0A 1TQTA 3LRHA 4PJ7E 1ND0B 1IGIH 3ARFB 4JFOA 5D2NB 1PPIA 4QKTA 2UX6A 4X42A 1Z9SB 2NXZB 1IL1A 1JNHA 3IGFA 3TXAA 5F7FA 2DQFA 3SDAD 1JPEA 1H6TA 3NJGA 1CI3M 3S8WA 2XA8L 1MG3C 1CLVA 3F7YB 3HCVA 3Q5TA 5DTFA 2AJZB 4YS4A 4JKWA 3GTNA 5FAAA 2C9PA 3ZE1E 4HAFA 4Z7WB 3JV4A 2HT3D 3P69A 1FFPB 5C9JB 3ATAA 4IYKA 1IEAB 3HC3L 1GIGL 4J28A 5FM5O 2WK2A 2WLKA 3CZEA 2AQPA 4PJHF 3MOBL 5HVGB 3NZUA 2F7RA 3CLWA 5FLUA 1HZLA 2V9RA 3O3AA 3ZRFC 5DLLA 2IWGA 2XWBB 4XP9L 2B2XH 5E9NA 3SYPA 3W11D 4AIZB 2ZXEB 2BSRB 2E4TA 1PEWA 2HVBA 3PHSA 2VDPL 5I0YA 4QLWA 2FCBA 4ELME 5AYTA 4LHUG 4PCYA 2XI9A 4YFLI 3G6JE 3SDDD 4M3KB 1XL6A 5GRJL 3X14A 5MENE 1XEUA 4Z7UB 1VGKB 1R3KB 3EHBC 2HJLA 3II1A 1P7QD 4LMQI 4JFHE 4PHZA 1BQ5A 5F9OH 4AKQA 2NZ1A 1KLFB 2EIBA 5AYUL 1IT9H 4IDJH 4JM4H 4BKTC 2WLIA 3LEVL 1PLGH 2EDMA 3GSUB 4PJ7B 4X9BA 3BPCA 3GSOA 2GBUA 3MLUL 2C9QA 4N2GA 4Y2DB 4H8PA 2FX7L 1CICC 3P54A 4LU5H 4EZLA 5HD8C 2CO3A 2B39A 5D7JA 5KYUA 4AUUA 1ZLVH 4GBXC 3RWCA 4FQIH 2PP7A 5FUZH 2LLLA 4U1MA 4ZOAA 5GGSA 4FYTA 1QBLL 2R0ZH 4QHLA 3VWKD 3L6FA 2FE0A 3AGWA 4X80H 2O4EA 4C83B 4XC1L 3SPVA 5F70A 3ZE1B 3FQRA 4UBDD 1KC5L 3WO3B 5JR1H 5J11C 2Z8WC 1HHJB 2AJYH 2E0PA 5AB9A 1XHHA 1KTJA 4XNZC 3BVNB 4OBSA 5DMKA 1OPOA 1XBRA 4U1IB 1J9TA 1MZYA 1QZNA 2V5RA 1XCTA 4LE8A 3MHZA 15C8H 4JFDE 4XCNB 5AOZA 1FH5L 1NCUA 2WAQA 4RBPK 1SJEB 3Q6GH 4J4PC 1A1MB 1KXTB 4J12A 3VFNA 4NDMB 1ECZA 4GT7A 4J3BA 4OQ1A 1TDQA 3UYRH 4ELMB 1MFCL 3G6JB 4BZ1L 4I4WB 5MENB 4HJ1A 2E3VA 1AQDA 3O2VH 4L2LA 2HFGL 2VAAA 1IGJA 2WV3A 2HTLD 4Y4FC 4MHHG 3N42B 3VFOA 4EBQH 3BUIA 2JB6A 4L29A 1UWGH 3NEXA 3CLFH 4PHXA 2NR6C 4U0RB 5FIEA 3HI5L 1WQVT 5IW1B 1AGCA 5D96C 1SY6L 3SCMB 1KULA 2YZ8A 5FHBL 1G6RL 4K8RH 4UT7H 3AG2B 3IXAA 1CWVA 1RJLA 3KR3L 3UZQB 1UT2A 4K7FB 5MERA 1J48A 4M5TA 4C57C 3ULVF 4U49A 1QTSA 2NZIA 4YBQC 3NAAH 4AH2B 3H4HA 4X0NA 1KG0A 2BXYA 4I0CC 1MJ8L 4CKQA 1KTDA 3MROB 2B3RA 2DIAA 3RAJH 4G6FB 1JK9A 3K81A 1LQSR 3C6LD 3L4CA 4QAWA 4NPYA 5DR5L 3RWJA 1ASOA 3SGJC 3MYJA 4MZ3A 5EBLB 4OIIH 3S0PA 3GLZA 4I87A 3CQPA 5E0QA 4JFDB 3FTYA 4QRSB 2J4WH 3FT4B 2IFGA 4L3CB 2CRZA 12E8L 2FAUA 1GPOL 1GTFA 3PHQA 5B8CB 2OM5A 3HZKB 4BQCA 4NZ8A 1SJVA 1AQMA 3PNWB 5IMLB 5C0AE 1O6SB 5F0JB 5ESAB 2DI8A 4LFHD 2WGXA 1JHKH 1FVCB 3R06A 2W65A 3X1FA 5B1JA 5FW8A 1IVLA 4IJ3B 4LP4A 3JWNG 1VAHA 3A4DA 2ROYA 4XVUD 1JF1B 3WTSA 3ZRSA 1HWGB 1HKLL 4NUQA 5IWLC 4P46D 4QJ4B 3BIBX 3DDGA 4R3SB 2BX5A 1VIWA 3HBZA 4N0CC 5EZJA 1AKJB 5E6IA 4UQAA 4G9DB 1NCBL 3JVFC 3TBTB 5IJBC 3IVKA 4M9PA 1PVHA 2G2PA 1DQDH 2UZXB 5DHDA 3SPHA 3ATFA 4E68A 5CBAB 5IB2B 4U6HA 1OSYA 4MQXD 4V1DA 1G9ML 4P07A 2QVMA 1EVTC 2GTQA 5D7IF 5FFOA 1IM3D 5IESH 1AZBA 2VXSH 3T2NL 2PABA 5A6LA 1JVLA 5IFAH 3PXLA 3IDGB 1S8DA 1NSNH 5T33H 1QSVA 5I5RA 1MFBL 4ZUVA 1J0ZA 5FECB 4AENB 1MIMH 3FTVA 2FEEL 2GC7C 4DAGH 5IT2L 3TCTA 3RVXC 1MFMA 5DRNA 4CN1A 1CGTA 4FG4A 1RFDL 1ET8A 3OF6A 4I89A 1A4JB 4ZYKB 5I1CL 4NO0D 3C87A 3T6XA 3WUZA 3NUKA 3RWGB 4UINL 1JV2B 4X7CC 4XBPB 4L8CB 4BFIB 5IBTL 5C0AB 3D18A 3GJFK 2Q1EA 3SDAB 3WFBH 3ZL4H 1LEIB 2XZAH 1AO7D 2A73B 4XMLL 5GS0H 2V5YA 4HUVA 3K6FA 4GAYA 3NN8A 4K7PH 1L9TA 4LVHB 2HKFH 4UUJB 4K5NA 5ESVB 4YN3A 5FHAH 4RAVB 4PGEB 3LPOA 4XZUA 3RUGE 4YDLB 5IW6B 2UVFA 4X7EC 5EUKA 3UADA 1BYPA 1NIEA 5TE7H 3U7YH 4KK6D 1KGIA 3V52H 2H3KA 4GW5A 4MJ5A 1RY7B 1AGDA 1S7TA 4LSQH 3UERA 3P73A 2ZP8A 3VD9A 2TRHA 5IQ9B 4XXCA 2D31A 5C0BD 1YN7B 2WUCL 4M6NH 3F12B 4K3EH 4CBPA 2WIIA 3HI6L 3PAYA 2BC4A 5MHSD 2EH7L 4RCAA 1KN4H 5ANHA 3HE6D 3L4WA 1GYVA 1TYJA 2BFVL 1GGIL 2VZUA 3DETC 1UTDA 2UYLA 3QXUA 2NDFA 1VJSA 2OJEA 3G04A 2CSPA 2H0FA 4RISL 4ZNEA 3PL6C 3JQOB 1KBPA 1VACB 2YKLL 3PHAA 4JFFA 4NQTA 3SDCB 3WIHA 3WIFB 1X5XA 2EABA 1UA6H 4RFEB 3SGKA 3QQ4A 4M7LT 3GXPA 3VXTB 3HC0A 4N8VG 5I8EB 4QTIL 3VGHA 2M1KA 2BP0B 4ZRGA 3UPRB 4QHNB 3BT2L 3NJJA 3EO1B 3GK8H 4AIXA 2AXGA 4NNXA 4C4KT 4X4KA 2EILB 3QUMB 5IROC 5HYQB 4KRMB 3JTTB 1BWMA 3LKNA 5IZ7A 2HX9A 2NY6D 3OJDB 4ZX5A 5GGVY 5TQ2L 1MHCB 2VITB 4Z6AT 1BZ8A 2NPLX 3L3OC 4RBPH 1DLFH 5E7BA 4X50A 1A14L 4KROD 3RUGB 1JF5A 4YR6B 5B21A 4WHYG 1E9OA 1KXHA 2QQLL 1I3RA 1CE6A 2RMNA 4WENB 2RFXA 1MRDH 5AALA 4LEOA 5TQ0L 2I9TB 3P30L 3VGAB 1B88A 5KBLA 3SOTA 2X4QB 2OK0L 4NNPH 3E3QC 1XF5A 4TUOA 2BSSA 1L7TL 2GEQA 5KJRH 2PP8A 2OJ1A 1VRSA 5DVOA 3TBWA 2XJKA 1BQLH 1BP3B 3H0TA 2YGQA 4L4TE 3TA3D 5K9QG 1OARH 1Z5HA 2VZ1A 2WBXA 2VDQB 2OZ4L 3K6SB 3EFDL 2BNQA 4P4RA 4PGBA 1QFUH 2DBJA 4C4KO 3VXSD 1QD0A 2IAND 2ZUYA 4U1LB 2E46A 5CXPA 4DVRH 2ERJB 2MQCA 2OMYA 4KITB 4QDGA 1GR7A 3TJEH 2VSDA 3ENEA 5JIPA 1Z32X 4AVIA 4DUVA 2NTSP 2ZSWA 4KTEL 1XEDA 2VERN 3H56A 1CFTA 4CVWA 2BXZA 3K71B 1F6AA 4H8WL 3O11A 3RGBA 1AGEA 2BSEA 4W68A 4Y16A 1A9BB 5J7CC 5DJZB 2CBOA 4OD1L 2WXLA 5IVXA 2EACA 5EF2A 5LCVH 2B1HH 2CO2A 5I8CA 3D1MC 1TZIA 4LVOB 2WKOA 3C6LB 3LH9A 1OE1A 2F5AL 4Z7VE 4A6YB 5AAWA 3LEXA 2ZNXA 3CCHB 3K2MC 3PGCB 1JDCA 3F7VB 3RTQB 3O3DB 4ODHH 5I1DA 4NXKA 1YECL 2C5DC 2P8MB 3ARTA 1NFKA 1K5WA 4A2FA 2AW2A 3PWPD 1MJJB 4ACTA 3BAJA 2B08A 2ZONA 3MREA 1LLAA 2DLGA 3E9UA 5IG7A 1XD0A 1G7HB 4Y9FA 4CW1B 1N59B 4QRRE 1NAKL 1RHHA 2YAPA 4P2OA 4W4NA 3ARED 4S0TD 2BY1A 2ZX7A 2AANA 3HRZA 4FQ1H 1IGYA 4IBLT 3ZDXF 4DQOL 3CSPA 4W9CC 3VI4E 2GJ6A 2I24N 2MMXA 2QQKL 3QUKA 1AC0A 4R96A 3SYOA 4ANKA 2L7JA 1WZ1H 1CIUA 4P5MA 3IAQA 2PYEA 4L4TB 3Q9PA 1AO7E 1SNRA 1MREH 3QG7H 1L0YA 1FG2A 2VRKA 3UGUA 3LD8C 4YFEA 3N40F 5KAQG 3OKNB 2WPGA 5M94B 3PAVA 3M7OA 5H94B 4YXLL 4L0YA 3KCWA 3I6KB 4W9GC 4XNUH 2X89D 5CIPA 2XTLA 2UWEE 1FL6A 3BJ91 3OX8B 2GITB 4NQSB 1OM3H 3MRLB 5EO1B 3D4ZA 1QFHA 1ZIAA 5T5FH 5EFIA 1E6JH 2QSCH 4KHTL 4G9FD 5C0BE 2R1XA 1IM3B 3MAWA 3WTXA 1T0MA 3UJTH 1DUZB 2HKAA 4PLKC 4PY8I 4FQXD 5MHSE 3CHSA 2DMGA 3MV9E 4X8XA 2C9XA 3D85D 1FV1B 4ABUA 3IJSA 5KJ7E 1QO3B 4KRPB 3N0PB 3M1BA 3HNSL 4Z7VB 4KXAA 1QUNB 4YDIL 1MRCH 4EN2A 3QEHA 1RZFH 1ZHNA 2KPNA 4IRSA 3F58H 3O6KH 5J6SA 3OHXA 5I5MA 5BZZA 4AYMC 3EH5B 5J1SC 2ODHA 1MW3A 3EH3B 4FYRA 5DJYB 2Q3XA 1JGUH 2HFFA 3GJFH 3LB6D 5CJOL 4KJQC 2DQJH 4UILL 4FQHB 2X6MA 3DSFH 4QRRB 1ACXA 4GRWH 1CU4L 4K9EH 4NO0B 3ARRA 3MRCB 2V9TA 3VI4B 2BIMA 5DYOB 3U0PB 2OR7A 3VMNA 3FU5A 3VACA 4F1SA 5CMAA 1AZVA 1R3HB 1RUKH 2P80D 3BEVB 3IJHB 1AO7B 1C08A 2R69L 3KBHE 4MS8D 4LSPL 4WW1B 3RWFB 1G9MC 1NIFA 2ZXBA 4ZFGH 4FJ6A 1F45A 1J88A 1D7DA 4JKNA 4OB5L 1SN2A 1R3IH 3B3IB 1PX8A 3D12B 1HNFA 4K73A 3BKML 1U2CA 1F8TH 1LDPL 4LLVA 5LXVA 4FQQA 2H6UA 2OXGA 1S5IH 4AQ8C 2UWEB 1E42A 4DETA 4F24A 1HWHB 3VXMA 4NZRL 2DN7A 2EDDA 1IGTB 2GVYA 4GAGL 2L7EA 3D3VA 2X2HA 1OIOA 3BSZL 5C0BB 1MCEA 2W0FA 4N2IA 4DCQA 3KHOA 1G5AA 1PU0A 3MV9B 3A4EA 1KCUL 3REVB 3SQBB 3TNMA 2DD8H 4FE9A 4G7YL 4L3EE 4WUUA 5F3FA 3H3PH 2AV7A 1FVDB 4HWEL 4QJ5B 5DQDH 5AAMA 1JAEA 3VXSE 4Q6IC 2IANE 4GS7B 4OV5B 1R17A 1M1XA 2A1WH 4HWBL 3WFZA 2C1PB 2FRGP 2V5SA 2X4TB 3QFDB 1H15B 2WINB 4JQVC 4QNPF 2B5IC 5HHMD 5DD0H 3B7YA 4X5LA 4OLXL 1ORQA 3CXDH 4DGIH 3T0EA 4KPHL 5DJAB 5I9QC 1CTOA 4FXGB 3D4GA 3PWNA 4OIFA 4EI6A 4NYLA 2ZXAA 4KI5D 3ETBF 3KDMA 4JG1H 4NJ9L 1N6UA 2XLLA 3ASNB 4HWNA 2DYPD 3ET9F 2BHFA 4ZX4A 2XIBA 3ZUNC 1XXFC 3MDJA 3N3EA 2OBGA 2EDFA 4XNMB 2FTAA 2IV8A 4JUTA 1RJYB 2BHUA 3SDYH 5KVMC 2XN9E 1EEZA 1ETA1 4KROB 4YHYB 5MEQA 4QHPA 3ULVL 1D6VH 3E8VA 3U79A 5KVGL 2WIMA 2MJWA 4PVMA 4BA0A 5I75C 5JMOC 4IIQA 5AG8A 1AHWC 3VGEA 1QNZL 5EHFA 4ZMAT 3ZR5A 3QIUD 3QT2A 3N1FC 2X6CA 1KJ2L 5AAPA 5BW7A 1A3ZA 2Q5BA 3IDNA 4WI4A 1MVUA 4HS6B 4HS8H 5DZ9A 1W0VA 5H37H 3VM7A 3T0BA 5B7EA 3TO4B 2W95A 2EDKA 4L3EB 4WTZG 4BGDA 4B9JA 1RJZA 1CN4A 2DEYX 4RGMC 4RMWA 3VXSB 2IANB 1S7RA 3B9VA 5CSZB 2ZUSA 1ZJAA 3KLHD 3MCYA 1C12B 3QXWA 1MQKL 1WZMA 3AC0A 1TIUA 4F1ZA 1MJ7H 3MNZB 1MCPL 3BKCH 1N67A 4JFXA 4JCLA 5MEOA 2L7UA 2J12B 3RWHB 4FG6C 3UIZA 1OAXH 2Q76B 2VL5A 5FDYA 2VXQH 4G9FE 1E9QB 4NC1E 1JMZA 3QPXL 4R4FL 1MHPL 1E28B 3HE7A 2V2WA 3Q2NA 4IOFC 3QEGH 4WKZB 4YL9A 1HINH 3RDTA 2G0KA 4J6RH 5G4OA 4ZNCD 4QRUB 1KXQE 5TH2B 1KTCA 3U9UA 3MFFB 1KTKE 3FO2A 4G8EB 1H8OA 5CINL 1S3KL 3C60D 1C5BH 4OM1L 3RIAF 2XN9B 3BWZA 3W39A 1L4IA 3GTVA 2K4AA 3J7HA 1Q94A 1A3LH 1JFQL 4HS3B 4HXAL 4YGAB 2R1YA 1AZRA 3WMSA 4AK2A 4AMKL 1L9OA 1DE4B 1Z1WA 3DYMA 1C16B 1ML0A 1OCZB 4HGKC 5FPIA 4XTRD 1K8DB 3VRJB 1ZGLB 3T4YB 2VO5A 3MA9H 35C8H 2A38A 5AKVA 4OLVL 4K3HA 4GXUM 3LQAH 1A4AA 4P2AA 2ZWNA 5DI8A 4HOXA 3RKPA 3IJYA 4M43H 2ADYA 3IBEA 4LQ1A 2OTWB 4QCIA 3BQUC 4F27A 3I50L 1T04A 3ECUA 3V4LA 2IJ0C 1U8KB 2D7OA 1KJ3L 2WWMC 3BLPX 3ULSA 4XBGB 4PJGA 4XNBA 1U92A 3BE1L 1G6VK 1S9KC 2ATPB 1TCRA 1NGXB 4NO3B 3FSOA 4NWTL 1KJVA 3H9SD 3GMMB 5AKSA 1DCLA 1HSAB 2GYSA 1AIFA 2FEJA 2NY2D 2NY0B 3DSNB 4G9FB 3LPGA 3NJKA 4EAEA 1A0QH 3EW3B 2HVJB 2AJVH 1HN1A 1YRKA 1KACB 4ACPA 5ESQA 4FQXB 1I9JH 4OFPA 2OL3B 2QFRA 4ZMTA 2D4FA 3AU1A 2F5BH 1M7UA 1Z5LA 3NP4A 3QEUA 3QO1B 5IVXF 4HFUL 3UDWC 3FHEA 1YUHB 2EDTA 4ZX3A 3UJIL 4F58L 5IMOB 2OJZL 4LCCA 2EIKB 2WO2B 3KPSA 3P77A 4NAMA 4XCFL 2WKOF 4E0RB 5IHHA 2WXHA 1IU1A 4B9KC 1NLBH 4AITA 4MNQD 4IOSA 1N5YL 5FLVA 2YMXH 4OCSH 1IFGA 1KIRB 4M7KL 2FEDD 2YJLA 5HHME 1ZA6A 3Q8FA 2G5UA 4GKZB 3UMNA 4A66A 3IDXL 4GQ9H 2QHRH 4C56A 5AW3B 1INDL 1IBDA 2XWJB 3O6LL 1GZQA 1QA9B 2ARJA 1PZUB 3RL1A 3KYNB 3LRSB 1CXFA 3L5XH 4CADA 3L4YA 5I1AB 4X8CA 4CVXB 1N6QH 4S1QH 3NABH 5IBLD 4WEMB 1XIWD 2A5UA 3CDGA 2NOYA 4DP7X 2GTWB 4YHNB 4AJWA 5FKAB 1A65A 1TJXA 1A7RL 2DPKA 2IGFL 2QADC 3EH1A 3DGDA 5DUBA 2OYPA 2PPCA 1D2OA 2NW3A 3B2UC 3EBHA 1DN2A 1M7IA 4WDIA 4TUKL 2NSXA 2PTUA 1OAZH 2IDFA 2FWOA 3CG8A 1CE1L 4MAZA 5AUMB 5IJCC 2KPWA 3S5LA 4PJCA 5KS9E 5DEFB 4QRTA 4M1GL 5J12B 3OWEA 1I8KB 3N06B 2G3NA 5GJTH 1SRDA 5JUEH 1OK0A 1XQ4A 2QSQA 2OQJA 1GKEA 4TVSa 2QSTA 1HL8A 5HGDA 3QZMA 2YAEA 3BYTA 2VW4A 1YMHB 3A47A 3B5HA 4YPGB 5IEKB 4NZUL 2FH6A 5BZWB 3GIVA 4HIIA 4F8TA 3P9WB 3UEZA 2EDXA 4HUXB 3DX6A 4P2QA 2M8XA 3LZNA 2JKTM 4L8BB 3FRPA 4O02H 3FO9B 2R1WA 1DHKA 2C9RA 4EVNB 5CUSH 5HHMB 3HUJA 3W37A 3NK4A 4JLRB 3VQMA 4CU6A 1I7ZB 4N0RA 2VUOA 1CK0H 1I7UB 3B37A 4AX3A 3IDYB 4PJIA 4PRBB 1FO0A 4ZAKA 1NGQH 3G08B 4LLDB 1FORH 2WLJA 4TNFA 2ZOTA 3IU4H 2EDBA 5BJTA 1A7OH 2CMRL 2PKDA 4JPSA 1OT2A 5ITBL 3CFJA 2DKUA 4MA8L 1H3TA 4A1RA 4H25A 1LEKA 4I0PC 4DHLA 4YSAA 4KNTA 1P6AB 4NM4L 4JO3L 4JQIH 3QH3B 2VQ4A 4HIHB 2WXRA 4ONFH 3QORC 2WW8A 3EYFB 4FNUA 1OCOB 1HNGA 3Q01A 3W5NA 2LLNA 2VDRB 5HGBB 2PXYB 3CPLA 2KKQA 3UBGA 3ULUD 5KS9B 4ANXA 3QIUB 5JOEA 2JE8A 2APVA 2BNUB 3MNWB 3AROA 5E4EB 1T1WA 2NNFA 1F6LL 4L8DA 3WNOA 1FGNL 5IVZB 3VRIA 4MQ7B 5CAYB 2ED8A 1MLCB 2LV4A 4AMWA 3QUZA 1NGWA 2C3VA 4N0YH 3LKSB 4L4VD 1KTLA 1MRFL 1PCSA 2NW2B 2XICA 2BS71 4GUPA 2ITCB 4EOWL 2OXHA 1DBJH 4OR1A 2YD3A 1U8OB 4GLRI 2ICCA 4XMXA 1UOWA 4JMNA 4O2EB 4LBEA 4LF3B 5IB1A 5C86A 4R7VA 4WEBH 1ZV9A 5CN2A 2OA9A 2W8CA 3ARFA 5D2NA 5AL0A 2FLBT 3I75B 3I6GB 3OLEA 5CGMA 5KYYB 2H6PB 4KC3B 2XXMB 3QR2A 2QSVA 4JDTL 3UAAA 3RZWA 7FABH 1T6VN 1C1EL 3LRKA 3F7YA 1YA5A 3P0GB 4LPTA 5F7HA 3V6ZA 4GKSA 3D08A 1IAII 4JPKH 1AZCA 3U1SH 5LB1A 1DTUA 1L0QA 1R5IB 4Z7WA 3LQZA 4I2XA 1R3JB 1YJDH 4GKLA 1QLFB 4LT7A 4MBOA 3WYRA 4TVUA 1NFIB 5C9JA 2C7UB 1P2CA 2ZOKB 3POCA 3BN9D 4MNQE 4TL4A 2Z92A 3EYSL 3NDYE 3BP4B 4BUQA 4Y9GA 1NCOA 4NQED 4XVTL 3KBPA 2XWBA 4AIZA 3QZWB 3MLVL 2IH1B 2BSRA 2BIQA 4DJMA 4O9HH 5J1AA 3MN8A 5L8KB 1OGAE 3CMOH 3K6IA 3QUYB 3HAEH 3VYOA 2H2SC 4B41A 4K7PX 1GVIA 1YSOA 4Y5YC 1R3KA 4Q74A 1CGWA 4S2SB 1BZ7B 1J5OL 4IQHA 3N55A 1X6NA 4PQXA 4AGQA 1OSZA 1MFAH 1Q90A 4XPFL 3U1PA 1NCDH 2HA1A 1S46A 1VGEL 3VFRB 4D94A 1U3YA 3TT3H 1KLFA 4OFYD 3RY4A 1RZIB 5LGHL 5FYJL 3MRDB 2Y23A 1IC5L 4LRIC 4MJ6B 4PJ7A 3EKCA 4BKLB 2YD5A 3CLEL 2LE9A 2EUZA 4X7SH 3NQKA 4EDXB 3UTPD 2CUAA 2OW6A 4KXCA 5AOKA 3RURA 1G7MB 3NA9L 2W88A 2ZKXA 3QZLA 2UY6B 4LLWB 1U3NA 4DKFH 3OMAB 5T5FA 3IFNL 4FMKA 1NCAH 2FX8L 1FNEA 4N1HB 5JHLH 5H4YA 3ZO9A 1JPTL 3HMXH 3LJ3A 5MP6L 4YZWA 4HW6A 1AS6A 2HRPL 4W4OA 1X7QB 2E27L 3FKUS 4C83A 1ED3B 1PAMA 1Y18B 4YMPA 2JQAA 2ZOUA 2YLHA 2YEZB 4MNQB 1KB3A 4X6BA 5I6PA 1NCNA 3BVNA 4IGBD 4N2BA 4NKIH 4U1JB 1RMFH 2VKWA 4U1IA 4Z95H 5ERWB 4U05A 2EAEA 4X0KB 5I0VA 4XCNA 1F3JA 4JHWH 4DKEL 3H9HA 4DW2L 3KNBB 4RX4A 1A1MA 2CHZA 3QQNA 3ZHKA 5AD0B 1K3IA 2BO0A 1LWJA 2FWLB 3A6CH 1MLBB 4NDMA 4ELMA 4UAOC 1KELL 3AB0C 4LDOB 4NP9A 4OH2A 1OGAB 3TN0B 4YLBA 5DHVB 1XIWB 4HH9B 3MNVA 3O2WH 4Z7NB 1PSKH 5FUOL 4HCRA 4WHDA 2K6WA 4ORZC 4QI3A 1BFOB 4J3OC 3L9RB 5ECGA 3SGEI 4NKMB 4DP8X 5IW1A 1LP9E 1CICD 1IM9D 3OAYK 4LSDA 4PJGF 3RB5A 5F1IB 1WA1X 1A3RH 4PB9L 2YAOA 3UZQA 4GBXD 5JTWA 2RR3A 4FNTA 3CDZB 4K7FA 3CXHK 4HCGA 2VDKB 3WDJA 4EE2A 4G8FA 4HCFA 1ZANL 2WCSA 4NQXB 4Z3EA 4OD2B 4K3DH 1E5CA 4PRAA 2PR4L 4HBCH 4B9FA 2XN2A 1RI8A 3POHA 3MROA 1I82A 3DIVA 3SO3C 2J57A 5I6XB 4N2DA 4Q9RH 4N6QA 3NZ8B 3BUYB 1MQ8A 2BSTB 4ERSH 2VC2L 2J8OA 2BY0A 3LCYA 5JHDD 5EBLA 3U48A 2EDQA 3KCPA 5GRYA 3E8UL 4PGJA 1JIBA 3OQRA 4GEIA 4MD4B 3BH9B 1BZOA 4JFDA 4XGZB 1BGXH 4QRSA 2CO1A 1QACA 1DSFH 3MLZH 3FF7A 4PH8A 2WXMA 3KJ6H 2ZWLT 5B8CA 3HZKA 4ZBJA 4FFZA 4P2YA 2X3CA 3C8HA 5JW3H 2ROXA 3UZVB 5IMLA 1O6SA 3KYKL 3MGAA 2E7BA 3IDJB 2DDQH 1YNLH 3IK2A 2NY5H 1NFDF 4L9LB 5IBUG 1RZKH 5KG9B 3WIHL 1F90L 3MLTB 2OYLA 4AQEB 4X99B 4ODSL 4GG6A 5IMKA 3D33A 1A6UH 1JF1A 1CB4A 1EIBA 1TEGA 2X4RA 2NY7L 5JZ7D 1C7SA 4R3SA 1I1FB 4QXUH 3EJSA 1AKJA 5CEZH 4ZD3L 1LP9B 4G9DA 3TBTA 5EIIG 4KQ0A 1GAFL 3MLWH 1G9NC 5CBAA 5IB2A 2ISDA 1QBBA 4NQEE 1UZ6F 2X4UB 4YBQD 4G5ZL 1B0GB 1YZZA 3JWDL 4MKMA 4AQ1C 4TNGA 4PJCF 4OUUA 3MRMB 4JGUA 3ARXA 1XGYL 1P84K 1I8IB 1GYCA 4XN2A 1JXJA 4A38A 1FGVL 4LOEA 4AENA 2WVVB 5L6YL 3VH8A 2WQAA 3HZVA 3QDAA 4JB9L 4X5XA 3VJ6B 4JZOB 3QJXA 1XGTB 3AT0A 2XXFA 5ACMA 1CFVH 3RZCB 4KX9A 1XSIA 1HXYB 1M56B 4LESA 3S36H 2DIJA 4ZYKA 1A4JA 2A9CA 3HUJF 3AVEA 4QT5A 3N91A 3RWGA 2ZKYA 4M93C 4MAYA 1XAUA 4EXPX 4L8CA 2FR4B 2DQCL 4BFIA 1T89C 4NOFA 5C0AA 2YK1H 4PJIF 3NQIA 1UFUA 2OMUA 3KEDA 5D7JC 3T6ZA 2I60H 2A73A 2JIXB 5L9DL 1C5CL 2G60H 4N0CD 2YARA 1U8IB 5KWYC 3CZNA 1ZT1A 4PLJC 4OI9A 1WZKA 3OMNB 4KK5D 1H8NA 3CIQA 4PWGA 1HT6A 3QPKA 5IW6A 1X7SA 2B14A 3E2HC 4M6ML 1AZZC 2HKHL 3X2QB 4P9MH 2CKBL 2QV4A 3L45A 4PI2A 4CMMB 4HUMB 1M9WA 3IMVA 5DJ2A 3KPNB 3RJQB 5F7KC 1PZDA 2YAQA 2AZAA 4NQEB 2IQ9L 3LHPL 5E4AA 3MBEB 2APTA 1YEGH 2IPKB 1HI6B 4HJGB 5IQ9A 5EZIH 3I6LD 4HJEA 3A22A 4A04A 2NY4C 3F12A 4NKDB 3ZN6A 3ABZA 2H1PL 1ZHLB 4MB5A 5ES4B 3GI8L 1M6OA 4R8WL 1NC4D 4J8QA 3FO0L 4BEIA 2YRLA 3A4FA 1R75A 4KK9C 4G3YL 4IMLB 1GGBL 1OPGH 3NJNA 4K55A 1VACA 3SDCA 4D9LL 3RU8L 1EHLH 1O5PA 1QEWA 2VN4A 3BDYH 1UOKA 2UZIL 3CD4A 4RFEA 3FMGH 3L16A 1BM3L 1L9SA 3BWAA 3QARA 5I8EA 5E08H 2K7PA 1IAIL 2QL1A 2YD7A 5AZEL 5JIHA 3EO1A 2DWDB 4E9TA 3MZGB 2ZPKL 4JG0H 3F7RA 3APNA 5I74C 2IPTH 3WUWB 2BVPB 2IDCA 1ID2A 1MJUL 4RMTA 2CM5A 3GS0A 3GSRA 3OJDA 3U9PH 1JYVA 1NBQA 3OZKA 4P2RE 5EN3A 2VITA 1ITBB 2K9UA 3Q5OA 2UXGA 4Z7QE 1NBYB 3CFKB 3ARGD 4E42A 2NLJB 3D0VB 4Z7WF 1ZJBA 4W9JC 2K78A 4PY7B 3W0WA 4HEPG 3GBEA 2EICA 1WFMA 1JGEB 4RRPM 4LSVH 1EMTH 3C2AL 1DBMH 3MA7A 3HNTL 1S7SA 2EDJA 1HXKA 4F5CE 4M1DL 2AC0A 1A7QL 1TKWB 1YY8B 4ZQKA 5DRWB 3D25B 4ZTOL 1G94A 4EF3A 1HL5A 3DETD 3EHBB 5CZVH 2AJUL 1JS4A 3ETTA 4A7QA 3K3QA 5B38B 3AZUA 3L1OH 9PCYA 5I1IH 3OAYH 3IGLA 1L7IH 3FT0A 3K6SA 3OAUL 2YOCA 5B1JC 5IV2B 2PNDA 5DQJA 3DJTA 5CEYA 4OF5A 4HBQA 1U8PA 5E2WH 5ALBL 1YPZE 1CICB 2HN7A 1NUFA 4G6AD 3A4AA 2KC0A 3G7TA 5E6IC 2CH8A 4K3GA 2NY3C 4OQTH 4GBXB 4LHJB 3K71A 4Z0BH 2P5EA 4PJ7F 3MRFB 2PTTB 1A9BA 3FH8A 5ABAA 2VSMB 4E41D 2DB8A 3QFJD 3CFUA 2OMZB 5CJQL 1MG2C 2OSLB 2CJUH 3BESR 2IDSA 5J11B 3SDXE 4P2RB 2VZTA 4FC3E 3VXRD 3HZYB 4A6YA 1EBPA 4GT0A 3D4YA 3PGCA 4Z7QB 1JPGB 1BYNA 3F7VA 3RTQA 3G6AB 3O3DA 4PP2A 3KLKA 2P8MA 3TGXA 1JYNA 5L4JA 5FDWB 4NUMA 3ZE1F 2XTSA 1H9VA 1MJJA 3L7FB 2NZ9C 5CJXA 3BAYA 4MAUH 1YEJL 5SV3A 2Y2WA 1R33A 4KKZA 4CW1A 1N59A 4M5SA 2VR5A 3B83A 4Y5VA 2AERT 3VMPA 1C9SA 5J8OA 1OAUL 3G3LA 1JN6B 1UZ8B 1JRHH 3QQ9C 1ZLEA 2P43B 1YEHH 2Y7SA 2CIKB 3KLQA 1YEDB 4Y4FB 4M4PA 1NGPL 4L4TA 4AWJC 4ELMF 4JW3A 3SD5A 5H2BB 1RIHL 3STZB 4QUOA 4OUOA 3FHQA 1NDGA 4XB3A 4EQ2A 4TOYL 2DMKA 3GDBA 5EEZA 3I2CH 3OKNA 4NC2B 5FB8B 2IDUA 4JGNA 5H94A 4GSRA 3N42F 5I8OL 1PBYA 3I6KA 1A22B 2WBWB 4LARL 4PWIA 3QUXD 1YPZB 3MLRH 2AJ3B 4CU7A 3OX8A 3G5ZA 3WNLA 3M1OA 4XVSL 1FFRA 3TO2A 4JQIA 3ILPA 4O51B 5EO1A 4OI8A 3OB8A 1KGUA 2HJFB 2MFNA 3II3A 2WQ8A 2CO4A 5KVFE 4BHUA 1GSKA 2KQNA 3QA3B 5A43C 4JJOA 5IQ7H 3QQDA 1DUZA 3T71A 5BV7C 4DF9A 3QUHA 3V4UL 4EMZA 1FV1A 3SDXB 1QO3A 1PD6A 2P3YA 2PYFB 3GLDA 4Z7VA 3FCUB 3V7AG 1QUNA 4NQCD 5DA0B 4AQAA 1RXLA 4FEIA 3FDWA 2QVFB 3DDFA 4JO4L 3CVHH 1GC1C 1UVQB 3BH8B 4DN4L 5LGYA 1BOGB 1YQVH 1FL3B 5DJYA 2O6PA 2OMTB 3P4NB 3UPCA 1IEHA 3KWTA 3PHOA 1MWAB 4QRRA 1U8NA 2EINB 1RVFH 1RL1A 1VFAA 3CVIH 3SGKC 5GRZA 5EEXA 3DHUA 1QI5A 2M83A 1DO5A 3VI4A 4GRMB 5KVDH 5DYOA 4U1HA 3U0PA 2P5WE 4JO1H 2WLLB 4MDJB 1SHXA 3TWCH 2QKIA 1KEML 2Y07H 1R3HA 1D9KC 5D4HA 1R3LB 3IJHA 3P3UA 4X4ME 1CXHA 4WW1A 2Q6WA 3RWFA 4IM8A 2H8PB 3JWDC 1P4LB 5T3ZL 4WWNA 2GG1A 2E7LA 3TZVA 3PAZA 2YBRA 4QMEA 2ZUQC 3NFNA 1AD0B 2FIRT 3B3IA 2DOCA 3VXQB 4QYAA 2YD2A 1ROWA 4OCMC 1IC4H 2DLEA 2H2PD 2DQTH 5E8EB 5FYKL 3J2PA 3BHBB 4DSYA 1U36A 2MNJB 4NUGH 1IGTA 1GY2A 1SOQA 5ALCL 4F7MB 4JPVL 4OGXL 1TTRA 4PLKD 1TLKA 4MX7B 4OGAC 5F3HA 5A16B 5C0BA 4TLUA 5FUCC 4N0UA 5C0CA 5J89A 3RB7A 1SFHA 3VG0H 3QRFM 4B9GA 3MV9A 2MCPH 4N8CL 3REVA 3MXWL 3SQBA 5F6HJ 5KW9L 1VFBB 4OLZH 3H8NA 4GW1B 2VRAA 1KB9J 2NXYC 1FVDA 2O6FA 2TRYA 2Q86B 3RAJL 4QTHA 5L88H 3FZUC 3GRWH 4KJQD 3VA6A 3ZZ1A 5DFVD 1EUUA 2C1PA 3QFDA 3HAEA 1NCWH 2X4TA 4NBYB 2YXFA 3VFGH 1U58B 1I1RA 3AWGA 3WD5H 4ZW7A 3BZ4B 3X3FL 2E9GA 3NBNA 3MRGB 3V6OA 1F58L 3MRIA 1S9YB 1SF3A 4KKBC 32C2B 2LW3A 3ES6B 1JNJA 1BM7A 1RURH 4HT1H 4F8LA 2J4WL 3TYFA 3DROB 1UXLA 1EO7A 2P5WB 3BSHA 4E41E 4YHZL 2FYYB 3BVWA 3D7PA 2CCVA 2WVTA 4P5KA 5E95B 2G2RB 5EOTB 1XH0A 2DS4A 3Q5YA 4NHCH 3KPOB 1GYUA 3TEXA 4P9HL 1J1XH 1JHKL 3VXRE 1GOGA 5FA4B 2R27A 1KJMA 4XNMA 2GTZB 1RJYA 2QPFA 4FADA 3V0HA 4CSZA 2B20A 1CGYA 5AAWC 2WOYA 3NFPB 3EJQA 4XCEA 5JHLA 3MKGA 5DHYB 4E9YA 2YWZA 2MOVA 3QG6A 4K71C 1RSYA 3OVUB 1S7XB 1U8LB 3E3QE 3MUJA 3SKUD 1TFHA 3P40A 5HYEA 4AV5A 2VR3A 5DD1L 3V0JA 4MD5B 3OKDB 1IQDB 1E5AA 3G5XB 4XWOC 5C08D 3L5IA 5HYJD 1XL4A 3HRZC 2WLYA 4HS6A 2VW7A 4D9RE 4MNHA 3JTSB 5IOPB 5EULV 3CSBA 3TO4A 3PL6B 3KPTA 2PF6A 2WZPD 4BELD 2NSQA 4L3EA 4FNLH 3BIAX 4HZAA 4JVWA 2R8SH 5KBKA 4G83A 4ADJA 2QGBA 4FQ2L 2IANA 5T3XL 3PWLB 4PS8A 4TNWK 3JWNE 1UCBH 4UZUA 5EC1B 4BQ8A 3MJ7A 1L5GB 1NIBA 3P0VH 4XO5A 4ADGA 3FSZA 3G9AB 3QJTB 3PG2A 4M5ZL 5EA0H 4YHIB 3MNZA 1TZAA 5LG6A 1P5VB 5EOCH 3RWHA 4Y8AA 3DX7B 5E56A 5JIDA 1PG7L 2AF2A 2Q76A 4ZUTA 4M5YH 3VFPA 3CN0A 1E9QA 2OKMA 3OL2A 3UC0H 4E41B 4FL4C 2NT0A 3E6FB 1E28A 3GXTA 1AE6L 3L3OB 1DQMH 2WM0A 3WFBL 3L9BA 3VXRB 1SM3H 1SXZA 5GS2H 4NQCE 1Q72H 3MFFA 5IQMA 5CLYA 1CC3A 4G8EA 3DGGB 1AY1H 4K5MA 2EKJA 2XN9A 5KN5A 1EAPA 2ZXCA 2WYIA 5DMGC 1GGCL 1N0XL 2Y0SA 3BKJH 3OHXC 2XZQL 2ZCKH 1AZNA 4HS3A 1UM4L 2DTSA 3T65A 4M8UA 3CX5K 4ZO7A 1DE4A 1OP9A 1G43A 4HHAA 2OR9L 1PFOA 1K8DA 3EO9L 3QS3A 4KVPA 3VRJA 3T4YA 5AKTA 1SXAA 4KQ4H 4LCIH 4AJYV 3CFDA 1O7SA 2X4PB 5I76B 4O2FB 5MEPA 4UT9L 3NZHH 3I74A 2AZUA 3WFEL 4DVBB 1U4EA 1UWXK 4M7JL 4Z5RB 1QYGL 1WFNA 1KBGH 1B4TA 1PKQE 4E5XG 5CO1A 1JXFA 2OTWA 3GBNH 1TZGH 1QLEH 3GXMA 4IBSA 1U8KA 5ELIA 4PREB 4KVNL 5EZOH 5BPPA 1BFSA 3N43B 1XCQA 1M3JA 4XBGA 5EIQA 5T8IA 4FG6D 1HAWA 2ATPA 3VU1A 3IF1B 1FO0L 1NGXA 4A7GA 4WF7A 4OCNC 1NCTA 3GHPA 4QY8B 4IOFD 2VDOB 2UVEA 4OF8A 3MJ8A 4PJDA 4F91B 1B2YA 2HVJA 5C0FB 1KBVA 1W6WA 4P3CL 5J6HA 3MJWA 4HPYH 2B0SH 2FD6L 3L9EA 4IRJC 1Q0EA 2FT6A 5AVSB 4N8UA 2MPAH 3KM2A 1A3QA 4NQCB 1YUHA 3QI9D 4O4YL 5HGHB 5IMOA 4X98A 4RGOL 1B2WH 4E0RA 1BZQK 3EJCA 3ZXAC 1WWBX 1B3JA 1RZJL 4QXWA 4I0KA 5AZ2H 1MCSA 4XXDB 2B4CL 3Q44A 4OJEH 1KLGB 2AXHA 4GKZA 1F97A 1XVSA 3INUH 4C47A 2XWCA 1DJXA 2ZWYA 2XWJA 3CFIC 4BE5A 1NGYB 3LRSA 3MBWB 3IWVA 5I1AA 4GUOA 5C0IA 3LD8B 3BQUD 4CVXA 1V3MA 1PJ9A 3SJVA 2I07B 1FC1A 4Z7NE 3TIEB 1PKQB 4JRFA 2GTWA 4YHNA 4TQ8A 2GSGB 1X5ZA 3U30C 4F57L 2BOLA 5FGCE 4O2CA 3GLEA 3RFZC 5FM4A 4K23H 3Q1SH 1YEIL 3ATBA 4J3VA 4YE4L 3L4XA 4B5EA 4JG9A 3FONA 4L2YA 4UT6H 1P4IL 1A9EB 2MPVA 5A1AA 2FWUA 4PRIE 4FZ8H 3OKOA 2YZ1A 1HE8A 1Z66A 5AG9A 4IIQC 1I8KA 4H4NA 4HZLB 5C08E 4KKCC 2QQQA 5HHXL 5HYJE 2EDLA 4HJJH 5E6SB 3IMSA 3OD3A 2ZCZA 5BW7C 3F8UB 2GBAA 5F9DC 1CBJA 3KYMB 4GXUN 2GIXA 4DP6X 2A9MH 4PRPE 1LO4H 5IEKA 3WN5A 4W70A 2J1YA 4EUPH 3AAZB 4Z7VF 4B9YA 3O8XB 1GY1A 3A6BH 5HDWA 2WXKA 4CSSA 4EVNA 2ESVD 4PCKA 3IM1A 3LXCA 3KPPB 5F7DB 4JLRA 5GGTH 4DFHA 4Y9BA 4F8OA 5JIMA 1I7ZA 4GMTH 3M7FB 4ZK8A 5LDSA 3OZ9L 3CFCL 4I9WD 1TJMA 4PGDB 1E0OB 3HHMA 4N8VB 4LLDA 3OKKB 4N68A 4P8QA 2AJSL 2O26U 1HH9B 4OIBA 2ZWZA 3VI4F 3L1FA 2XSKA 4ZO9A 5GIRB 4WCYL 1BG9A 3HNVH 2QADD 4JHAH 3HE7C 4QHMB 2F6AA 4PBVC 1E9PB 5EO9B 5EMYA 4APQA 5HXMA 2X9YA 3QIBC 2GIYA 2FATH 4HSAC 2P47B 3LV3B 3F64A 5FGCB 4B3VA 2WBJC 4AYBA 3EYFA 1UYWH 3DECA 3FULA 4QXTB 3BZDA 3O3BB 3V4VB 3MZTA 5G4NA 5HGBA 2PXYA 2UWEF 3ZDZF 1BAFH 1BXXA 4XNQA 3RX7A 1WD8A 4PRIB 3T2LA 3FL7A 1Q9OA 2WWOA 3VFMB 2W9EL 2ZOLA 2BNUA 2DQEH 4L37B 3MNWA 2O5YH 3ZSSA 5JIQA 1UWFA 5C08B 4R5VA 5HYJB 3CSGA 1AMXA 4BYHA 2H4EA 3NCFB 3FFDA 2FHFA 1MEXL 2YPLE 1JWSA 1KIQA 4Q6IB 4PRPB 3L4VA 4JPWL 1JPSH 2BNRE 1MFDL 4KKPA 2B5IB 4YWGL 3LX9A 3MRNB 1IARB 5HY9A 4WWOA 3U46B 1DQLL 3LZFH 4OAWB 2G0LA 2ITCA 3P0YL 4MJID 3TX4A 3KE0A 3DRQB 1T21B 1WWWX 3DARA 1X5YA 2AQRA 4O2EA 4WGKA 4XPGH 2F61A 4X9FA 3AMLA 1RUPH 3VFWB 1HQRB 5GZOD 1MPAH 1RAMA 1O7DC 5MI0B 4FQLL 3WENA 2X7LB 1DL7L 3D39D 1D5XB 2F2HA 3DX9B 4FXKA 3G5YB 4TULL 2FGZA 4WU7B 2DQGH 3I6GA 5E51A 4I0PD 5KYYA 2H6PA 4JR9H 1J12A 4GFXA 3FXIC 4HCRL 3ESMA 2VDLH 4OQTA 2W91A 4P04A 1NMBL 5I19H 1FZOA 4NP4L 3H7LA 3QORD 4XAWL 5JOPD 1JNLH 2X1WL 4UIKH 3D69A 1U41A 2F58H 4HG4K 4J6IA 2LHAA 1R5IA 2Q7YB 1R3JA 4FCAA 4IOIB 5I75B 5L4FA 1AHWB 3Q8AA 4LCCC 2C7UA 3S36X 3A67H 1QW9A 1TMCB 5GISH 2VMJA 1MWOA 3AG4B 3BP4A 2GB2A 4J39A 4OCWH 4OFKA 4OCYL 4BRVA 3JTBA 2AGJH 1NEZG 2XQBH 1I31A 2IH1A 2VWEE 3FUHA 5IHZA 4JHUA 3GSWA 4RGMB 2YPLB 4D7BA 1MHEB 3QUYA 2YBGA 1S5HB 1E4XL 4ZMOA 1J8KA 3QHZL 4S2SA 1AACA 4BHUI 2BNRB 4WI5A 4YBLC 3UBXG 3R0MA 1P0SE 5E70A 1UD5A 3VFRA 5DQDL 3UTTA 1MY5A 4X5PA 1RZIA 1MELA 3OKLB 1BIHA 5TE4L 1MUJB 4ZS7H 4FFZL 4MJ6A 4U6XB 4YC2C 5F72S 2ZIDA 1KSRA 5TGBB 1A6VH 5I30H 2F1BA 2OMXA 2BHZA 2XWTA 3L4TA 4HIJB 4QF1A 3GS7A 5J3HC 1R5VB 3ECBA 3M88A 1G7MA 3KJ4C 4WVRA 2D3JA 2UY6A 4HUKB 4LLWA 2EIMB 3N1QC 1PIFA 1PLBA 1NA8A 4LPWA 4HJTA 5EU5B 2FBRA 2X1PA 1T5XB 4HZ1A 2WUBH 4NFDA 4A2MA 5CCHE 4PG9B 1X7QA 2G4GA 3EO0B 4XH2B 1BJ8A 1ED3A 3DRTB 1DQQB 2CD0A 1O5DT 4KDVA 4R2GC 3QDGD 4JN1L 4RMBA 3ARBB 3KL0A 3VSQA 4U1JA 4MMYA 3GGWB 3FT9A 3B6SA 3DWTA 3VTTA 5F88B 4Q6YA 5LGJB 3KNBA 2DICA 3BFWA 4I9WE 4Y19E 1TG8A 5IB5B 3C12A 2P4AB 5CU5A 5AD0A 2H2SD 2FB4L 3UCQA 1PZCA 1MLBA 4OF3A 4PWEA 4OM0H 1CD1B 2EEBA 3BQUB 1JTTA 3PGFL 4EQ3A 1OGAA 2XV0A 2GAZA 3EBIA 2WY3B 3TN0A 1N4XH 1QPKA 4HH9A 4RMQA 4XOAA 2VXVL 2AS5M 5DRZB 1ANUA 4PJ9B 4TSAH 4KAQH 4QGYA 2ITDA 5LWYL 5TDPA 1BFOA 4NQDE 4FKKA 3FB6B 3NH7L 3EYOB 3HG1E 2R2HB 4HJIA 1DDTA 2A83B 4AV0A 3QVAA 3UP6A 2BP5M 2XTJC 5C09E 3FRUB 5E2TL 1TTBA 2R2BA 1ZLDA 1JF6A 1MH5B 2J8UE 5KVEE 3CDZA 3W2DL 4FZEH 5ICYA 2MHAB 2M26A 4NQXA 5TJWK 1YDPB 4OD2A 2WGNB 4PFEA 2X6VA 4GYBA 1OAXL 1FHNA 4PJDF 5D9SB 1CDBA 4QXGL 1LILA 2QHLA 3RL2A 4RIRB 4YSUA 3EDKA 4OCRH 1AJ7H 1DO6A 3VDBA 3CBKB 3NZ8A 2BSTA 5B22A 1BF8A 2LR4A 1VPOL 4M9OA 3SD2A 4NOBA 5DFAA 4HHGA 2EDRA 3FSWA 4GSDL 3UZEA 5FCUL 3HI1B 4MJIE 3K8KA 5BZDB 1YYMH 2TAAA 4LO9A 2IAMC 3GMPB 2J5LB 3BH9A 4WU5B 1D5BA 5TD4A 4XGZA 3U2SB 4JDEB 2DYRB 2R2EB 3WL9B 2WNWA 1SMOA 4Y19B 2XPZA 4LNRB 5H35B 1W8EA 2EUWA 2QGEA 1VEPA 4G42B 5I17B 3I84A 5KBNC 2I5YL 2A4ZA 2MH4A 1Q0XH 4WZ9A 1HILB 3HG4A 4GO8A 2UZPA 4ZSOA 3RGHA 3UZVA 1T1ZB 2NNXA 5CHNA 5LQBL 3IDJA 1ONQB 3ME0B 2R39A 4QIRA 5CNHA 1HHGA 2QADB 4J3OD 4NN5C 4YSTA 5KG9A 3MLTA 3T4AB 2H1XA 5JOPE 4KFZC 4Y0GA 2JSFA 4KH9A 4NQDB 3H7BB 4PIRF 4U1GC 4TF4A 6FABH 1I1FA 2X44D 1G7QA 1P6WA 1RPKA 2EADA 3HG1B 4WLCA 5TDOB 4BUHA 5K9KA 5J6GB 1LP9A 2X3BA 3KWXA 3BWUC 3KW7A 5C09B 3CAFA 4IMKA 3HHSA 2FQDA 4HV8A 2YFNA 3QYNA 3O6FA 1EHKB 2J8UB 1GW6A 2X4UA 4JANB 1R46A 3AFLA 3CZLA 3HG0A 5JIIA 2MSPA 1CDIA 5FO7B 3RI5K 1NIAA 3ZYOA 1CF8H 2EKSB 4ES8A 5H37G 3GWJA 3OPZH 5C07D 4UMSA 2W38A 4LCYA 5K39B 5I18H 5DURD 4C8XA 2X3AA 3VJ6A 3THML 4JZOA 2H26B 3FQWA 4EIZC 4F7PB 4RH4A 4OZFH 4MJIB 5E9DA 1NM4A 4KDTA 4QRBA 3RZCA 4AEFA 1HXYA 5TFSL 4XWGH 4N2HA 1JYXA 1EXUB 2PWHA 3NT0A 1U9KA 4DN3L 3ESUF 3FUIA 1T2QH 4G1MB 1NPUA 5B3JE 3GXDA 2JLPA 3U6XS 1KCKA 4X7FC 1BAWA 1IX2A 2FR4A 3BAXA 1MAML 2VDQL 2XXGA 3AACA 3ISYA 4I5BB 1QFWL 3MC0A 1QHOA 4R90L 2HLEB 1UXWB 2JIXA 3CHQA 1CD8A 1U8IA 3IDUA 1EGJA 3RVUC 1HU8A 1IBFA 1NC2A 4LXFA 2EE6A 2QZQA 3KWWB 1AI1H 1XR8A 3CMGA 1OTSC 4RRPG 4ZJ9A 3WGUB 3Q7JA 4W4OC 3IGAB 4BFEA 3QDGE 1DQJA 2NNCA 4NJAL 4F7KA 5B7FA 1GSMA 1J10A 1WSST 2BOCB 2DH2A 43CAB 1F4YH 4DFIA 2DMBA 3L13A 1Y0LB 3MBEA 3IAGC 1NLDH 4KGJA 4IRZA 3WS6A 4I88A 4HFWB 1TU2B 2AV1B 4NKDA 1X4ZA 4A6YL 1LJMA 1ZHLA 3L1GA 1DVXA 2Y2YA 4JPQA 3WIIH 3MX0B 4FG2A 3D2UB 5EV7A 1N3NB 1ZVNA 1A6WL 4K9EC 2NX5A 4LPYA 3QWNA 4ZFFB 1Z7JA 3C9NB 5F89B 4ONHA 4ISVB 1INEH 1UHVA 1RJCA 2K45A 4KY1H 1KZQA 1EQWA 4AYGA 1V05A 1NMAL 1EA9C 1SOKA 4K3JL 4PI0A 3MACL 2YRBA 2NCEA 1S7UA 4KXZI 2ED6A 1UATA 4H88H 1CK0L 5D7JD 1QVOB 1T4KB 4F7EA 1VA9A 4PJFE 4PLJD 3U25A 3N2JA 4MQTB 4DKAA 4X9HA 4HJ0D 2FO4B 4ADIA 1PAZA 2V3EA 3LEYH 3WFCL 2DEXX 1NBYA 4XCCH 3CFKA 2NLJA 2VMFA 2XZCH 1XGRB 3QDGB 4FLRA 4W9ZA 3T2PA 1TQUA 3PABB 1MNNA 2O5NA 1NBVH 4TUJB 3X12B 3ELQA 2A6KB 2GJRA 4KO6A 2NY4D 4NUJB 3RILA 3CVDA 3CK0H 2CWRA 1MFUA 3WY3A 1TKWA 1YY8A 5ILTL 1SVBA 5DRWA 4X6EB 1AS7A 5DJ8B 3RX5A 2FJHA 4Y5YB 1L6ZA 1TYEB 1RP9A 3FCTB 4MYPA 4N9OB 4DGYH 2E9JA 2Y1YA 4KK9D 1PKOA 5B38A 2XIIA 2XX0A 3O9WA 3TPKA 4JO8A 1IGFH 1LQBC 4YHOL 2L3BA 3G6DH 1HEZA 2OMBA 4U3SA 3SKJH 2HUEA 3AUVA 1UH2A 4W9LC 4AIOA 3QJSB 1AR1B 1BX2A 1H3GA 2IQAB 4HC1A 4LSUL 4ZS6C 1W8NA 4U31A 3V0GA 1IE4A 4M8VA 4TQIA 5DVMA 1SDYA 1HCYA 4W9DC 4XOEA 3OXSB 3WLBB 1H6FA 1T5WB 1UACL 3GF8A 3MRFA 4IHOA 4PJFB 1A7NH 3I3BA 4HETA 2EJ1A 2Z7YA 1K8IB 2OSLA 2EO7A 2TSAA 3FB8A 4UU9B 5CEXA 1ZLSH 4AEHH 4P2RA 4DERA 4LIQE 4Y2LA 1WLHA 3RPIB 3G6AA 1KB5H 1EHXA 4JPKL 4FABL 4UDUA 4MDIB 5FDWA 1YJDL 4NC0B 3FQTB 3L7FA 3OAWA 1JNNH 4J4PA 1HFUA 5G4MA 4KOCA 3O6ML 4H8UA 2AEQH 4HPOH 2ARWA 1WIPA 3SE4A 2L04A 4UAOB 1MW0A 1R5WA 5FYJD 3AB0B 5E2VL 1G0XA 4TL5A 2IG2H 5T1DL 1XGZA 1JN6A 4YSRA 3BAIA 4JFTA 4P4KC 1U91A 3QZPA 5GGTA 4MAYC 1FCCA 2CIKA 1YEDA 2Y6SD 2UX7A 4Y4FA 3WDIA 3GSQA 4TQHA 5T1KA 3TLRA 3UAEA 4R6UA 5H2BA 2NR6A 4FA8A 1L9MA 1UOVA 4ZFOB 3N9GH 2G3MA 3GJEB 1RUAL 4A68A 1AOHA 2VLMD 2X4SB 4TPRL 5FB8A 4PR5A 5E6ID 5JLZA 3KPLB 4LVHC 5JYLA 1I3GH 3II2A 4AVKA 4ONGL 1KT2B 2FBJH 4V1DD 4O51A 1XSOA 2N56A 4M00A 4OJYA 3RFRA 3FCBA 2P8PB 3EGDB 2B8OT 5D71L 4WQOA 4DGVL 1P4BH 3GI9H 3SO3B 2YPVL 4ZFZB 5I66A 4AJ0A 3FUEA 5E2UL 4UQBA 2XY1A 4P23B 1DEEB 3DXAE 2IC2A 3SDXA 3B9EA 1T2XA 5DLMH 5CCKH 2YO3A 1U30A 5TF0A 1UENA 5GGQH 2NZ9D 2P24A 3QCTH 1V3KA 5HHPA 4XMKH 5JXEA 3GMQB 4RWYL 3T0DA 4GXVL 1J05B 1BOGA 4MJJA 1FL3A 3VFUB 4O00A 3OF6D 3P4NA 5IF0B 2LLGA 3KVDD 1TOXA 2DBLL 5IUCA 4JY5H 1Q9KB 3W56A 4AGMA 4JHWL 3TBSA 4YDNA 1JNHB 3LKQB 1JZ8A 3M1CA 5PAZA 1B6UA 4MDJA 2WLLA 5KUMA 1B0IA 1M42A 2CK0L 1W80A 4S1SH 4Q9QH 1NCCH 4GI6A 1JFHA 1R3LA 5K9OA 3V0DA 2H8PA 4XNXL 2MCG1 1P4LA 1VZHA 4HIQA 4FS0A 4YH6A 4FFTA 2P1YA 1IC1A 3EOBB 1KV3A 4ZDHB 5BRQA 1I8UA 1PSKL 4ORGB 3BDXA 5DJXB 3GSVA 4YSOA 4RDQF 3SQOH 3VXQA 4QXVA 4AQ1B 1T03H 3OLGA 4Z1PA 5JOFB 25C8H 3GEFA 4Z0XB 5F1NA 3MV8A 5E8EA 3O3AB 1LP9F 1FQ9C 2P48B 3BHBA 2BWDA 3SE8H 1DJGA 1RERA 1E7UA 3V10A 3RVTC 5AW7B 4IK6A 1B90A 1B0RA 2YGVA 4MX7A 3X11B 2R56L 5A16A 2HVKA 3X14B 2WMPB 3Q9QA 2JKRM 4HQQL 2BIOA 4KVCL 4XP4H 5IVNA 3DXAB 1VB9A 4WJKB 1CCZA 1LO2H 3RKDC 4BZ2A 4IS6A 4LHUA 2BVQA 1E4JA 1J5CA 2PMZA 1FSKC 5JW4M 4JFFD 5C9KA 5J0BA 3ZL2A 2X2IA 5GSVB 5IR1B 2MQGA 4QHKJ 4Y1AE 2BDNL 4JS7A 2XXCB 3HS8A 2WLIB 1U58A 5C2BL 2WWKT 4M93B 1J5HA 2D73A 2WAHA 3BPCB 1CI5A 3MRGA 1AIZA 3P11H 1ZK5A 1IIKA 1WBZB 32C2A 2XV6B 3TASA 4AEIL 2ATKA 1XTLA 3DROA 3RWCB 4F33B 2P5WA 3ZDYE 2FYYA 2QV2A 4DK5A 2DWTA 1PIGA 2XQ0A 3BUBA 5JDSB 3HC4L 2G2RA 4QHLB 2DTMH 4OJCA 4X4MA 2O93L 4B50A 1P1ZB 4PB0H 3NSJA 4G59C 3E2HB 2RCSL 2PW2A 5HPOA 4JREB 5FA4A 1BA9A 2GTZA 4XVJL 2NY1C 1R9FA 3LYRA 2COQA 1ZKAA 1UD2A 1IGMH 1RIUL 4TQEL 4Z18A 5E8PB 2FECI 2C3HA 5D1ZB 3RTQC 4XI5D 4P5TC 1XCTB 5DMIL 3BGAA 3CX2A 4G7VL 4LSRL 5I1IL 1N7ML 4JL2A 2J73A 4OGAD 2H47C 3CE1A 4QR7A 3PYCA 2NY4B 3P4MB 1U8LA 2BIIA 3T1WA 1YQ2A 4OY9A 3VFNB 3GMNB 5C6TL 5LJYH 2OL3L 4MD5A 4Q7DA 3QW9A 4MXVE 1IQDA 3IMWA 3G5XA 4Y5VC 1ZTMA 5AFAA 1ZEAH 3OTTA 2WWKO 5EU3B 3SY0A 2NXYD 3JTSA 3H2PA 4HK0B 2Z9TA 4JGMA 3PL6A 2VAAB 3AMKA 1RPQA 2HWZH 3DTDA 3D51A 3QJUB 4YHML 2ATAA 2BNQD 2C9AA 3DMMB 3RQ3A 3VD3A 1CS6A 2YEQA 4L29B 3O45B 1E6OH 2CCLA 5K93A 2Q8AH 2HX8A 1XMWA 4Y1AB 4XC3L 1AGCB 3CFTA 3QCVH 5EZPA 4PJ6A 5C0NC 3VXPB 1S7VB 1FNSH 5IGXH 4KKBD 3HKZA 1OTUD 2A9NH 3DV6B 1CFVL 4D0CA 3FTGA 3S88L 3KYAA 2E56A 4YHIA 1SPDA 2PCPA 3VXNA 2BSED 2CGRL 4LZKA 5IROA 1P5VA 3WFDH 3DX7A 2EXSA 2B15A 4FFWC 4Y16D 2W80C 3FOLB 3QNZA 3R4DA 4KJPC 3BAKA 3ZDYB 3KGSA 4E41A 2Y36H 3M45A 3OKEA 3E6FA 1KTDB 3LZRA 5BMFL 4OD3L 4KK8C 2VMDA 3HB3C 4YHKL 1MCRA 5PCYA 4I48A 1QRNE 3VTMA 2WQWA 1GYWA 2WO4A 4U7KA 3UYPB 4QTFA 1OAYL 1AFVH 1ORSB 1XAKA 5B3NA 4P2OD 4ZW6A 3NIGE 3RPKA 2WWNA 1UC6A 3PHQB 2JKNA 4JHBA 3BO8A 1L3WA 2XG5B 4PUBL 3STBA 2GJ6D 3V8CA 4L5FE 1JWMA 2XBDA 2XY2A 5CILL 2X4PA 5I76A 4O2FA 1QW8A 3R06B 2PYED 5AOJA 3ABKB 1SHWA 2D4DA 4EIGB 3S5YA 4PN6A 2O5XH 4G6KH 4Z5RA 4YGVB 2QKIC 4KZDL 3HMWL 2K8QA 1FNAA 3D50A 5D70L 2W5PA 2EVFA 1K85A 4Y2NA 1EO8H 3FHAA 1SJXA 5E6IB 1K6QH 4PREA 2NY3B 5LBSA 3TZVC 2R0LH 4JO2L 3U4BL 3IVKB 2VERA 3E1ZA 3K72B 3IF1A 1UUSA 2YSTA 1W6LA 3UIYA 5EIIB 1F4WL 1PX4A 3OB0K 4QY8A 3V0WH 3KAAA 2FJFA 5F21B 2LGNA 4WTWA 3HKFA 1YJDC 4DO4A 3CSFA 2GKIA 5A3IC 4P5SA 2F8XC 4IDLA 2Z31C 4LOFA 5C0FA 1SBSL 1FLRL 5LXGL 3RVWC 3HG5A 3MODH 3F84A 1BJ1J 5B4MD 4KKRA 1MN4A 5DMGD 3NZSA 1AQHA 4IRSD 1QRNB 1K72A 3MV7A 1PF3A 2F19L 3WEAA 4AQZA 5HVWA 1UM5L 1ZVSB 2VDRL 5FF6A 3WSQH 1QBMH 1XSJA 4Z7QF 3IBOA 1X9QA 4GS7C 5C0JB 1KLGA 2VQUA 4LHQB 3HHRB 3C5JB 2PLTA 3NIGB 3B8YA 3D9AL 1DQKA 4PMEA 1WBYB 4TSBH 3P02A 3NJVA 4MSWB 2DQIH 3V6OC 5IHUH 2P46B 3D18B 1NGYA 4TTGA 3IS1X 3V4PH 3N85H 3LH2L 4D3CH 3MRRB 5C97A 3JZ7A 4LDLB 2KI6A 5C6PB 2Z91B 4MD0A 4XBEH 3NN8B 2I07A 2FO8A 4BH8B 4HPHA 1F1DA 1NUDA 3UH8A 4P3WA 2GSGA 1YNKL 2WXQA 3ZK0A 1ZLWK 2IF7A 3BSGA 5EUKB 1HSBA 2XOTA 5ACZA 5FYLH 2BSCA 1KBKA 4X4ZA 2NMSA 4QHUB 3VXMD 4LL9A 5EIVA 1VENA 4MJ5B 3S97C 4YHYC 2C3WA 1S7TB 1OZTG 3P73B 3C5SB 1YPZF 1A9EA 5FUCE 3A23A 3D3VD 5K9JH 3P9LB 1KDJA 3IFLH 2EDYA 2D3VA 1HIMH 5BV7B 4WY7L 3AXLB 2PO6C 2WIIB 2RHEA 1X4XA