1E9QB

Crystal structure of bovine cu zn sod - (1 of 3)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
151
structure length
151
Chain Sequence
ATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDDERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTSTGNAGSRLACGVIGIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Variability of the Cu Site in One Subunit of Bovine Cuzn Superoxide Dismutase: The Importance of Mobility in the Glu119-Leu142 Loop Region for Catalytic Function
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE
total genus 41
structure length 151
sequence length 151
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2000-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1e9qB00
2Z7UA 1U3NA 3HW7A 3GTTA 1Z9PA 1HL5A 4U4IA 1B4LA 4B3EA 1DSWA 2AQRA 3CQQA 5CU9A 1E9QB 2WYZA 4BCZA 1MFMA 1BA9A 1TO4A 2APSA 3L9YA 3F7KA 1IBFA 1AZVA 2ZKYA 2K4WA 2WKOA 1COBA 4A7GF 2Z7WA 1F1AA 1EQWA 1Z9NA 3MKGA 3KM1A 4A7VA 1N19A 2E47A 3HOGA 4MCNA 1E9OA 2AQTA 2ZKWA 1CBJA 2AQSA 4A7QA 3KM2A 4A7UA 2GBVA 1OZTG 2GBTA 1N18A 1F18A 3MNDA 5KBMA 2VR7A 3L9EA 1QUPA 1SXSA 1HL4A 3KBFA 3GZPA 1EJ8A 1E9QA 2XJKA 3F7LA 1SXZA 4OJAA 4A7SA 1OAJA 4N3TA 1P1VA 2LU5A 2XJLA 2Z7ZA 2E46A 2AQNA 2WZ6A 2ZKXA 3PU7A 2ZOWA 4N3UA 3GQFA 1OALA 1IB5A 1XTMA 2SODB 2C9UA 2JCWA 2WWOA 4FF9A 1PU0A 1BZOA 1YAZA 4A7TA 1KMGA 3GTVA 1OEZW 2JLPA 3S0PA 1PZSA 1Q0EA 2AEOA 1F1GA 1YSOA 4BCYA 3QQDB 1L3NA 2Z7YA 1JK9A 1E9OB 1UXLA 2V0AA 1YAIA 3GZOA 2GBUA 3RE0A 2NNXA 1SDAB 3ECWA 2WZ5A 3GZQA 2AQQA 4A7GA 1DO5A 1SRDA 3T5WA 3ECUA 1SXCA 2WWNA 3CE1A 3CQPA 3QQDA 1PTZA 1JK9B 2C9SA 1TO5A 2Q2LA 4OH2A 1B4TA 1XTLA 1IBBA 1FUNA 1IBDA 4BD4A 1SDYA 3KH3A 1SXNA 5KBLA 3ECVA 3HFFA 3K91A 1SOSA 1E9PA 1OZUA 4L05A 4MCMA 3SODB 3KH4A 3H2QA 2VR8A 1SXBA 2WKOF 1F1DA 1CB4A 2R27A 3LTVA 1RK7A 2WZ0A 1UXMA 2AF2A 1SXAA 1E9PB 3KBEA 1JCVA 1XSOA 2VR6A 1ESOA 1SPDA 2WYTA 1IBHA 3H2PA 1S4IA 2AQPA 5KBKA 2C9VA
chains in the Genus database with same CATH superfamily
5IW6A 2HH0L 2OK0L 1XGRB 4HS8L 2XY2A 4LIQH 4KXCA 5I1EH 2IALB 2XSKA 2UY7B 4UBDC 5KSAC 5MEPA 3FSOA 4NN7C 1XVSA 2RAMA 4Y5YA 2NY4B 5FM5M 3CN1A 2PYFA 2Q86A 3KGSA 4NZRL 1QNIA 2Y9RT 4AX3A 3O2DH 4KUZH 1UXWA 5GGTL 3KXFD 5C0CD 3ARED 3Q06A 3BPNC 4XNYH 4XTRD 4JG1L 2F7OA 4X6EA 2J1KA 3W81A 3CFQA 1RZ8A 2DLFH 1B3JA 4RMRA 2J3SA 3IDIB 3PAYA 1OQOA 4B0MB 4WW2B 4ODSL 3BKML 3NBNA 2PPDA 4LVNB 4OAWA 1A21A 1G7PB 1EGJL 3TCLA 1P5UC 2QGEA 3BWZA 2KPWA 1CK0H 4LNRA 5F71A 2DMGA 4X98B 1KNOB 2B59A 4HT1H 5CWSB 1KV7A 2BC4B 2CKBH 2KKQA 4L37A 1E4XI 1PG7L 5E5UB 2K6ZA 5F7NC 4NZRH 4DQAA 4X6DA 3VXUD 1DVQA 2IDTA 5C09D 4FEMA 3BFOA 2BVQA 4MNQB 5JXED 4XMPL 1PZ3A 2AK4B 1IJNA 4NSKA 2HVKB 2JIXA 2N7SA 1EFXD 2ZXBA 1I9EA 3NCBB 4JO5A 4K07A 4WK0B 5HSFA 3ZKXB 1ASPA 1C8PA 5EC1B 3K0WA 1BFOA 3BKMH 2DQHH 1LO2L 3TA3B 1QW9A 3ZKNC 1J11A 3BIBX 3QDJB 4YLQT 3S2CA 2IPKB 3WFEL 3LN4B 3VNZA 1E8ZA 1KGJA 3F58H 1D2PA 2BVPA 1HXMB 2ZUWA 4CUCA 3AY2A 1INDL 4EDWL 4A39A 2WGXA 5H94B 4OZ4B 1T1ZA 2MWCA 3VXRE 1SDYA 2HX7A 1KWKA 1ZWIA 3FS9A 5I66B 1QWUA 2G4GA 2LABA 1XGPB 4MCYA 4QXUH 2XNAA 4NZ8A 1T2JA 4YDNA 4RZKA 1D6VL 2XRAH 3UG5A 1G7JB 1ZTXH 4HWBH 3T65A 4P3DB 1REIA 4BK5A 1P1ZA 4RX4D 5CKGA 4QRSB 3SY0A 3U7WL 4MAYC 1V05A 2BXYA 3MV11 3SJVE 3SE8L 2XTJB 4FFWC 4BE6A 4Z7UA 3F58L 1BZ9A 3P3UA 2DWYA 1WEJL 4OTXH 2X4OA 2XQYK 4TNWF 4X99A 5E1AB 3BN3B 3A4DA 1M6OB 1KJ2B 4ZMOA 1JGUH 1I7TA 4PJFE 5TH2A 3ZU8A 1A4KB 3GXPA 4H0LC 1M1XB 2ED9A 4E0RA 2LR4A 4HJGB 4ZTOL 4K8RH 1WFIA 3VQMA 3QEUA 4JR9H 1CF8L 1F1AA 2YRBA 2BSSA 3GMNB 3W9DB 1AGEB 4UNVA 2WCPA 1JGLH 5HY9A 2AW2A 1XV8A 1G7QA 3INUL 3MXWL 4JPWL 4NO0B 4BIKA 2OXGA 4K3GA 3QORD 1AVAA 2DIJA 4RGND 3F8UB 3L3JB 3UZEA 4KAQL 2A73B 4AUJA 3SEPA 1OOAA 4NN6B 5LXVA 3IFLL 1NGYA 4C4UA 1KGCD 4ZMWA 3HMWL 3SYCA 4NC1E 1FVDA 4XCYA 3PIQA 1YEKH 3IMRA 1TZHB 2ADYA 1TTGA 3H9SE 1IAKB 1H15A 2NY5L 4A7SA 4N3TA 4OZFB 1FFQA 1P4BH 4J3VA 5DYOA 3P4OA 1AIFB 4LEOB 4P23B 4KZCA 1CDCA 3VD5A 2C9UA 2F7RA 2CDFB 3NZHL 1DQVA 5FYLH 5C07D 2VXTL 5I1HH 2LOEA 2COVD 5EA0H 3E6FB 3QZWG 3RVVC 4XBGB 5FDWB 1C9SA 3NCMA 3HI5L 1AKPA 1NC2D 1UHVA 1WZAA 3MXWH 3QFJB 2RQ8A 1LEKA 5FYKD 1RUPH 4KAQH 3MVSA 1BXUA 1KTDB 1URLA 2WUCL 3B7TA 1K5WA 1E7VA 3D39E 2A1WL 3LKSA 1QP1A 4FL4B 2PF6A 4QHMA 3LIZH 3O0RL 2NNAB 3CZSA 4XE5B 4MZ3A 4M6MH 4OF7A 2X4RA 1P53A 1QTSA 3K6NA 5AG8A 4EOWL 3IGKA 1GGUA 4LOEA 4L8DB 3H9SA 3MGOB 3MRCB 3TBWB 3W9EA 1Q4NX 2VAAA 5I6OA 5GS2H 1JZ2A 3DOSB 4KKRA 2VDLH 5DD6A 3PXJA 3QO1A 3L2LA 1L7TH 2QJDA 3HRZC 4K3DH 4U1GC 3F7PC 1UB6A 1SVCP 3C8DA 3B7SA 3HI5H 1WWBX 3SOTA 2X4UB 3B56A 3LRMA 2MOQA 5C97A 2LT9A 3P0YL 2VZSA 2XWDA 3QC5X 3GXTA 5IJCC 3GXUB 2QZQA 4FX5A 2WZPD 3HHSB 2L8AA 4JM2B 3LZFH 1A7PH 1P2CB 4Z7UF 1OP9A 1LQSR 3O0RH 3E8UH 1ZHLB 4Z18A 3HE6A 4EOWH 3ETBF 3S5YA 5E2WH 2RTTA 3L4WA 2WQXA 5HI3D 2H3KA 2O4EA 1GW0A 4X7SH 2X10A 5I9QB 5CJOH 1B9KA 2IBGA 1JWMA 1GL4B 3C60D 4N5UA 3X11A 4HA1A 1U6AL 2FL5A 1U8PB 2B1HH 3T3ME 4BKLA 2CCVA 2WOYA 1XB8A 5LUMA 3QR2A 4LGPB 2HJKA 3OV6A 5TFSL 3DV4A 5ID1B 4QTFA 3D87B 5CN3A 3L5XL 1FC2D 2H2PD 2HJFA 1ZLWK 2YPLD 5IHHA 4AIOA 3LNFA 1VEOA 3QIWC 2V7NB 1DDHB 1LP9A 3MNWA 3ORJA 3DX8A 2CJUL 4JY4A 4PW3A 1XZWA 3UBXB 3VFVA 2VLRA 1NBVL 2FX8H 2I60H 4Y5YB 3SQBB 4PRDA 2DQUH 1H3PH 1Z9MA 4BCXA 3IE4A 2GC7C 4ZG1A 2ENQA 5AW7B 2E46A 3K2UL 3UYPB 2ZOWA 3Q8EA 3HE7B 5EZPA 3FU5A 1FFNA 1N2RB 1PKOA 3GO1H 2D03H 1MFBL 3P9WB 4UM8A 5E9DA 5EV7A 3WNNA 2QPFA 3O9WC 2JK5A 5AB0A 2X05A 4K23L 4EVNB 1WUZA 4IHOB 5BV7L 1GR7A 3MRDA 3UGEA 4JFZH 3LEVH 2VZVA 2YAOA 4UANA 5FGRA 3WLWC 3ZO0A 3MV8D 4XNQB 1U8LB 3HS0C 5FWRA 3O6MH 4R7DA 4J8QA 4UI2A 1G7PA 3TCLB 3L4TA 1A9BB 5T1LB 5E7FA 4GKLA 4RSYA 3L7FB 2QTVA 3EFFB 5SWZD 1DO5A 2H6PB 5I1EL 4WSJA 4KKZA 2EKJA 5DUML 1NH6A 3C5ZD 2DQUL 3QFJE 4OZGE 1P84J 4LSUL 4RISH 2B15A 5DMIL 2ITEA 3TPUA 1PSKH 4BYHA 3EXLA 3GUTA 5CSGA 3L3DB 3QDGD 3V0HA 5D6CA 5KVEE 4E5XA 4F9LA 1FVCB 4PWHA 1EUUA 3GWJA 4QRTB 1UD5A 5JPNB 4QOKD 3LS5L 5BV7H 4Y9FA 2Y23A 4QXWA 4AV5A 2NUTA 1HHKA 1YEFH 4ZQKA 3HR6A 3MRIB 4JO4H 4R7NA 5JIPA 1KLUB 4IGBB 3L95B 4UZGA 5IW1A 1MFEH 1UUSA 4AEIL 2I32A 3RL2A 5CEXB 4WRLA 3NJMA 5I24A 1CF1A 2F54E 2F18A 3RILA 4PLKD 3TNNB 4D2NA 4IOIB 3DBXB 1F97A 1U8IB 2F2HA 3L3HA 5C7XL 1WIUA 4YIQB 3JTSA 4KNQA 1G7IA 4YR6A 1CFQB 3CQFA 1Z32X 3GI8L 5LGYA 1VFUA 2AV1B 3P0VH 5JIKA 3ZYZA 3V8OA 4GG6E 1L9SA 4OLZL 4PJXB 3AGWA 4JHAH 4U3HA 4Q6YA 3KLKA 2DWTA 4KK8D 1IAIH 5C6WH 1OAUH 3GJFK 1L0PA 1RP8A 1G0XA 1YCSA 4ODXB 4PJ8B 4ZDHA 3VH8A 3U25A 1HDMA 2VDNH 2NY1B 1O9ZA 3MI6A 4Y4FB 4BBWA 3OB8A 3PL6A 1D9KD 3ZZLA 1MFEL 5SWSA 1C7TA 1YQVL 1RZFH 3REWB 4NAJA 1QEXA 4ZMTA 5JOEA 4KO5A 4KKAD 5K9KA 4KMTH 4E41E 4MXWH 3OJMB 3ZDYB 5DRZA 4L29B 2HCZX 1N0LB 4ZW3A 2QDWA 3ARFD 2LLGA 1F6AA 4Z77A 4KRLB 1I8MB 3QNXB 3KLLA 2Y5TA 1YMME 3LEXA 4G80A 1PF3A 4PRBA 4CGTA 4AIZA 4RBPK 1G5AA 4AGLA 1WJ3A 3GM0A 4Z7NF 3OAYH 4B95C 3G6DH 4YSQA 4Y5YC 3DYOA 4YHIB 4AOFA 2VDNL 2ADJA 1OCCB 2EKSA 2R1XA 2Y69B 2DBLL 2YPKA 4L9LB 3QZMA 3DURB 1MHPH 5BW7C 3O9WB 2VLLA 2EINB 3ARPA 4W9LC 4HK0B 2Y24A 1FH5H 2GJ6A 4KMTL 5LGHH 2DMCA 4G1MB 1NSNL 2B2XL 3RY6A 2DTSA 2JIXD 1UM6L 1LL1A 5LHDA 5DT1L 3IDXH 5E6IB 2HSIA 4OCWL 4Y4HC 5TQ0H 3MBEA 2Q7YA 5INCA 1JGUL 3UJTH 3CC1A 3QZWA 5ERWB 3RVTD 3EFOA 5JHDB 1VFOA 2VR4A 3KD4A 2AXGB 2K1MA 2P49B 4UUJA 1IKOP 2PP9A 4UU9B 1QKZL 3N41F 4FYSA 1T83A 1TZGL 4QRUA 1DBKL 3SZKC 3VFNA 5K9JL 4XVJH 3PQYA 5DHVH 1A6ZA 4HJTA 4AYBA 2F08A 4KZ0A 1T80A 3SCMC 5BZDA 2Z6FA 1UQSA 2DBLH 3MU3A 1RY7B 1FDLH 2FHBA 2XWEA 3K8KA 3BFWA 5GS0D 1PX3A 4K5NA 2YD2A 3UADA 3CVIH 5E70A 4LHUB 1HEHC 2C9VA 1J1PH 1O5DT 4WWKB 3OMZA 5DXWA 1NSNH 1ICTA 2WXHA 3FONA 2DQJH 4OCNC 4PJBF 2DMKA 2X4RB 4UQ2A 2YA2A 3ZSTA 3VYOA 5GGVH 3GTNA 5JHDD 1QW8A 3F7YA 1M4KA 4FLSA 3QC6X 4PGEB 3C5JB 5EIIG 4TOYH 5DMGC 4JY5H 4S11A 3LH9A 4HD9A 4JHBA 4L37B 3UCRA 5HGHB 5I6LA 1ETB1 4PW4A 1OV8A 3FT4B 4OCYH 5TQ2L 4TVPL 1CXKA 1KT2A 2ICWA 4ISVB 2YEZB 1XB3A 2FJFB 3EYFB 1WBYA 4MWFB 5KVDL 4XN5A 4WNQB 2Z92B 1EHNA 5T5FH 4WWOA 4ZW7A 5HHVH 4RBPH 3SPJA 1A7RH 1BWMA 1FDLL 1BF8A 4OM1H 2XKNB 4ODHL 4DESA 5EEUA 4HIXH 1KN2L 4NN7B 3QUZA 1G87A 5D93C 1OO2A 1FFOA 1Y18A 5IVZA 3H9SD 3OKMB 3JTTB 5F0LB 5ILTL 3ZDYE 2A9CA 5TPWH 2FGWH 4M6ML 3VD2A 4YN3A 2G2RB 1LD9B 4HF5H 1TJXA 1FNEA 4OT1L 2OYLA 3W39A 4ALAC 4KKCD 2VDPL 3QORA 1UD8A 1TIUA 4WGKA 4LSVL 2CXKA 2VN5A 4HUMB 5KG9B 5D2LB 2CLRA 4L4TE 4KI1A 1F4WL 4ZRGA 4FYQA 5T1DL 4C57C 1SLWA 1QBBA 3RBGA 3T3PF 1K85A 1QSEE 4I0KA 1A02N 3WFHA 1H6FA 5B8CB 2NY0D 2WTRA 4UCFA 4F91B 2OMNA 1T5WA 2WQWA 4WHYH 2CCWA 4KUCF 3TYFB 3L2MA 1YN7B 4UDTB 1BXXA 1VKXA 2GK0B 4NQVA 3FTXA 3MJGX 4ZOCA 3RWEA 3TXAA 1XSIA 2DDQL 4IMKC 1MCDA 2NY5C 2WTOA 1FL6A 4AK1A 5F9JA 3FO1B 2N3JA 2P8PA 4FQHA 3KPTA 1N6QL 1HWHB 3LS4L 4RDBA 5DZ9A 3G9VA 5EFIA 5LAXB 4QD2E 3FQRB 3GFUA 2IH3A 1NFDF 3SDYH 1GIGH 1ZKAA 3DX6B 3AACA 1RFDH 3II2A 4C56B 2X5PA 2YAMA 3LIZA 1A7NL 1L0QA 5HVGB 3PCYA 4NDMA 1RI8A 2O5ZH 4QO1B 4LPWA 2BMKA 5H2BB 1XAKA 2QV2A 3WIFA 3HVDA 2BNRA 3K71B 1X9QA 4TXVB 3HPLB 5IQ7L 1SLVA 4GRWH 1HWGB 5GGSA 1WRFA 1U21A 3FRUA 3NA9H 1NGYB 4DSYA 1B4LA 4ZX6A 1N8ZB 3MTRA 1IGJA 2FL5B 5CU9A 5D4QA 5LGKA 4NRYB 4FP8L 4Y1AD 4NM4L 3HZVB 3MV7E 3NFNA 3AXIA 3AB0B 4QHUB 1WTLA 2EDKA 1BBJB 2WZPA 1CO1A 4ETQA 2E8YA 4HHAA 1X7QA 4GP8B 4H2AA 4JDZA 3ARSA 4C59B 1KEMH 1KTLA 5AZ2L 1W6WA 4YHOL 5D96B 1IC0A 5A40E 3G04B 2GCYB 3BUQA 4PM1A 4Y1AE 5IHLB 1GZHA 4G6KH 1WHOA 2QVKA 5AW6B 5C6TH 2ETWA 3K4ZA 5L8LB 1D6EA 3B5HA 3WS6C 4BELD 3L3OA 3EGXB 4Y4KA 4W9EC 5CEYB 4JS7A 1ZS8A 1GGBL 2AS5M 1UKQA 3G08A 3ULVH 2I9TA 1UT2A 4JW3A 1ZXQA 5IZ7A 2Y36H 4MAZA 3HG1B 5TDPB 3GMRB 2X1XR 4NM4H 3EG9A 2E3VA 3RUGB 2A9NH 3MX0B 4NXKA 3DTXA 3WNMA 3MQIA 1QFWM 3FT0A 1JVKA 5DJYA 5FCSH 4DP4X 4KRPD 5EB9A 3RGVB 1KEML 1SOXA 3RZCA 5D7SL 3FCGA 4GQQA 3S8GB 2JQMA 1Z5YD 3B9AA 2W0FB 3KXFE 5C0CE 2CR3A 4HPOH 3V4PB 2IAMB 3IM1A 4XNXH 2VSDA 3RWDA 3DX7A 2D2CC 2YXWA 2WPGA 3G5XA 3FUFA 1EAPB 5JYLA 5ALCH 5CP7A 2EIEA 3WIHH 5L0QC 2UY7A 4WTZA 1E5UI 4R84A 4L3EE 5AAWC 4WW1B 1SJEB 2F6AA 1AQ8A 1QVOB 3L5IA 1U8NB 2CRYA 5DUPH 1JPEA 4FZ8H 3Q5TA 1UGKA 5GSRA 4F24A 4JRYE 2AEIT 2IGFL 2ENSA 4PWFA 3MRKA 3KLSA 3MV8B 5B1AB 3K6IA 5F89B 4IKJA 3VAEA 3EYSL 1BQUA 3FCTB 3TCTA 1EAJA 2W07B 3FZUC 1F3JA 1S5HB 2AV7A 3UGXA 3DJZA 2DQEH 5F3FA 4MLIA 4Y9BA 4IRJB 2K8MA 4OZFG 3SDAB 1RZFL 3AY4C 2BM3A 2IH8A 3TZVC 2O5XL 3ZHDA 4WIQA 5IM7B 4EEEA 1BVKB 3WIHL 4WO0A 2NSQA 3EHBD 1I1AB 2VL4A 2FYVA 3ME0A 3NZHH 2ENPA 5FYLL 1E9QB 3L4UA 4AMWA 3NCWA 5JLZB 5B1JC 2EDRA 2GHZA 4NO5A 4YL9A 1HE8A 1K4DB 4L3FA 1JL8A 1A9EB 4I88A 3CZUB 1RJYA 4P05A 5C0BE 5DZVA 3NIGF 5A7BA 3VXRD 3EDDA 4LKXA 3TTSA 1IGIH 1XSKA 3UBHA 3V5KB 1M3JA 4M9OA 1HFUA 3OGCA 3IJHB 5I75B 1T6BX 4G2AA 1VACB 2UZYA 4A7QA 5J9PB 3EXJA 2D7NA 2WB7A 5CZVL 5BO1H 1TZIA 2O5XH 4FQIH 1LJMA 1OF2B 2OI9B 1T22B 4F2MA 4XRCB 2BVOB 1ORQA 3BP7A 3BVXA 2XPGB 1PX8A 4E36A 4OVVA 2F61A 2IH1A 4YL4A 3MX0A 1UENA 1L7TL 4FADA 2YFNA 1KJVB 4MRCA 4RFNC 3W37A 3RGVA 3RZCB 3ESNA 3PHSA 2EO9A 2OCFD 2Y7SA 2ZSWA 3IN0A 3NJGA 4G9DB 1OP4A 3PRZA 5F2FA 5I1GL 3OX8A 4U31A 2GW5A 3PWVB 1PZSA 4JM0A 3QG7L 1YNKH 5CZRA 5C2BL 2FLMA 5I8KH 1NGWB 5F6HJ 4O2FA 1UCBL 4JAMA 1E9OB 2XVGA 3E8UL 3QIBC 1PKQE 2PKDA 3PHQB 4J3OG 4PSPA 4LPYA 5IVZB 1W6LA 2FQEA 3TM6A 3VVWA 4WUUA 3HE7C 4A7GA 4DVBA 3BCFA 3EH2A 1W9XA 4QXTA 3VRLF 1MCNA 1ZEAH 2VDKH 4KMLB 4YZWA 3CH8A 4YHZL 1TQWA 3VW3H 2NXYB 3GSNA 4JY5L 4LVHB 1U6AH 4LP8A 1IM9B 3FTVA 4BRVA 5I17B 1M7DB 1OSZB 2AJ3A 2XZCH 4NQCD 3DROA 3WKYA 3NK4A 1DEDA 4KJPD 2HVKA 1SMOA 2F5AH 3H7LA 4Z7WE 5DS8B 2KH2B 4FC3E 4DO6A 1F1DA 1NCDH 2P47B 1PEZA 5HHVL 5HGBB 1SXAA 3FJTA 2XV3A 3HHMA 4LLDB 4D94A 1L6XA 1FE8L 3F85A 4L2YA 5AYUH 1S7QB 4IYKA 2A4CA 4C4KT 1KN2H 3G6AB 1GY2A 3QUYD 3S3SA 2ATKB 4NO0D 3EJCA 4DGYH 5AUMA 5ITBL 3RX7A 1HK6A 1TG8A 1QA9A 3KJ4C 3B2VH 1L9MA 3UAEA 2OMWA 3QJRB 3DGDA 2FBOJ 4XXWC 5D6DA 4XOBA 1EJFA 2MNWA 1VB9A 3FO1A 4HMEA 4M5ZH 2NZIA 3IJSA 3KVDD 3QQ9C 4HP5A 5L6YH 2BLFA 4G7SB 1L0YA 4X6DE 1TNNA 4FABL 1U8HB 4Z7QF 3OXSB 4FXGC 3L9RB 4YDKL 4A6YA 4X7TB 3APFA 4NKOA 4LSVH 3VRJA 4KK5D 3CDZA 4PJ7A 5D9SB 5DC0A 3TBBA 1SY6L 5I8EA 1IIKA 4NI3A 1IBZA 5MERA 5D7LE 4TVPD 2FBJH 4YHIA 3VWJB 1A6TB 1NBYA 2CLVB 2IH9A 2RMNA 5DO8A 1P5VB 3QIWA 4I7ZC 4MD0A 5DUMH 3NIGB 3UDWA 1SLXA 4RFEA 2P5EE 5IF0A 5DUBB 1IEAA 1AQMA 5HPMB 4BZ2A 2UYLA 2TAAA 3B2VL 3Q2WA 4C83B 2G9HA 1X5JA 2R2EB 3KCWA 1NPJA 1AXTL 4NRYA 4QJ5B 3DECA 2GY5A 1KELH 2WXGA 3P9LA 4FQPA 1NM9A 4U6XB 1MIEL 2MTAA 2ZOUA 4J4PC 4OB5L 3C08H 4BK4A 4J27A 3O8XB 4JLRA 1K72A 4AY0A 4LGSB 3JWOH 3V5HA 4JO8A 1A1NB 2HUEA 3Q6GL 3OB0H 2EYTA 1OGTA 3MLSH 5IHZB 1JIBA 1TXKA 1QYGH 3QNXA 3MLWL 5D1QD 4R5VA 4DKEL 2HH0H 1FNHA 2OK0H 1FAKT 1I85A 1ZJAA 2CDFA 4U1HA 1RUML 5CJXA 1DCEA 2YUVA 1UD6A 4YDJB 1SDAB 4IBLT 4P2QB 4NZDA 2MKWA 4HJ0D 5IQ7H 3VSUA 4F7MB 1U3HC 2P8PB 3LPPA 4FQHB 4NZFA 3VU2A 4ZZFA 4PRIB 1MWAB 4P2CG 2WVTA 1GGIH 4C55A 1G1OA 2R39A 5GGTH 1A4KA 5LWYL 5DJ2A 4UMGA 3RPBA 2Y6SD 4MNQD 3HCVA 4DQOL 3QIBB 3CCHB 3ARGD 1U42A 4HJJH 3O6LH 4F3FA 2J5WA 1U8OB 1R5VA 3HFFA 1LP9E 2ICWB 3QQ4A 4KI5D 4LCUB 4R90H 1QR4A 2R4SH 1HKLL 3ETSA 4RDQF 4Y1AB 1A1NA 1JI1A 4NZJA 5IOKA 4XPHL 2NXYC 3WDIA 1EUTA 4OKVA 1JWUA 3MHZA 2AF2A 5I1CL 4QRTA 1Q94B 1V27A 4OV5B 3RY4A 2IWEA 1V8HA 4MXWL 3X13B 2QHLA 1H8OA 3KPSA 2VWEC 4GXVL 2H2SD 1HCFX 3AFLA 4KROC 1NGXA 2I9LB 4RCAA 4PJDB 3IT8D 4XP1L 3CUPB 4S10A 3SYOA 3B2DC 4TLTA 3RL2B 3PHOB 2XWJB 1RJZB 2RACA 3IGAA 1UQSB 5EU3A 1GGIL 1KIPB 2C7FA 5F72S 1KXTB 3RL1A 3VWKD 3KS0H 4LHUG 5D9SA 1MLBB 4GO9A 4DQOH 3G6DL 3QIBA 4B41A 3BSZA 3WLWD 1PG7W 2BNRD 1M71B 4R90L 3OQ3B 1XCXA 1TUPA 1HKLH 1KIQA 3PV7A 3NACL 5BV7B 1M7UA 4E9LA 5M95B 2B20A 3QRLA 1LEIA 1ZT7B 4XN9A 2C7UB 2WIIA 3MRDB 3OKLA 1HNGA 4AEHH 4MB3A 3PGFL 5L8KB 3SGEI 4G8GB 4R96B 2I7OA 3EOBA 4RGOH 1DSFL 4JDZB 4FXGB 5I1KH 4MD4A 3FFCA 4HW6A 2EC8A 1ZGLP 4MJ2A 4MQTB 2A2QT 3UZEC 5GZOD 3QNYB 4JZJC 2HRLA 5H37G 1MXDA 1PVHA 2EVJA 3ATEA 4ETYA 2ALWA 1S6NA 1RIUL 3RNQA 1S9XB 5G55A 1SXZA 1FO0A 4L1LA 3QFGA 4LVOB 3DPDA 4QWWC 1WP6A 2XXCB 5EZOL 2WLKA 1J05A 4U1IB 4GXUM 5LO7A 1N0LA 2WWOA 1M7IA 5EC1A 5F0PB 4E42A 4FHJA 4QT5A 1I8LC 2FVNA 3EKCA 2JJSA 5I2IB 1QHPA 2FCBA 5GZND 1DVUA 3HC4L 3ZZSA 1GGYA 3Q48A 2C3XA 3TIEA 4BZ1A 4RGNB 5IBLC 1U8KA 1AR1C 1UD3A 1EZSA 4CADA 4CW1A 2XPYA 3PPEA 1DSFH 4DO4A 2E9JA 5I1KL 1J86A 1BM3L 1EERB 2ITCA 1IQWL 3BVNB 4L3ED 4TRPL 4OF8A 3ZW3A 1DN0B 3M45A 4UT6A 4EZMA 3ULVE 4XODA 3SBRA 3GI9H 1HH6A 3NYKA 2WWKT 4B9JA 2Z8RA 1BBJA 3E6HA 1QLRB 4CVZB 2ATAA 3FU6A 3VJ6B 5FUOH 2NY6C 1C08B 4GS7C 1E2WA 1CLYH 1ZE3H 3NK3A 5KOMC 5F7UA 3T0EE 3EJRA 4NCDA 1P9MC 4FNPA 5D8JL 2ED8A 1OE1A 1N6VA 3MRPB 2VABB 4G8AC 1HE7A 2EVFA 2EYRB 3GSVA 2P42B 5AW8B 1N7ML 5HI5C 2XIDA 3LKRB 5FW8A 2N01B 4JQVC 2FYYB 4ZFFB 1ETA1 5J57B 1LDPL 1YMMA 5E1IA 2NY1D 4F15C 4TNWK 2XC8A 2ARJQ 1HQ4B 1LO4L 2VDPH 3WENA 5CEYA 1YLBB 2WBJC 5CD5D 2A9DA 4I89A 5DEFA 1A6AA 2BIHA 4HH9A 3N43F 4UOW1 1M7DA 5L2JB 3TPUB 2APSA 4PUBH 4P2RA 3N42B 4ERSH 2WBKA 5CN1A 3RJQB 3TBVB 2BXZA 3VD7A 1RULL 1JERA 4F33B 4F93B 3FO0H 5DZJA 3ET9F 4Y16C 3MNVB 5A2FA 3KM1A 2HG5A 1YEJL 4LP5A 2F15A 2QFPA 1EH9A 3TN0C 4JRXE 4HIHB 4JM2D 4WJKB 2NUPA 5LKNA 1EFXB 4X83A 5JW3H 3V0WH 1AIFA 1FGVH 1PQZA 1L9QA 5EF0A 4LSTH 2VSMB 3T0WA 3LZOA 3KE0A 1UJ3B 3CFJB 2GSGB 2QQKL 3GMQB 2O30A 5B7MA 1ZEAL 2VDKL 4WFGE 5T1MA 3S37H 5DMKA 3M1BA 1TFPA 2C3HA 2IMNA 3F83A 4LASL 5AWNL 3FK3A 4R4BA 3UAJA 1Q1JH 4UTBH 4DP1X 4ERSL 3IGLA 1CDHA 2W07A 1LHZA 5GSVB 3SDYL 5CF3A 3FQ4A 1QEWA 3QXAB 4Y4HB 2V5RA 2V2WA 3WEBA 3ZLQC 4S1DD 5GS1C 5HYSG 1TJHH 3OM3B 3GKWL 4WI3A 3ASOB 32C2A 1NMBL 3E2HC 5AAMA 2FZ3A 1A14H 1MEXH 3BPLC 4O5LL 3AJ7A 5FYLD 1QFWI 2X4NB 2CK2A 1G1KA 1AZBA 1CU4L 4H0HB 4R0LC 1QLRA 4W4OA 3LVTA 1JCKA 1PQZB 1PS3A 5E2WL 1RZKC 4BH7A 4DGYL 2P5ED 3GSNH 2YKLL 3CSBA 3M86A 4HLEA 5IUCA 5L7XL 3DJ9A 1SQMA 1BW8A 4JRXD 4FQLH 1N26A 1D7FA 4LAQL 3CG8A 2XETA 3ATFA 5L6YL 3MRQB 3V4PL 1A5FL 2V5MA 5I1AA 4DZBA 1DJSA 4GI8A 2OMYB 4HJ0C 2VLMD 4G8EB 3IRZA 1MQKL 1NUFA 3BVUA 1T7XA 4LBEB 5E2UL 3VCLB 4GRMA 4BWWA 4U6HA 1XR9B 3GNML 2CK0L 3F2LA 1RXLA 3BP4A 5CSZA 4H2CA 3NGBB 2EKSB 2R1XB 4DVRH 2JVUA 3IMSA 4G6FB 4IDJH 5SX5K 4D0DA 1CU4H 4KKLC 1JZ3A 2Q9OA 4HFUH 2G0KA 1YZZA 3C5ZB 2XYBA 1XEDA 4N8CL 1XF3B 3K2UH 4Z7OF 2ZWYA 4IMKA 1O6SB 3JTTA 4U1SB 5KSBA 2ZG3A 2CNYA 1MFBH 2I24N 4I48B 4L8SC 1K8DB 4QLWA 3NJHA 3EJPA 3QZWB 5D7IB 4H8PA 3MRQA 1G43A 4F2FA 1INEH 1ZHKB 1WGOA 5B38G 5CR8A 3FSZA 1NEZG 2WNGA 3Q6GH 2XWRA 3B7YA 3I6GB 1VFAA 2QQLH 3D2UD 2N0MA 1F5WA 5CJBA 4KNSA 4DKEH 2Y4SA 1LDSA 5D1XE 4TPRH 1A6UL 1JYXA 1YY8A 3IPBA 5AKSA 4L1BA 3H54A 3CUPA 4CRPA 2NX5B 2HB0A 1DFXA 2VJ0A 5F7HA 4WSKA 4FZ8L 4JNXA 3VXMD 2JELL 3QJHA 4DUWA 1ECZA 5JW4M 1ZANL 4HZLB 4YE4H 1CE1L 5E8PB 1VENA 2EIJB 1W15A 2DJSA 2VDRH 3CDGA 3CVCA 5LG6A 4U1MB 4OUUB 4OKDA 2EDJA 3PGCB 1KGUA 3BVDB 3MJ7B 4QRQA 4UT9H 5EBWA 1DFBL 5B1BB 4MMZB 2YPVA 3F64A 4WLCA 3A4AA 3M6DA 4WKZB 1ZT4B 2O6CA 3EH4B 2J73A 2JJTA 1NOFA 2OI9C 5H37A 3RAJL 4C56A 2BY3A 3V4VB 3QUYA 3VB8A 3RI5K 4QPEA 4PJDE 3UPRB 1XF2B 2VXVH 2BHZA 2EEAA 4YHYC 1TTUA 4KDWA 1BD2B 3L1OH 3L3DA 3MODL 4RFNB 3M17A 1OAYH 4ZO6A 2L7JA 3D07A 1D7CA 2XKSA 2OSXA 4HKZA 4F37F 2EYSA 3FUMA 2DRUA 1AZNA 4ZPVB 2H5UA 5KJRL 2ADFH 4HYTB 4PJ9A 1SHWA 3II3A 1PFOA 2YUWA 2YAQA 2Y2TA 1D5ZB 4K2UH 1WFOA 3NACH 3WNIA 4JGMA 4M4PA 1PL3A 1S46A 2LTQB 3WO4B 1UH3A 2D7OA 3Q6FA 3QIWD 1FLRL 1GAFL 4YC2C 2WTRB 3S88L 3FXIC 4YIQA 2ZWKA 3PHOA 3QUZB 3IGAB 3MLUH 2NCEA 4OD1L 3VFWA 4MA8H 1NWPA 2CR0A 1CVSC 1ZHBA 4PG2C 5F3HA 1UWYA 1U3NA 3HW7A 4ABVA 3Q9PA 2WANA 2MH4A 1DJGA 3HIZA 3QDHA 2MOVA 3RY6C 1YUKB 4HDIB 5HJGA 2YLKA 1FNEB 3W39B 3NN8A 2LLLA 4NZTL 2XV0A 5F9JB 5HVFB 3RX9A 3WTYA 1HJBC 4OJFL 3WN5C 4O9HH 3MCG1 2RCSL 2DI7A 3CMGA 3QEGL 1OB1B 1HOCA 1OKEA 1SYSB 3ZTDC 2KLSA 5C07B 3F7VB 3O3EA 3UJIH 4YX2H 1IUZA 1FLRH 1CMOA 1F02I 2HFGL 3ZQ9A 4BSWB 1WFNA 1AY1H 4GRLB 3SYQA 1KZQA 4WTQA 3P11L 4NENA 1DVFB 4FQJL 4AQAA 1BLIA 1MCRA 4XPGH 2ZP8A 1UWGL 3DO7A 5FECB 5T1KD 1YNLH 4E42B 2BOCB 2VLRE 3TN0D 4FYTA 1R46A 3QVAA 5FA3A 5FUOL 5D1QE 4D8PB 4PRPB 5DD3L 2VXSH 3D39B 1TZAA 4Z7UB 5KVDE 3H9YA 5D93B 4HV8A 1ACZA 4UILL 1JDAA 1TQBC 2HJLB 4XP6H 3V4VA 3VWJD 5K9QG 4PJEF 1TSRA 3DX9B 4KX9A 3QEGH 1RJLA 3S98A 5MENA 4U3SA 4D8OA 2IIJA 4PHXA 1E4KC 1HH6B 2XBZA 1P7QD 1PAZA 2GSMB 5B1KA 4MDIA 4HS6B 3DTXB 3A23A 5J1SC 4AIXA 1Y6MR 2H3XC 2TSAA 5DWUH 5F8RC 1LO4H 2VM3A 2BDNL 4KK9C 3JZ7A 1KFAL 4GAYB 3DJRA 1NDTA 4N2LA 3VFOA 4NKDA 5ESVB 3FU7A 5DD3H 3B5TA 3SKOB 1A4JB 4G7QB 4AIZB 4G9FB 5T5FL 2M2DA 3CZNA 3ILQC 2CAKA 4LLUA 4YDIL 1NIDA 4OM1L 4JM2A 3EIFA 1S7VB 3G04A 1SHXA 4PSRA 4P3CL 2APFA 3ZYIA 3UTQA 3R4DA 4PMFA 2HLFD 2GTQA 4YBQD 2ZP9A 4L9LA 2WOBA 5T5FA 1VCAA 4FL4C 1ZV9A 4N2AA 5KYWB 2FSEA 3CN4A 5E8OB 3T1FB 4L0YA 2FGWL 5IJDC 5JW3L 2DD8H 2F54A 1MVUB 3SDDB 3VXME 2YPVL 5E8NA 3IDNB 2VIRA 4WW2C 1N4XH 2XVLA 3S3PA 1HL5A 2QQKH 4OJYA 3D0AA 2XN9D 5J13B 2Q87A 4IJTA 2EXYD 1U3JA 1FO0B 5AWNH 4KJQC 2LV4A 4HV8B 4UTBL 5EOCL 5TE4L 3QYNA 3NSYA 1FA4A 3ZJAA 2YAHA 3QZLA 4R97B 1GS8A 2EE6A 1YA5A 2QKIB 3POHA 4XVUC 1RUMH 5EU3B 3S5LG 4EXKA 4I5BA 4PD4J 1XDTT 4A7VA 3NAAH 5LAPA 2E47A 2AERT 4HIQA 5L8JB 4YOKA 5DRXB 3EJYC 1JK8B 1CICA 2VR5A 4IK6A 4TVSa 2DD8L 1ZTMA 4AVHA 4WFEE 2EE2A 4LKCA 5DJZA 5I8CA 5FLUA 3VWKB 1QUPA 4IOFC 2W65B 5L7XH 4F5CE 1VDGA 3ZKMC 4U1JB 1N6QH 4WEUD 6TAAA 2B1AL 3QSKB 3D51A 3SKNA 4OFVA 2VMFA 2WK2A 3IDJB 1A3RH 5I1JL 1K4DA 1O5PA 1P69B 1SN0A 4XPHH 1GIGL 3NMEA 3GMQA 4BH8A 3IKKA 1UVQB 4GMTH 5FW6A 2YRPA 1OM9A 5DD0H 3AREA 5C0RL 1MCKA 4JDVB 1E4KA 1TVHB 3DTDA 2J1WA 3O2WL 4JY6B 1MCWW 4QHKJ 1E5CA 5PAZA 2V2TA 4TL5A 4F2EA 3DYPA 1NCWL 1OGAA 4KDTA 5AVWB 1MW0A 3U30B 3AWGA 4X5XB 1TZIB 1T2QL 1SHMA 5L2JA 2JJTC 2PW1B 4F2MB 5K69A 2WUBH 1VESA 3VRLE 1JZDC 3LD8B 3QP3A 2B4CH 3C2AH 1A22B 1JPGB 4O4YL 1F8TH 1LEGA 4PV8A 5EO9B 4DTGL 2UWEA 4NHCH 4NNYA 4TNVF 1DQIA 3M46A 3N1FC 4HKBA 4JJ5A 1A3RL 5ANMB 4AEHL 1Q0XH 4AQEB 3T2LA 3BGFB 5C0NC 2K3TA 4PPTA 4XCCL 1D5BB 2VLKD 5ACMA 5IVXE 3EJQA 5FS5A 3VXSA 5FEBA 3ZL4H 4Y5XB 3B5GA 4E9RA 4PJ6A 2KQMA 1OARH 4UIMA 2I26N 3VFGH 1I7UA 3CHXA 5EU7E 3ZK0A 5CEZH 1GGBH 3LN5B 4X6CF 4URKA 4MD0B 3ALWA 1HS6A 4JQIH 3VYNA 2N7BA 4L1DA 1BAFH 1U8CA 3UYRL 2WUBL 2OSLA 1EJOL 3APMA 5EZOH 3EDJA 4P2YA 5AB2A 3IVKA 1KBBA 3DIFB 3V0DA 1K5NA 1LMIA 4QTHB 1D5XB 3WTUA 1LK3L 2JXMA 4KY1L 5D1QC 4I0PA 1RUAH 3QDGB 1YJDC 2WYZA 1MFMA 3S9DB 5A2BA 1HXKA 2ESVA 4L9DA 3HC4H 4XMKH 1UYWH 3IE9A 3BAEH 3T4YA 1MSPA 1CJYA 3QW9A 2VAJA 4R7XA 4JHZA 3DX0A 4M7ZB 2HKHL 5GIRA 3L6FA 1VERA 4IEFB 5MI0B 4LLMA 3F6JA 4H8WL 3QI9C 1ZS8B 3Q3GB 3DO3A 5E2VL 5LCVL 4DUVA 4E0RB 4Z7OE 5BXFB 1AJ7L 2Y7QB 3SYAA 5CIPH 3EBHA 4N22A 4PJ5A 4POZD 4UDUB 4TNVK 3VXUA 1N0XH 1F18A 3BGMB 1MHHB 1DJHA 1Q72L 5F7DA 4N0UB 3IVKB 4UOJA 3FFDA 5E5MB 3UZVB 3B9KA 3WSQL 3L08A 3MFFA 4JCLA 1RUAL 2QLYA 5CCKH 1F4XL 5I75C 3FB5B 2PCXA 5JORA 3RKPA 4RWHA 4Y7OC 3SQOH 3U4AA 4OZHA 2KS0A 4YDLC 1WCBB 3LQAC 3GMMB 4XBEL 3DRTA 2HKHH 5B1CA 1AS6A 4XN2A 4FQQB 1DCLA 2IV8A 3LZLA 4HUUA 1OTTD 4L2LA 4N8PA 4IOSA 3BQUA 3DOIA 4F58L 3S88H 1A7BA 2X4PA 3W0WB 1X5MA 1U93B 2B3IA 4POUB 3V0FA 4YDMA 2Y06L 3VUAA 4J28A 4XO4A 5FPIA 5FDYA 5C3TA 3RKDD 4HKBB 4S0HA 3KPOA 2XWJA 5DFAA 3RWGB 2VDMB 1JNLL 1MCPL 1MQ8A 1X9UA 2X4NA 4AKPA 2XBTA 3D3VE 4UZSA 1HILA 5D7JB 5KYXA 4GFTB 4NJAL 3P77B 4BK5C 4KZEH 2GJ6B 2BZ7A 1S9VA 4TF4A 5CBEB 4PJ7E 3PWPB 3ZZQA 3Q2LA 3UC2A 2OX5B 2J6EA 3LSOA 5E0QA 5BOPA 3RHWF 4YX2L 4GKNA 1G9ML 2WP3O 2P5PA 5LVEA 4BSVA 4MBOA 1GYAA 2DF3A 2Q8AL 2OYMA 3P11H 5I0DA 4MA3B 3DX3A 3TN0A 5D1XB 2DQCL 3DGCR 3S37L 5HHMD 4PR5B 1LK2A 3GTTA 3Q2NA 3QORB 3ZN6A 4CKQA 3X1NA 1BJ1J 4MA1C 4M43H 4Z23A 1KZYA 5EUOE 5DRNB 1OAXH 4KFMA 1I1YB 2YBRA 1JNLH 3ZBMA 2OL3A 3FOMA 4JKLA 3QEUB 4ANXA 2VAAB 3GKWH 1ACCA 3RX5A 1OGSA 1RUKL 3SE4A 4BSWA 2NW3A 1MEXL 3FT2A 2FQGA 1OHZA 1S3KL 1U58A 3AS2A 4LPCA 1UZ8B 2GABA 3I6KB 3I9IA 1BAGA 4CC1A 1IC7L 3CLWA 3VACA 3MN8A 4DFIA 4JFPA 2OS7A 5HGHA 4D0CA 5JDSB 1DO6A 3RWEB 1NCAH 2VN4A 1GOFA 4ORZC 1QFWL 2FJFA 5EEYA 2HRPL 4HCFA 1FP5A 1W2KT 1BEYH 2C3VB 4XWOC 3GEWB 4Y88A 5EN3A 4C4KO 3GZPA 3EGDB 4OU3A 2W0KA 3EJUA 4Q2ZB 2E7LA 1MQKH 2OL3B 3FOMB 3H9ZA 1HINL 5GS0C 4MHHG 1PW3A 5EOTA 3JWDC 3PU7A 4JQIA 4U7MA 1J7VR 5CS7A 2C1PA 3NTCL 1DE4B 4FG6D 4HWBA 4OQTA 5KYUB 4MJIB 4M8UA 3TIDB 5EBLB 1EMTH 4I77H 1TYRA 3JWNC 1FE8H 1KCRH 3C5JA 3QJVB 4WI8A 4M7LL 3CPUA 2UX7A 3QH3B 1LD9A 4UTAH 4OJDH 2EXYC 5E1QA 3QULB 4E68A 1T3FB 1GA2A 2VCOA 3IFPB 1G7QB 1YECL 1JGVH 1NC4B 2OSYA 3H0TA 4AC2A 3C75A 3QZPA 3ZT6A 2YPVH 3QS3A 4G9FA 1H19A 4GQPH 1F00I 3O0LA 3D39D 1VGKA 4YXHH 5D70H 5IMLA 1ADWA 2CXGA 3HS9A 3BAYA 2X6BA 1TMCB 1WBZA 4ODWA 4XGZA 5I1IH 1A6WH 2YMTA 4Y2OB 2PLTA 3DOHA 3FTYA 3A4EA 3N41B 4E9QA 1S5IH 4UM9D 3PGDA 1UH2A 2OJEA 3QJQB 3QWQB 2OQJA 3HS0B 3MRFA 4A6YH 1E9PA 3TGXA 1J1XL 4G5ZL 2DPKA 2FDBP 2K70A 1YVLA 3U0TA 4M48H 2PXYA 3LXUX 3UPCA 1WDAA 4RAVB 1KXQE 3ULVD 5FO9A 3WFBH 5F7KC 5I6PA 35C8L 3WI9A 2I85A 1ZANH 1XFPA 4GY4A 4GAAA 3T2NH 1FCCA 4OF6A 2X87A 4K94H 4W6XB 3IDYB 5CSBA 4PB9L 1CVRA 3MV8E 2B0SH 1QD0A 3DO4A 1RLWA 2VMJA 2VE6B 5GRVK 4M56A 4L4VD 2C3WA 2LTQC 3U7YL 4AE1A 3MLSL 3NH7H 3IDIA 4K5PA 3C9NA 3MLWH 5ID0B 4MA1B 2X3AA 3QUML 4J6RL 3V4LA 1N8ZA 3BO8A 3B37A 2ZT9C 4GKSB 4ZYKA 2XZZA 3K72B 3BUPA 1QACA 4PTTA 4RETB 3L3KA 3QNYA 5TDOA 2CA4A 5FGCE 5KUKA 3US0A 1RZIB 3SBWC 3CK0L 3QR0A 5LG1A 4U1NB 4NQDB 1PGRB 1N9PA 3MRJA 3H85A 4KO7A 4BINA 4L8CB 4OFIA 4NKQB 2HKAA 3MR9A 1NTDA 1OB0A 1T2QH 3IU3A 3WKMH 3TNNA 3BCDA 4OGAD 3ZE2B 3KBFA 1JGEB 2ZKHL 3T8XB 1F8TL 4LCCC 2N1KA 5ACLA 4NKIL 4XNAA 1NCGA 2Z7ZA 4Z7IA 1EZLA 4P9HH 3OKOA 4P5SA 3JYBA 3U7YH 1FN4A 1EGJA 3EYUH 3ZHFA 2EUWA 2OMXA 3VDCA 2UUDH 1LEKB 3LNDA 3CVHB 1JD9A 1KCVL 3QUMH 2BS71 4GRLC 4N2KA 4M5YL 4PJXE 1CC3A 5FGBC 3FQTB 3D48R 2QVFB 3NCYS 1N59A 2FUQA 2OKMA 2X4SB 1E65A 1ZIBA 2YPLB 4D8PA 4EI6B 3TZVD 4QOKB 3C60A 3NRQA 5EWIH 2BNRE 4HIHA 3CZEA 1V55B 2DLHA 3PAUA 4A2FA 1FVEB 3BE1H 2GBUA 1MCCA 2QSTA 4OZIA 1JN6B 1OT1A 1NDGA 4YLCA 1AGBB 3AQDA 1AHKA 1NMAL 1RZ7L 2GIMA 3D05A 1XZ0B 4OJFH 5FM5O 1TZOA 1LNUB 5AW0B 4RMQA 3FN3A 3K2IA 3BWUC 4CNIA 4LL9A 3VG9B 1BMZA 3IYLW 3M1CA 2XKUA 1IGYA 3Q43A 4TMPA 1C7SA 5IGXH 1EZVX 3HNSL 4LDLB 5HDLA 3MRBB 1WAAA 2N4IA 3KL3A 3ULSB 3TO2B 2GITB 1Y7VA 3I6LE 5IUSA 1AQDA 1KYOJ 2Y07H 4M02A 3WTXA 1OWWA 3MR9B 3DBXA 4FLQA 4BSJA 3D2UB 4OLUH 3HMXH 4ANUA 3O11B 5TH2B 3OB0K 5CILL 4PRIE 4ZFZA 3VXSD 3AG1B 5JNYB 1AO7E 2ZOLB 2EECA 4GG6A 5JHBA 3OZKA 4UILH 4D7PA 2PMZA 1A3ZA 1F4XH 3TH4T 1BQLL 4XZ4A 5CZXD 2GJZA 3KYAA 3LKOA 2NQDA 1OSPH 3ZTEA 1QSFE 4ODTH 3NCEB 4J8RB 3TFKD 3NCCB 3QEQA 2Y7NA 4KXBA 1WH0A 4Z3HA 1W16A 3KWTA 3H8NA 4G6FD 4NQDA 4PLOB 1P7KA 1NLBH 1ZT1A 4Y19E 5IB4A 3FPYA 5LNDA 5HPMA 4QXTB 3MGAA 3ARDD 3KLAB 3EYQD 3S3BB 2QEJA 2XN9E 5E9NA 5G2NA 5F9OL 5I0XA 4MA7L 3NIFF 1FZKB 4RSVA 1OD9A 5H94A 5JORB 4LCYA 5CILH 5B8CC 3DPBA 4TULH 3VE0A 5IB1B 5T8IA 1AH1A 1XGUB 3BVWA 5E8EB 3PWVA 3S4SG 3W0WE 2N7AA 1DQMH 3BPOB 2CGYA 4HETA 4LVEA 1JF6A 1KB5H 4WHCA 1SBBA 1XGYH 2Y7MA 1W8NA 1KIUA 4PJ8D 1JZ6A 5ANME 3L48A 2NYYC 5CSZB 1WT5C 1FPTH 4QRSA 5JXEC 1U3HB 4WEBL 3GB7B 2CPCA 4S1DC 1Q0EA 3MREA 4LCIL 3S8WA 5HYJB 1N5YH 3WD5H 2R56H 4M8QB 4G42B 3X3FH 1TQCC 3DXAE 4MA7H 1FRGL 3KWVA 1LP9B 4QYOA 1DJWA 3EF7A 3L81A 3MCLH 5DK0A 5IY5B 5KSVB 3AQZA 2ITDB 1U91A 2V8MA 5I1AB 3HHRB 1P6WA 3OGCB 4JFTA 1E30A 5FWQA 3RGHA 3WIAA 4JO1L 2FEDC 3B9KC 4NX0A 1TQTA 2C4FU 1NGWA 4JN1L 1DQML 1JMZA 2EDLA 3CHSA 2QADC 4G8FA 4LLMB 4MJIA 1NGZA 2IPKA 2I07B 3ARFA 5T3ZE 5DVLA 5JW5A 1AAJA 1NEZB 1S8DA 2E9IA 4XMVA 2ZNXA 2FJHA 2YD3A 4WEBH 3G6JA 4WI9A 1WA1X 3D2UA 3I85A 3LOWA 1T3FA 3N1GC 1PEWA 2NY3C 1PDKB 4AUYA 5CLXA 3WS3A 4W9IC 4Y9GA 1NC4A 2VT0A 1HHGA 4UT7H 2A6JB 5JOFA 2GB2A 2R9HC 3MCLL 3D0VA 2DQDH 3FB8B 4N5EC 5DWPA 2PYED 3KPMA 4ZW6A 1YDPB 2EP6A 4I0PC 4N0UA 1R47A 1BQ5A 1INQB 3IXAA 4YHLH 3FN0H 2GTWB 3KW7A 3R19A 3SBPA 3CTTA 3OAUL 5FA3B 3TBYA 2GJ6D 4IRSA 5T1KB 5HY9B 5ECJE 1D5RA 2R4RH 1NMBH 4P5RA 4CU7A 3CFTA 4Q74A 4R96A 5A3IC 4PP1C 1I3UA 1EFXA 4KVNL 3WFHB 4TSBH 1AZZC 3N50A 1TQVA 4P2QA 2VN6A 1OT2A 4LLYB 4AGQA 5DDHB 4UTAL 1L3WA 1B0GB 1CTOA 2MFNA 4KY2A 4MCNA 4P9HC 3GSNL 5TD4A 2B4CL 2IFGA 3ALPA 5F6HI 2DQTL 3GLZA 3EYOA 3NCJL 3R0MA 3WHXA 4ELDA 2DLGA 2Z0BA 4U33A 4CSSA 2X4TB 1M05A 3MRLB 2O72A 1Q0XL 2Y2YA 3TF7C 1SM3H 1XT5A 3VXQA 5MEQB 3MYJA 4L1SA 4FKKA 4LKCB 4WU7A 5I1IL 3BFQG 2CK0H 1S7UB 4X6CA 4FG2A 4WKZA 5IR1B 5FKAA 1OALA 3GIZH 2ARJA 1WWAX 5E2TL 1AKJB 1IAOB 2ZJSL 4MS6A 1AYOA 3QXWA 5HHOE 1MFNA 4H5SA 1HCVA 1KJ2A 1S7XB 2OTWA 1YAZA 4IDJL 4LOVA 3GSOA 3GTVA 4MA3A 3D4GA 4HFUL 2B14A 1CTNA 3SE9H 3EUDA 3N44B 4NYLA 2VDKB 1IZJA 2P8LB 3L54A 1DZ0A 4GSUA 1MZZA 1YYLH 4BUQA 2VQ1A 1B0WA 1SUHA 2UZXB 4HWEL 3P1VA 2W38A 4UNUA 4XN7A 1CFSA 3QZBA 4QRFA 2CKNA 2V2XB 3BZFB 5CFHA 4N87A 1J87A 2OXGB 2EC9T 3KPQA 4ELMF 3QCTL 4X5XA 3O8XC 2EIZB 4M8RA 3KJ6H 2ZG2A 4HEME 1XTLA 5EN2A 5CN2A 2Q3AA 1NBZA 1FUNA 3LN4A 5DI8B 1I53A 1I1AC 5E2TH 1AZCA 3G9AB 4NT6A 3ZE0B 4MZIA 5T3XH 3BDYH 2FWOB 1SJEA 3O6KH 3RWGA 5AZEH 3RUGE 4FA6A 4Q56A 5HHOA 4KGJA 3RX8A 1U8QB 5JDJA 2QR0B 3V6ZB 4J2XA 2IAND 5IROC 1SQ2N 3TT3H 3FRUB 5I1LA 3O3BB 3V9EA 3EO0B 1FZOB 3QDJE 4I8DA 4Z7VB 5EOQL 3HAEG 1BP3B 2D7QA 2YR3A 3CMOH 2OA9A 3EAKA 4BQCA 1DLHB 4G5AA 3PFUA 4N1EA 2NY3B 4XBEH 4UT9L 1WZLA 4Y16D 4X98A 1QSVA 3ZDXF 2HX9A 4OLWL 4KTYA 4LBEA 3BP5A 2XQBL 1JZEA 2P24B 1H8SA 1FNGB 4PI2A 4P2OC 4N2CA 2V7NA 2VDOH 3MRJB 2V5SA 3QCVL 5MEND 1ZHLA 3FUEA 3X1GA 3NCXA 4Y4HD 1P7QA 1WCQA 2YQ3A 2WVVB 3AMLA 5DD1L 5BUAA 2WVUA 4G3YL 4CAGA 1S7WB 2A83B 3E6HB 5FYJL 1RUQH 3LEYH 3DDFA 4HULB 3H3PH 1HI6B 3OLIA 1GCYA 1CGSH 2KLTA 4ANKA 3VXSE 5BXFA 5FCUL 1NCCL 4S1QL 5DS1A 4NJAH 1ZA3A 5FYJE 5A2CA 3NIFE 5ICXB 5HI5D 4GSDL 4HKJB 2LU5A 4C56E 3BRGC 2DKMA 3VO0A 1I82A 4NT6B 3GQFA 4E9VA 1OVZA 4AQEA 3STBA 1P2CA 1IAMA 5D5MA 5IGXL 3OHXA 5CZKA 3UTQB 3G5YA 5ELIA 5MP6L 2R51A 4XCNA 5IBUB 4OD1H 3GGWB 3LMJL 2TRHA 3LNEA 4G72B 1FBIH 1AHWB 1MJ7H 3DUUA 2OL3L 3U0TB 1CFSB 2XQYA 4Y5VA 4J4PD 4XCFL 3W57A 4AWJC 3DX2A 4IBWA 1CFNA 5HHPB 4NKDB 1MFUA 1CGSL 3I75A 1I3RA 2WXQA 2YSTA 4W81A 1FL3A 2QSCL 4HXAH 5AAPA 1O0VA 4PJGA 4OFYA 5IJBC 3HBGA 4X4ZA 4P2OD 4NO5B 5BRZD 2F8VA 4FLOA 4MDRA 4H26A 1LE9B 1JUFA 3LIUA 3BP6B 4UV7L 4TNGA 2OMBA 3EYVA 2LFEA 1IGML 3I84A 3TU6A 1EAQA 4MX7B 5SWQB 2FIRT 3CFNA 3RWIA 1CT8A 1IM3B 3VGDA 4NNYB 4MJ4A 1GZHC 3KDMB 3VX0A 4G6ML 4CN1A 3SDAA 5DFTA 4O02A 2YWZA 5INDA 1J0JA 2X53A 1F58L 1JZJA 4LLQA 4P46B 4UQ2B 1Z9LA 3RB7A 5I30L 1A1OB 1MKFA 3X3GH 2XOTA 2BVTA 2EE9A 1E2ZA 1G6RB 3ZDYF 3FQWB 5I0WA 3MLPA 2X6MA 5DEJA 3D25B 1BIHA 5JQHC 2VXSL 4DZ8B 5T33L 3IU3B 4TULL 5BRZB 4OGYH 1RIVH 1QFOA 2IWKA 3GDBA 4HKJA 1BEXA 1DLFL 3F6LA 4QYAA 4O02H 1EMTL 5E9DD 1L4IA 3BPCA 5F0MB 1DDTA 2D7MA 1IAKA 4HK3N 5I5RA 3D69B 3HI6L 4M6NH 4Z7NB 5DJXB 2AVGA 1USQA 1AXSB 4BWTA 3GLEA 5L88H 3OL2A 1QSED 5C08E 1C08A 2PWEA 4NPYB 5TJWK 3QJFA 4V1DA 2DQIH 5FKPB 1RURL 1SJVA 2FEJA 2Y7OA 3BOVA 3R7RA 2DJMA 2R56L 4XI5D 1KLFA 2W9EL 3ZE2E 3TS8A 3T6QC 2A6JA 1MUJB 5JOFB 2EDNA 5SWZA 3EOAA 2BHFA 3LZNA 3W0WD 4JGJA 2VR9A 1WBXB 5FO2A 4PBDA 1FNAA 5ICZB 4X8CA 3KPOB 3T0EA 4YDIH 3TJPA 1HL9A 4JN1H 3G5WA 5F7WC 4AXWA 3HLAA 4KZDL 2ZX9A 5EF1A 3JV4B 1OD7A 1KJMA 2B59B 1KGWA 3FFDB 4IBYA 5E5MA 3MBEC 3VWKC 4N5ED 1MRCH 3UXFA 2UVFA 4M6OL 5DLLA 2XVBA 2DLIA 2L7QA 1OQXA 3F12B 4GO6B 2GT9B 3MUY1 4LLDA 4XZUB 5JHDE 3U1SH 3LB6D 4QXGL 1T7ZA 1O7VA 4J3SA 1EDQA 5DZNA 2Z35B 1P5VA 4BZ1H 3O4OC 3P02A 4NM8H 2VO8A 1EXHA 4JE0A 2J1ZA 1A6PA 4XN1A 5IF0B 1JNNL 3S36L 2WZ5A 2R23A 2DQDL 5GGTA 3B6SB 3WOVA 4J3TA 4FJYA 4OCMC 5EOCH 5TE4H 1AP2B 2BP0A 1TETL 1JF5A 3NH7L 5GS1A 3H0TB 3FN0L 2DYPA 5CO1A 4NQXB 2AGJL 2J6EL 4KROB 3K1DA 3DX4A 5K9OA 1D7DA 3Q1EA 3U30C 4ZMZA 3QUZC 3T77A 5FHAL 4NBXB 4CC4C 3A22A 3K1KC 3OJDB 4WFHE 4GUQA 5E6IA 5C0EA 1UEYA 3CBKB 4WY7H 4G80B 1K8IA 2RALA 3G6AA 3VE0B 3ZMRA 2X70B 1E9PB 5BV7C 5L2KB 5HGDA 3QO1B 5C86A 2Y72A 3B1TA 1IC5L 2B5IB 3TWCH 3WBDA 3QWRD 4WWID 3PL6C 3KLAA 1PY4A 2EH8L 1KENH 3ATBA 1JTOA 1ODAA 4QJ3B 1MIML 1O6TA 1AE6H 4GAGL 5FYLE 5HDWA 5IFAH 3TF4A 1A3LL 1M2VA 1KLUA 1SYVA 1TETH 3EYUL 3K74B 3WTTA 5IROD 4KO9A 5ISZD 1D5IL 5BS0A 6CGTA 5EBMA 2ADIB 1UZGA 2R69H 4MNGA 5LXGH 4UQAA 4FTVE 1EHAA 2DJUA 1KB9K 5EC2B 3OG6B 2XWXA 3QJFB 1MLCB 1R5VB 5FKPA 2CO3A 2ZYHA 1EK3A 3TFKC 2CD0A 4HS3A 5EU7C 1DVFA 4V2CB 3KYKL 4LGRB 5KAQF 3O8XD 3HFMH 3U0PB 4U1LB 3SE9L 2DEXX 1HZHL 1I7RA 4MCZA 1JPSH 1RZ7H 2IPUK 2DY2A 2Z31C 3C2AL 3WE6A 1FO0L 1DBBH 3A6BH 4YHMH 4GP5B 3RPIB 2PCYA 4IOFD 4YO0B 4WU5B 3EUUA 5ACZA 1GHFH 2OR9H 4JRLA 2CLRB 4BH8B 3ARBC 1E9QA 3QCTH 2F8IA 4PS3A 3CIAA 3RDTD 2DI8A 4W9FC 5IJKC 2W81C 3N0AA 5LNGA 1TZHA 4W4OC 2VUOA 1OGAB 2A77L 2P8LA 4LFHG 2XLLA 2NY6B 5B4MC 3VFMB 2G5RA 4N1HB 5I28A 5AZEL 3UOAB 4OLUL 3HFML 2QQNL 2HPTA 1SF3A 4AYSA 3HEIB 4XNZB 1HSAB 4AVKA 1AKJA 1IAOA 3VSTA 4LCWE 4ILDA 1MW1A 4BCYA 1EWHA 4HCRA 5EULV 4ZMXA 1OF2A 4LLVA 3OD3A 4JG9A 5EDXA 5EOQH 1X7SA 2QPUA 2VLJD 2WSDA 5D1XD 2X4OB 1CPUA 4TUOA 1NAMB 1PYWA 3OPZL 3U6RB 4PJIF 3SCMB 1J5OL 4FNTA 2F53D 1P0SE 3X1BA 1MAKA 1JZIA 3BUBA 3EGSA 2G60H 1CD8A 2XN9B 1BSIA 3QDGE 3B43A 4WO4C 2AKRA 3GSRA 3QG6B 3QGVA 1P1ZB 2WYHA 5E2VH 5E51A 1X9LA 3CSGA 3KVPA 1AJ7H 1JVOA 1Y0LA 4F7CB 4YFLF 1Z3RA 4G7RB 4NRZA 7FABH 1L9RA 4O51B 5BPPA 1R0AH 1TVDA 4Y5VB 2OV0A 4FKHA 1BVOA 5FYJH 1WAPA 4U2ZA 5DRNA 3R4RA 1FJ1A 4LCWA 2V8LA 4GRLD 5DZLA 5I74B 5FCUH 4NGHH 2XBDA 4KOCA 4Q9QL 3CQQA 1JHTA 1QFPA 2PPFA 4YFDB 3KLHD 1LE9A 4ABWA 2EXWD 2B5IC 4GG8B 4POYA 3Q3GA 2B16A 4XO9A 4ZUWA 1BM7A 3CVHL 2MRYA 3NZ8B 2WVVA 5L9DL 1NCNA 3H2WA 1ZVSA 3U0PA 1IBGH 2VABA 3PJLA 3MLRH 3PUCA 3DRQA 4NBYB 2W9DH 4LU5L 3UEQA 2PP7A 2ZD0A 3ZMNA 1K4CB 1OL0A 2FR4A 5DQDH 1E3FA 1MHEB 4NHUB 4LCVA 3IFPA 3TBVA 1CBJA 4GSXA 4GT7A 4JDTL 3D0LB 3MRNA 4I2XA 3U9UA 3RIFK 4HHAB 4BDVB 2VDMH 1MCPH 3TEZA 4KDVA 4XR8C 2CMRH 2HJLA 4OJEH 4G83A 1HCZA 2WY3B 5D55A 3ARZA 4ZXBB 5LBGA 1RV6X 1QQDA 1IEBB 1ML0A 4R2GB 2X7LA 5D1ZI 2YHGA 5FUZH 5F97E 1MCWM 5FXCH 2IQ9H 4K73A 4LIQE 1G9MH 3VXPB 5ICXA 2WLZA 3ZE0E 3ZKND 4EIGB 3MPCA 1UURA 4UU9A 4NO2A 4LPXA 1QLEH 2P48B 4S1SH 2QHRL 3WAJA 3RA7H 4DT2A 1ZT7A 1CXFA 1UATA 2CKBA 4LEBA 1LILA 2BSTA 4PP2B 5JW4Q 4B96A 4UDUA 4AL8H 2FB4H 3QAZC 2R0LH 3X1FA 2P80D 1ZPUA 4JREC 2HAZA 4UNTA 4ZOEA 1OCRB 5CJ8A 3ZTJG 4UYQA 1HOCB 2BNQE 3OAUH 2J6WA 3FKUS 1SEQL 1TSHA 1TVBB 3L4ZA 3PXLA 3IU4H 1RUKH 4OIAA 4QHNB 5KAQG 1B6UA 4MBRA 5B38B 2FHFA 4I13B 3BSHA 4UTCA 3VMNA 1CFBA 1IC7H 1UWXH 4JL2A 5GSVA 1LE5A 2XX1A 3DRQB 2BERA 4B6ZA 3CFBA 3D3VD 1R3KA 4P5TA 3RB5A 1H8NA 3L16A 5GISL 4H8QA 4R7LA 3V5DA 1EDYA 2DQTH 1S3RA 3E9UA 4NWUL 1IX2A 3NCJH 4ZMPA 1UD4A 2JKWA 4PYGA 1S9YB 4FXKB 2VLME 3HTLX 1K5NB 1SHSA 1I31A 1T1YA 2APWA 3L1GA 3HG2A 2Z65C 3GJFH 2FT8A 1RH8A 3B7RL 3M8OH 4TLUA 4R4BB 3I6KA 3ULUC 1UOLA 4B60A 4QNPE 4AW4A 1H3XA 1R24B 2YAFA 4D0BB 3QDMA 2FTAA 2BS8A 2ED6A 1NUNB 1GS7A 2GUOA 4FCAA 1IGTA 4D9LH 1NJ9B 1YUHA 4PVBA 3MRBA 1Z9NA 5F7BA 4X42A 4RFOL 3L4VA 4MAYA 1LEGB 5EO9A 4AT6A 4BZ1L 4PJ5E 1BVNT 1JN6A 2NDFA 3HKFA 2OTUA 1YEHH 4OZIE 1A6WL 2YD8A 4F7PA 5J7CC 3ZDZF 2NY4D 1BQHA 4WJG3 2JK5B 2XN0A 3QDJD 3ZTNL 3AT8A 1OAKH 2AAVA 2FECI 3QISA 1HXYA 4N8VA 4EMZA 1E5ZA 1E3XA 1VADB 4PJEE 5DHVB 4AYID 1B4JH 3FQTA 3EBAA 2EO1A 4K3JL 5IM7A 4O02B 3VXQB 5MEQA 1QMUA 5CJXC 1PU0A 5AW3B 4OD3H 2VWEE 3QRGH 4BZ2H 2XZAL 1FG9C 5DVNA 3WO3B 1CT8B 1ZLUK 4WY7L 4FFYH 4FXKA 3SKNB 4Y9CA 4XBMA 1TVBA 1I9JL 4QRQB 1UXSA 4APQB 5DJ2B 5DEGB 4YO0A 3IJSB 1YEHL 1V7ML 4TUJB 5I6NA 1YC7A 3QIUD 2X3BA 1E6JL 2VN7A 3QJHB 1JK8A 2JCCB 3TNMB 2Y0SA 2YGPA 4AJ0A 3EJYD 5IBUG 3WAKA 1TO5A 3EDFA 1MFCH 2R29A 3B6SA 4AGPA 3FYIB 2DH3A 4PJHA 4GKOA 4MWFA 5GS3A 1UA6H 5I0VA 1CGYA 1NLDL 4G3YH 3QUKA 1C12A 3GBDA 2OSLB 3LEYL 2R29L 4NO3A 4EDXA 3KYKH 5KTEL 4X6DB 1Z0NA 3T08A 3U9PL 5LNEA 5EHFA 3LKPA 1J0YA 1BFVH 1MCQA 4S2SB 1JFHA 2BY2A 1R3IH 4ZFQA 1ORSB 1PMYA 3IB4A 4H1LH 4NKIH 1NCIA 4Z5RA 3DVGA 2ZNWA 3ZHNA 1ASOA 2G3XA 5KYNA 4LAJH 4OD2B 3C60C 3WV0A 5L2KA 2HLAB 3MROA 3MV9B 3CDGB 4M7KL 4Y2OA 1WITA 2H0PA 4XXDB 1QBML 5F93C 4F8PA 2MTPA 2O61A 3RWJA 1FBIL 5IB4B 2WLLB 4HJEA 2DQ6A 4TTDD 1EDHA 5DJ6A 5KSAA 2AJZB 3BKJL 4IKNA 1IGCH 4AMKL 1D5XA 1FFRA 3MV7A 3O4LB 4OLEA 4PLNC 2VDLB 2E9BA 2QQNH 2D7TH 2MPAL 4ZAKC 5IHWA 4DN4H 1JPFA 4M1DH 4WFED 3ZDZB 2A6IA 3AABA 2NY0B 2AEQL 5D1QB 5DJCA 2AMUA 2RIKA 1G7LB 1OANA 2PYEE 4JZNB 3SBWA 2BY0A 4B7LA 3L9EA 1F90H 4XAWL 4YNYB 1UM4L 2JCCA 3TNMA 2JJVA 1RZJH 5FYJD 2VRKA 2VITB 3D4CA 3P3YA 5MHSE 2FWLB 3V7AG 4NQEE 4H88L 1L7IL 4LDEB 3VTTA 1UUNA 3WJJA 5I26A 2Z31A 4W9HC 1X5KA 3KMDA 1YHPA 2C1OA 2H8PB 2VMCA 4XHQA 4ODVH 1OE3A 4FG0A 3M07A 5AVXB 4UB0H 4L1TA 3N0PB 4NJ9L 3ESMA 1DVFC 1SYSA 3X3GL 4J3OC 1OAQH 2E7CA 3BSZH 5EPMB 5FO8B 4PJDA 5C0BD 4NIYE 1BZEA 4TUKH 4FFTA 3Q8AA 1OOWA 1KXVA 2EJ1A 3H9SB 4JVWA 4X2UA 3TBWA 2XY1A 3AXHA 1QLFA 4CU8A 2KUTA 2IG2L 1T21A 1ZLVK 5DRWA 3WUWB 4GQ9L 5ISZE 1L6ZA 3S34H 2LVEA 2VRAA 2DM3A 2YQGA 3OWEA 4EN3C 4RRPA 2E4FA 4OH2A 2R0ZH 1P5UA 1ZK9A 2P5WD 3VXMA 1VKXB 5EU6A 1I4FB 3TO4B 4R4FH 3KPRD 5JDSA 3K91A 5DFVD 1PJWA 3AUWB 2JCCF 4K5OA 4UB0L 1JNJA 2EDEA 3O4OB 4NJ9H 2Q8BL 1FGNH 3KZ8A 4Y2DB 1OK8A 1U95B 2E27H 3FTUA 3P9MB 2QADB 4BQ6A 1BECA 4EBQH 3TESA 1DANU 2BIPA 4B5EA 1KPUB 3AU1A 1IBHA 1MRFH 2EYTB 4A2DA 4RWYL 3WE6B 2NSMA 1MWOA 2OX5A 3LSOB 3MJ9H 1A1OA 3H42H 1E90A 4ZPTB 5D71H 2ZF8A 3EFDL 1OPGL 2KMWA 3CDFA 4HXBH 3ML9A 4DAGL 2G2RA 5FGCB 3VWJC 1WA2X 1BA9A 3V0IA 1A4JA 2XPZA 1OP5K 3TN0B 4ZXBD 4ZPVA 3VMPA 3ILDA 3MV7B 4MASA 2XDHA 4LXFA 3WIHA 2VXUL 1AZRA 2ZYRA 3AS3A 4TN9A 4LRNL 2Q8BH 4L8CA 4NM8L 2XA8L 3DIVA 1ND0B 3IMBA 5FFGA 4EO5A 1KC5L 5K39B 5C71A 2E8ZA 5TTRA 2F74B 5AVTB 4JZNA 1UZ6F 4AL8L 1S7SB 1Q0YL 4I1NB 1GVIA 2NTFA 1NCUA 2CRZA 4OUUA 2AGJH 2IC2A 1W8OA 3QAQA 5BVPL 1GTNA 5CUSH 2XZQL 2EIBA 3EO1A 4GKZB 5ESQB 3RIFF 3IU4L 3NCYP 4YLBA 4IU3B 4MMZA 3LH2L 2H3NB 1OGAE 2R0KL 3D3VA 2ZTBA 1OAJA 3IFOA 3G3LA 3HR5A 4Y4KB 5GRUL 2CJSA 3PE9A 4ZFGL 2SODB 3ZE1F 7CGTA 3BLBA 4AYGA 5F0JB 3CN0A 3UBXA 4YSSA 5T5NG 1KB9J 3NZUA 1LQBC 5FYKU 1FG2A 3GZKA 1MIMH 1JFQL 3BKCL 3ESOA 4I18B 4CL7A 3BZEA 3U4KA 3UTTA 4A55A 2ZXCA 1C5BL 3PP4L 1ZLSL 5BZWA 3GJEB 2OQJB 4D9QD 3DARA 5GGVY 2R4RL 2AI0L 3GYRA 2F8XC 2HJFB 5IMOB 4OJCA 4UM8B 4ZO8A 3T1WA 4RH4A 2PTVA 3FSAA 1XHHA 4H25B 4YBQC 2YOAA 1X3DA 1IBDA 3L3OC 1ZA6B 4KRPB 4CC4A 1AQKL 3WS6A 4P9MH 5E9AA 1BZ8A 1BG1A 4NDMB 4M7JL 2AK1L 2DMHA 1X7QB 3OHMB 3ZHKA 1BBDH 3C5ZC 3MRGB 3GRBA 5HGAB 2X6CA 2JI1A 4Q7DA 1SOQA 3JWOC 1DBBL 3A6BL 3MO1B 4ONGH 3C5ZA 4YHML 5I18H 2BY1A 1CDGA 1OSYA 3JTSB 1FV1A 1HIMH 1GHFL 2OR9L 1CLOL 4NAQA 2PWHA 2AKRB 5DEGA 5T1MB 2GJPA 5SWZB 4LSQH 2JF1A 2C5DC 4J1UB 5JHLA 3ESUF 2HZHA 2MEJB 3GMLA 5KS9E 4PRBB 3LKNB 5C0JA 4Y2DC 2B8OT 3WEXA 2F7PA 4LESA 5KYYA 2AJSL 2ZYIA 4P5MB 1KJVA 1KYFA 1I9IH 2G30A 1JZHA 3L5WA 2ZSWB 1B0GA 3K4AA 4Y5XC 4APXA 3O6FC 3QJTB 5IOPB 4Y5VC 2GAZB 5HJ3B 2IO5A 3QBTB 4KHTH 4NIKB 2DQFB 2G5UA 4OD3L 2XZAH 3ELQA 4NXSA 2GFBB 4WNSA 5JUEL 3UTZB 2RBLA 4LSRL 1M05B 3MRLA 1S7TA 3OHXC 4KX7A 4YHKL 2ZXWB 1ET5A 4NUQA 2JH2A 4YBLC 4NUJB 1D6VH 2GI0A 4F8QA 1E4WH 3P2TA 3OPZH 7PAZA 2FE0A 4XXCA 5CAYB 4I3SL 1C16B 4MMZC 2UWEB 2NXZC 4H20L 2DYSB 4KQ3H 5I15L 2Z0UA 4YVNA 3TBYB 3U7WH 5IP4A 2AFNA 4I3GA 3DX1A 3F7LA 3KR3H 4KNUA 5CJ5A 1I9IL 3FQXB 3BPCB 3KLDA 1QO3B 2XCMC 1WD8A 2Y6TE 2BOBB 3CH1A 3EYVB 4N26A 1UGNA 3AREB 3VGAB 7FABL 4BQ9A 1XTMA 1R3LA 1K3ZA 5C0DA 3TTYA 1FHNA 2Z3FA 4TKWA 3LNHA 4YHYB 2DIEA 2K6WA 2OLDA 3FB5A 5A2JH 2ZCKH 4W1TA 2IF7A 1C5DA 1EAPA 2WXPA 4K8RL 3NESA 1GW6A 3I75B 4HEMA 2NNFA 3WXVH 3K6OA 4ZS7L 3GHEH 4CC0A 4OFQA 4FFZH 3ABGA 3KVQA 4XO8A 4IRJA 3WLBB 2BP5M 1QR1B 4QHLA 5DLML 2RB8A 3INUH 4DP2X 4YEFA 2IBZX 3TX4A 1YC8A 1P6FA 1C1EH 2WAHA 3Q44A 2LU4A 2YQ2A 5I19H 2NUPB 2MQ0A 4J12A 3ZKXC 1MCFA 1TZ8A 3OZ9L 4I18C 1XH2A 4PQXA 1QOKA 4Z3JA 4Z7NE 4G6JH 5A6IA 5DJAB 1TENA 4OGXH 4N2IA 3I6SA 4MFHA 3ARDC 4MJIE 4N9GA 4PY8I 1YEKL 4AJWA 4F7MA 4JFFA 1IL1B 5DD1H 3F7QA 1HNFA 3FO9A 3SDXE 3TCXA 2EVIA 2XG5A 1CXIA 3POCA 1CXEA 1HHJA 2HYMA 2BW4A 3DHMA 2PW2B 3AT9A 2Y2WA 3FTZA 4W70A 5F8QC 1ZLEA 3TEYA 1G9NL 2BZCA 2ZUVA 3LPWA 5FYKL 3BAJA 4Z3TA 1AGCA 5K59F 3BQUB 3B9EA 4DGIH 4PGEA 2OW7A 2Q76A 1GCFA 3CGTA 1UOVA 5LGJA 3KGRA 4UUJB 1XGUA 4M3HA 3H1ZA 4ZUUA 4E2OA 3OKKB 5CZXC 3GSUA 4N6RA 4PJCB 2BSBA 5D2NE 5CCJA 5A2AA 1YYCA 4IIQC 3S36X 2NYYD 3N43B 5CCGE 3IGFA 2UZIL 3DETC 4N0FB 1Q9KB 5FUCE 4R9HA 5HGDB 2W92A 3HAEB 2YGVA 1LP9F 1NKGA 4FA7B 2B7DT 2CDGB 5E8DL 5AUMB 4X5WA 2CALA 4M03A 3UIYA 1BVLA 4HK0A 3IJ9A 4FRWA 1RSYA 2KL6A 2Y5EA 3RA7L 4W9ZA 4JL1A 1BPVA 4OZGB 3TL5A 4B9KC 4JFFB 1MJ7L 3OLEA 1HESA 1OTSD 4JFFE 1MI5E 2AJYL 2VL5B 4WFGD 3EFOB 5JHDA 1Z2KA 3BQVA 3IETB 1OAQL 2F68X 2IOMA 3QEHA 2NY6D 2GJZB 3MBWA 4LHUD 1YEEL 4E9YA 2LE9A 1FZOA 3LQAH 1S9KC 1AO7D 2J8UA 3OJ2C 2BFVL 3BRFA 5EO1B 2OJZH 2DYPB 1J1OH 3JSSA 4P07A 4GQ9H 1U8CB 4UV7H 4NSKB 3UO1L 1J8SA 1ZK5A 2GK2A 2WXLA 2R59A 2JXMB 5IBLD 1NIFA 5IJVB 4ZFZB 5T3XD 4IBTA 1I9RH 2C34A 4N85A 3UACA 5F9AC 3QZNA 1VF5C 4JO3H 5I30H 4LEOA 1ZDSA 1MAJA 4KPHL 2O1AA 3KPRB 1G6RH 3E38A 1EO8L 2HKFH 2GIXA 2V2XA 2E27L 3BZFA 4OQ1A 5E6RB 4BFOA 1BJMA 4DP9X 3U0WH 5D72L 1FIGL 3FQUA 3LQAL 1RIVL 2YZ8A 3HG4A 3M8OL 5TFSH 1NFIA 3WEAA 4O02L 1KG0A 4J5VA 1B0IA 4E41B 2QL1A 3L3JA 3MJ9L 5DS2A 1J1OL 4ZI8A 1DSYA 4PJ5D 5IV2B 1U8IA 2BSEA 2JJWA 5I73C 3O9WA 1V7NL 2JKXA 4ONOA 1PZ5B 2FLRT 1NANH 3FZUD 5JW4N 2WIMA 4RA0C 2VGLM 2CUAA 1JRHH 1NDMA 3SODB 1GPOL 1QI5A 4PJFF 1PYWB 5F3HB 1BMGA 3FSWA 3TJHD 2ID5A 3O8XA 1OCWH 3QFJD 4JLRB 3SGEH 4L8SB 1TTRA 1LTXA 2M8XA 4KKCC 4TLKA 4E5XB 2ZCLH 1VFBA 1IMHC 3MLYH 2OULB 5AVVB 4W9KC 1WZ1L 2KDYA 4PJGF 4PRID 4LSSH 1ZS2A 4R97C 3EGDA 4KWUA 3CFDB 4G8IB 4QRPD 4OLVL 5EOTB 4IGBA 1H15B 1V7NH 3QQXA 5ANMA 2B08A 5D2NB 2F58L 4FQCH 3PWLA 3C8KA 4MRBA 4R5XA 5TDNB 4DGVH 4NERA 3BWUF 4X5PA 1GTFA 5I66A 3RWIB 1E50A 1NDMB 1E5AA 4R2GD 3UERA 1NGPH 5DMIH 3RVWD 1A6AB 3A21A 1TJGH 1PSKL 1WS7A 1OGTB 1DBMH 3MKGA 4P4RA 3SKMA 4JFOA 1YN6A 2ESVE 2ZOTA 2IQAB 1Y1DA 4WU5A 1MF2H 5A16A 1EBAA 2JNZA 3SO3B 1I8KB 4FFZA 2GBTA 3AS1A 5GPRA 3P9LB 2R83A 1U8NA 3LPOA 1C5BH 1PZDA 3EJZD 3MV9D 5I8OH 2F1EA 3ZDWA 2P1YA 4H13C 1UVQA 3LKQA 3QPXH 1M6OA 5H37H 1NLDH 2GT9A 4I87A 4GP4B 2DAVA 4HKXB 3V7MA 3BUIA 4HU8A 2XIBA 4QWWD 1CGWA 5KTEH 1YDPA 4NCC1 5IFJB 2ED7A 3G6JE 4HMCA 1CGUA 2AK1H 3HB3D 1KPVB 1DZBA 3U36A 5AVUB 2CLZB 1ACXA 3IXTB 4G9FD 3PF2A 5H35A 5CCHE 1BFVL 3IS0X 1IC5H 1FFNB 4L18A 1SDDA 4YHPA 3BUYA 1EEYB 1NAMH 1OAUL 4GAGH 3X12A 1A3LH 4NQXA 3IGUA 3OPUA 4A67A 2Y5QA 3E1F1 1D5IH 3NABH 5EMYA 5IMLB 4LQFH 1ONQB 4YUEH 3BXNB 2FH8A 4EKXA 2JKRM 3P77A 1CCZA 1JPTH 5ITFA 3SD5A 1U30A 3TYGL 1AXIB 4M1GL 1A9BA 1AOZA 4ZUWB 2PR4L 1E3ZA 4PJFB 3MMEA 1FF5A 4BH7B 1S78C 4X6BA 4G1MA 5AALA 1S7WA 2A83A 2K7PA 4B53A 1J8HB 4OIIL 4FQQA 3QJXA 4KHTL 3NSDA 3DK0A 4IRZH 1F86A 4P57A 1ECYA 4H44C 1FJ1B 2MCG1 5MEPB 1KTCA 5JHLH 1DVSA 2N56A 3IMUA 5T1LD 1UD2A 4X4XB 4J3WA 2NNCA 1XR8B 2R15A 3FFCB 5HD8C 2VSKB 3O6FA 2IH3B 1E4WL 4MAUH 4H88H 1Q9WA 3GSWA 4HAGA 4CDHA 5M94B 2FSDA 2IJ0C 4I3SH 4BQ8A 4XP9L 4M1GH 1CIUA 4K7FB 5D96C 5BVJB 2H3NA 3HPLA 4FFVC 3TONA 2V4LA 3EO0A 4V1DB 3FSVA 5BQDA 1PLAA 2BSRA 3FO9B 1YN6B 3IDXL 2Z8WC 4LOFA 4OCWH 2QVIA 5D7IF 3MJ9A 5F44A 5TQ0L 3RZCD 3PGDB 5JA8B 3TVMB 3SGKC 1I8KA 3UAFA 5HI3C 3U2SA 1MW3A 5DSCA 5F3BB 5A3ID 2Y7LA 5B8CA 1TZGH 4HK3J 2DQFA 3SSGA 1QZNA 4L5FE 2EH7H 4BWUA 2BNQA 3OR7A 5IW1B 5IW3A 2CO1A 2AXFA 1T66C 3L7EA 1GGCH 4JJOA 3GMPA 2ICES 2OTPA 1THCA 4BKTC 4L4VB 2GK0A 2QDVA 1RJCA 4L5FL 5DQJA 4KKBD 4K3EH 3SE8H 4JMXA 4NP9A 5H4YA 3UC0H 4XBGA 4PJXA 1DJYA 1EV2E 2BOCA 2ZX7A 1BZOA 5CR1A 2V9TA 4A7TA 3TEWA 5L2KE 3O3AA 2BOBA 1MRFL 4HH8A 4MDJB 2P26A 4ZTOH 5E08H 5HHQB 3D4YA 4MNQE 3LHPL 1QPPA 4MQ7B 2HWZH 5AVZB 2EIDA 2IDQA 3O2VL 4JFYB 1HZLA 5D71L 4MXVF 4Q9QH 1YAIA