1EA6A

N-terminal 40kda fragment of nhpms2 complexed with adp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
338
structure length
304
Chain Sequence
CSGQVVLSLSTAVKELVENSLDAGATNIDLKLKDYGVDLIEVSDNGCGVEEENFEGLTLEALSSLCALSDVTISTCHASAKVGTRLMFDHNGKIIQKTPYPRPRGTTVSVQQLFSTLPVRHKEFQRNIKKEYAKMVQVLHAYCIISAGIRVSCTNQLGQGKRQPVVCTGGSPSIKENIGSVFGQKQLQSLIPFVQLPPSDSVCEEYGLSCSDALHNLFYISGFISQCTHGVGRSSTDRQFFFINRRPCDPAKVCRLVNEVYHMYNRHQYPFVVLNISVDSECVLLQEEKLLLAVLKTSLIGMFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PMS1 PROTEIN HOMOLOG 2
publication title Structure and Function of the N-Terminal 40 kDa Fragment of Human Pms2: A Monomeric Ghl ATPase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna repair
total genus 86
structure length 304
sequence length 338
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01119 DNA_mis_repair DNA mismatch repair protein, C-terminal domain
A PF13589 HATPase_c_3 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1ea6A02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1ea6A01
2FWYA 4YKYA 3R4MA 3O0IA 2BM0A 3TZ0A 4CWQA 4R1FA 4DR3E 2WI7A 4KHPE 5J71A 1BKNA 4JI5E 4X65I 2WEPA 5L3JA 1N32E 1OJ4A 1OSFA 2EXLA 4QPJA 1UYMA 1YC1A 2V34A 4MB9A 3VHAA 4DUYE 2LJPA 2CGFA 4JAUA 1YT1A 4EGHA 3JAMC 4AQYE 4JI2E 3B28A 1Z5AA 2V2VA 1ZW9A 3CGYA 2ZM6E 1HNXI 1XNRE 2BT0A 4QPKA 2WI4A 2YGFA 4DUHA 2WW4A 2XHRA 2UUAI 4R3AA 4L93A 5M4NA 2CH4A 1Y8PA 1QYEA 3U67A 1A6FA 3WHAA 5FNDA 3U2KA 3HULA 1EI1A 2C2AA 4WUDA 4JI0I 5LMUI 4GKKE 2UU9I 1I58A 4BAEA 4B3TI 1FNMA 3B82A 2YEHA 2YE8A 2YI5A 3T1HI 3T10A 2R42A 2VQFI 4LWFA 2V2ZA 3TZ5A 4B7PA 4JI4E 4FPPA 4HZ0A 4URMA 4DV1I 4EGKA 4E00A 4LF6E 4JYAE 3J80C 5IT9C 2YI0A 5M4MA 4X9LA 5J6AA 4NH9A 4PRVA 4EMDA 1J5EE 4DV0I 1Z0GA 2QG2A 2WI2A 2XHTA 3WU4A 1ZM3A 5F3KA 3HYYA 1XHKA 1H7SA 4JI1I 3D36A 1ID0A 4CE2A 4DUZI 4K0KI 4JI3E 4U93A 3RLPA 5FWKA 4JQLA 1B63A 1Z5CA 1ZXNA 3A0TA 1Z0TA 2BU7A 4XIPA 4WUBA 1I94E 5D7CA 4LWIA 4DPUA 1YC4A 4B3RE 1NZ0A 4JV5E 2UXBI 4O09A 1UYDA 4FCRA 2X7IA 3K60A 3D0BA 1I5DA 2BYIA 4CE1A 2YJXA 4EMVA 1S4EA 3WU6A 3INWA 1BXDA 4MPCA 1TC0A 3B24A 2V2QA 2XDSA 3ZXQA 2WI6A 2BU5A 5LMNE 3K17A 4GKJE 3VADA 1QZRA 4KFGA 1FJGI 1YESA 4ASAA 1QY8A 3V2UC 2XCMA 2A2CA 1HNWE 4LFCE 3ZZUA 4ED4A 2YGAA 4DXLA 4YKRA 1AJ6A 2WERA 1N34E 3C11A 1UY7A 4UTGA 1XMOE 1YT2A 4DR4I 3MNRP 4CWTA 4YKZA 5D6QA 2YEEA 2AKPA 3PEHA 3WU3A 4LF7E 4AWPA 4LFAI 1XMQE 3EHGA 4MP2A 2BU2A 4JI7E 1S16A 4Z7YA 4MYUA 4GGLA 4ZKIA 1H7UA 4XTJA 1IBKE 3T1YI 5M4HA 2FXSA 4O04A 4O05A 2XEXA 4B6CA 1GKZA 2YKCA 4R3MA 3O6OA 4KSGA 1NHHA 1Z0VA 3J7AG 5F5RA 1HR0I 2UXDE 5A2QQ 1FWKA 4M1KA 4LF8E 1UYEA 1MU5A 1Y8OA 4OX9I 5GMEA 4XC0A 2HK3A 3D4JA 4EM7A 1MX0A 2XK2A 3LPSA 4PU9A 4USKA 1RREA 1N33I 3C0EA 4FWDA 4XKKA 5LL6R 4X64E 2HFUA 2HKJA 2YE3A 1IBLE 1TC6A 1YT0A 2ZKJA 1THNA 5FNFA 3K99A 3RLQA 3TZ2A 4YY3E 4I5SA 4L94A 2YKIA 4DV5I 4DR5I 2UXCE 5CTYA 4XIQA 4X66I 5FLXQ 2BREA 4DR7E 4JAVA 1HNZI 4GQTA 4BIUA 4LF5I 1U2RA 4B3ME 4LFBE 4DR6E 3KE6A 1UYLA 4L90A 2O1VA 3HHUA 4LP0A 3ZKDA 2QFOA 4PRXA 3Q5JA 2Q8IA 4GCZA 2YE7A 4HY6A 4DR3I 3FV5A 4KHPI 2XJGA 4ASFA 4JG4A 4JI5I 3QT8A 1N32I 1BGQA 4DV7E 4K4OA 2PNRA 4JASA 3Q5KA 3G75A 4E02A 1NHIA 2YEDA 3CRKA 4Z7CA 3U2DA 4DUYI 4DR2E 1I5BA 4AQYI 4JI2I 2ZBKB 3ZZTA 2VQEE 2UUBE 1YSRA 4MPEA 3D2RA 2ZM6I 2YK2A 1XNRI 5CTWA 4P7AA 1Z0EA 1A4HA 1UYKA 4NH7A 4HY1A 1HNXE 4HYPA 4ASBA 1ZM9A 3LNUA 2HFSA 4DV4E 4AS9A 5FNCA 3A0ZA 5M4KA 1K47A 4DU7A 4GKKI 1YS3A 4URLA 3HEKA 3R4PA 4BQGA 1ZWHA 2UWDA 1N0UA 5BR8E 3OW6A 4L91A 3OWBA 2QF6A 4DV2E 4JI4I 4I3HA 4LF6I 4JYAI 3OMUA 3ZM7A 3T1HE 2CZ9A 1D6TA 4LF9E 4DV6E 4H7QA 3T0ZA 2VW5A 1J5EI 4XKAA 3VHCA 3BM9A 1PVGA 5D7RA 2VWCA 4JI3I 1AM1A 2BM1A 4YKQA 3EHHA 2R3VA 1IBME 2YJWA 3TUHA 2GS8A 3H80A 1KTVA 2BYHA 1I94I 1US7A 2IWSA 4BXIA 2BTZA 2YI6A 5CF0A 5IDJA 4DV3E 3M6AA 4B3RI 4FMTA 3GIGA 2YEFA 4JV5I 2YKBA 5BODA 3LTOA 5IWAE 4XCJA 1NHJA 4MYTA 3J81C 4GFNA 2XHXA 4YKUA 2YEJA 1JM6A 1UY6A 1XNQI 3K1JA 4DPYA 4NXNE 4DPXA 4GKJI 5IDMA 3OTOE 3K98A 3EKRA 3F0NA 1KKHA 2E5LE 1B3QA 3G7BA 3HZ1A 2VCIA 5BOCA 4YHHI 1VISA 1GJVA 3B78A 1HNWI 4LFCI 2DEIA 5A2QC 4DR1I 3EHFA 3PEJA 4DPTA 3HZ5A 4EEHA 1I59A 4EGIA 3CWVA 2NPFA 3QTFA 2HK2A 4UT4A 1N34I 1ZXMA 1XMOI 2YEGA 4YKTA 3ZXOA 4LWEA 4EFUA 1ZM2A 4X62E 2XX4A 4FWHA 2YE4A 4XE2A 2YE2A 4FW9A 2IWUA 4FCPA 4GT8A 4LF7I 2BV3A 4JI8E 2CG9A 2UUCE 1XMQI 3A0RA 2ZITA 2IWXA 4JI7I 3OWDA 3QT6A 3PYFA 4EFTA 4W7TA 3CRLA 2F4VE 1I5CA 2BZ5A 1Y4UA 4RPFA 1UY8A 4WUCA 4CWRA 4HACA 2FYPA 2Q8HA 1PIEA 3Q5LA 2UXDI 1MG7A 1Z0WA 5CTUA 2BSMA 3RLRA 3O2FA 3FT8A 1N36E 1EA6A 4E01A 4DPWA 1L0OA 3WQ9A 4X64I 1U0ZA 4NXME 4XITA 1U2OA 1IBLI 2XX5A 4KTNA 1FKAE 3H4LA 4DU8A 4JI6E 3Q1QA 4L8ZA 4URNA 4O07A 4YY3I 2YEAA 3DGEA 1I5AA 4FN5A 4XKOA 2VCJA 3ZKBA 2CCTA 2BU6A 2UXCI 3FT5A 4B3SE 2Q8GA 4LF4E 4HZ5A 1Z0BA 2E0AA 4DR7I 2HHHE 5D6PA 4X66E 4YKWA 4B3MI 3QDDA 3T1KA 3TTZA 4LFBI 4DR6I 2XDLA 3J7AM 1AH8A 3G7EA 1UYIA 2QG0A 1TILA 3V5RA 3OPDA 3QT7A 1PKPA 4X65E 4BIZA 1Z0CA 3QT5A 4V26A 2E1RA 4O0BA 5CTXA 2FWZA 2HKEA 4FCQA 2HG1A 2YECA 4NH8A 4DV7I 1RR9A 3EKOA 1Z5BA 2BRCA 2WI3A 4BQJA 1KVKA 4ZVIA 4DR2I 2CCUA 2YEBA 2ESAA 2UUAE 2YI7A 2VQEI 2UUBI 1AH6A 4XDMA 3RKZA 1YETA 1S14A 3INXA 4ASGA 3PYDA 1UYCA 4MBCA 3R91A 4DZYA 4CE3A 1BYQA 3B25A 4DV4I 4JI0E 5LMUE 2OI2A 2IOQA 2UU9E 4B3TE 1UEKA 5M4PA 3PYEA 4HACB 2YE9A 2VQFE 4AWQA 1KIJA 4U7OA 5D7DA 5BR8I 4DV1E 1UYGA 2YKJA 2JKIA 2Q8FA 1FI4A 4MP7A 4DV2I 4AWOA 4CWPA 3JAMQ 4LWGA 1H72C 4DV0E 5M4EA 4CWOA 1GKXA 4PL9A 4LF9I 4JI1E 4DV6I 4FWGA 3B27A 4DUZE 3R92A 3VHDA 4K0KE 2GFDA 2HCHA 4KP4A 4KSHA 1Y4SA 2YGEA 1Y8NA 3A0YA 1IBMI 4CWSA 3B8HA 2UXBE 1UY9A 3HYZA 2ZDXA 2YKEA 3K97A 2GQPA 4DV3I 5GGZA 2WEQA 3BMYA 1H73A 2BU8A 1TBWA 5LMNI 2DEJA 1YERA 2O1UA 5IWAI 3J80Q 5IT9Q 3PYGA 4XIRA 5IN9A 2XJJA 2YE6A 2ZDYA 4YKXA 3TZ4A 4CWFA 1FJGE 2XJXA 4Q20A 4NXNI 1ELOA 1XNQE 1B62A 3OTOI 2J7KA 1KZNA 5C93A 2E5LI 1Z59A 2CCSA 4USMA 2YEIA 2O1WA 4LPBA 4MPNA 4HYMA 4YHHE 4MOTA 4DR4E 2WI5A 2H55A 2XABA 2XDXA 3SL2A 3IEDA 4DR1E 1H74A 3ZZ0A 1N0VC 2XD6A 1FWLA 2YK9A 4LFAE 5GMDA 4X62I 1IBKI 3R4OA 4LWHA 4P8OA 2JJCA 2X36A 2IOPA 4JI8I 2UUCI 3T1YE 4CWNA 5FLXC 1R62A 1UYFA 3B26A 4XD8A 3JZ3A 3J81Q 2IORA 4LF8I 1WUUA 2F4VI 1HR0E 4V25A 4H85A 2A2DA 2Q2EB 2XX2A 3GIFA 4OX9E 3A0WA 3T0HA 3A0XA 3R4NA 2EFGA 1N33E 4GEEA 1TH8A 1N36I 2V8PA 2K5BA 3CGZA 3GIEA 4HXWA 2AJ4A 3NMQA 4P52A 2VF3A 4NXMI 1YC3A 2XDKA 3GIGB 1DARA 3WU5A 4JI6I 4KQVA 4U7NA 4UROA 4XCLA 4DV5E 4DR5E 1UYHA 1AMWA 5CPHA 3T2SA 1ZM4A 3GONA 1TIDA 1HNZE 4H81A 4B3SI 2WI1A 4LF5E 3EHJA 4LF4I 2YE5A 2XDUA 2HHHI 1YSZA 2H8MA 4HXZA
chains in the Genus database with same CATH superfamily
2FWYA 4YKYA 3R4MA 1R6MA 2BR2B 3O0IA 2BM0A 2AE8A 3TZ0A 4R1FA 4CWQA 4N3OA 4DR3E 2WI7A 4KHPE 5J71A 1BKNA 4JI5E 4X65I 2WEPA 5L3JA 1N32E 2PNLA 1OJ4A 1P42A 1OSFA 2EXLA 4OKGA 4OO1F 4QPJA 1UYMA 1YC1A 2V34A 4MB9A 3VHAA 4DUYE 2LJPA 2CGFA 4JAUA 1YT1A 4EGHA 3JAMC 4AQYE 4JI2E 4GQUA 3B28A 1Z5AA 2V2VA 1ZW9A 3CGYA 2ZM6E 1HNXI 1XNRE 2BT0A 4QPKA 2WI4A 4BA1A 2YGFA 2WW4A 2BA1D 4DUHA 2XHRA 2UUAI 4R3AA 4L93A 5M4NA 2CH4A 1Y8PA 2GO4A 1QYEA 1A6FA 2JE6A 3U67A 5C0XF 3WHAA 4LOMA 5FNDA 3U2KA 4IFDF 3HULA 1EI1A 2C2AA 4WUDA 4JI0I 5LMUI 2Z5EA 2C37B 4IZKB 2UU9I 4GKKE 1I58A 4BAEA 4QNKA 4B3TI 1FNMA 3B82A 2YEHA 2YE8A 2YI5A 5F3KA 3T1HI 3L7ZB 3T10A 2R42A 2VQFI 4LWFA 2V2ZA 3TZ5A 4B7PA 4JI4E 4FPPA 4HZ0A 4URMA 4DV1I 2Z5BB 4E00A 4LF6E 4JYAE 4EGKA 3J80C 5IT9C 2YI0A 5M4MA 4X9LA 5J6AA 4NH9A 4PRVA 5JEAB 4EMDA 2CGEA 1J5EE 5JEAF 4DV0I 1Z0GA 2QG2A 2WI2A 3PRYA 3WU4A 1ZM3A 2XHTA 3HYYA 1XHKA 1H7SA 4JI1I 5DROA 1ID0A 3D36A 4DUZI 4K0KI 4JI3E 4U93A 3RLPA 5FWKA 4JQLA 1B63A 1Z5CA 1ZXNA 3A0TA 1Z0TA 2BU7A 4XIPA 4WUBA 4MU4A 1I94E 3HKMA 5D7CA 4LWIA 5K36C 4DPUA 1YC4A 4B3RE 4AIMA 2PO2A 1NZ0A 4JV5E 2UXBI 4O09A 1UYDA 4FCRA 2X7IA 3K60A 3S5TA 1YHCA 1I5DA 2BYIA 3D0BA 2YJXA 4CE1A 4EMVA 1S4EA 3WU6A 3INWA 1BXDA 4MPCA 1TC0A 3B24A 2V2QA 2XDSA 3ZXQA 3U1YA 1Y60A 2BU5A 2WI6A 1RHYA 5LMNE 3K17A 4BA2A 4GKJE 3VADA 4IZJA 4IS9A 1QZRA 4QNJA 1FJGI 4KFGA 1YESA 4ASAA 1QY8A 3V2UC 2XCMA 2A2CA 1HNWE 4LFCE 3ZZUA 4ED4A 2YGAA 4DXLA 4YKRA 2PNMA 1AJ6A 2WERA 1N34E 3C11A 1UY7A 4UTGA 1XMOE 1YT2A 4DR4I 3MNRP 4CWTA 4YKZA 1UDSA 5D6QA 1OYPA 2NN6D 2YEEA 2AKPA 4IZJD 3PEHA 3WU3A 2C39A 4LF7E 4AWPA 4LFAI 1XMQE 3EHGA 4MP2A 2JE6B 2BU2A 4JI7E 1S16A 4Z7YA 4MYUA 4GGLA 4ZKIA 2PO0A 1H7UA 4XTJA 1IBKE 3T1YI 5M4HA 2FXSA 4O04A 2JEBA 4O05A 2XEXA 4B6CA 1GKZA 4MU1A 2YKCA 4R3MA 3O6OA 4KSGA 1NHHA 1Z0VA 3J7AG 5F5RA 1HR0I 2UXDE 5A2QQ 1FWKA 4M1KA 4LF8E 1UYEA 1MU5A 5C0XA 4OX9I 5GMEA 5K36F 1Y8OA 4XC0A 2HK3A 3D4JA 4EM7A 1MX0A 2XK2A 3LPSA 4PU9A 4USKA 1RREA 1N33I 3C0EA 4FWDA 4XKKA 5LL6R 5ELWA 4X64E 2HFUA 2HKJA 2YE3A 1IBLE 1TC6A 1YT0A 2ZKJA 3KRNA 1THNA 5FNFA 3K99A 3RLQA 1F51A 4MU0A 3TZ2A 4YY3E 4I5SA 4L94A 2YKIA 5C0XD 4DV5I 4DR5I 2UXCE 3PS3A 2PO2B 4XIQA 4X66I 5CTYA 5FLXQ 2BREA 4DR7E 4JAVA 1HNZI 4GQTA 4BIUA 4LF5I 5C0XE 1U2RA 4B3ME 4LFBE 4DR6E 3KE6A 4FW7A 1UYLA 4L90A 2O1VA 3HHUA 4LP0A 4BA2B 3ZKDA 4IZJB 2QFOA 4PRXA 3Q5JA 2Q8IA 4GCZA 4ISAA 2YE7A 1E3PA 1E3HA 4U3BA 4HY6A 4DR3I 3FV5A 4KHPI 2XJGA 4ASFA 4JG4A 4JI5I 3QT8A 3GLLA 4FW3A 1N32I 1BGQA 4DV7E 4K4OA 2PNRA 4JASA 3Q5KA 3G75A 4E02A 1NHIA 2WNRA 2YEDA 4Z7CA 3CRKA 4DUYI 4DR2E 3U2DA 1I5BA 4AQYI 4JI2I 2ZBKB 3Q6MA 4J3DA 3ZZTA 2VQEE 2UUBE 1YSRA 4MPEA 3D2RA 2ZM6I 2YK2A 1XNRI 2C38B 5CTWA 2C39B 2C1GA 4P7AA 1Z0EA 1A4HA 1UYKA 3GMEA 4NH7A 3CDIA 4HY1A 1HNXE 4HYPA 4ASBA 1ZM9A 3LNUA 2HFSA 2PNZA 2PO0B 4DV4E 4AS9A 4CE2A 5FNCA 2JEBB 3A0ZA 5M4KA 1K47A 3PS2A 4DU7A 4GKKI 2C1IA 1YS3A 4URLA 3HEKA 3R4PA 4BQGA 5DRRA 1ZWHA 4MQYA 2UWDA 1N0UA 5BR8E 3OW6A 4L91A 3OWBA 2QF6A 4DV2E 4LCFA 4JI4I 4I3HA 4LF6I 4JYAI 3OMUA 3ZM7A 3T1HE 2O3ZA 2CZ9A 4LCGA 4LF9E 1D6TA 4DV6E 4H7QA 3T0ZA 2HHIA 2VW5A 1J5EI 4XKAA 3DD6A 2F1DA 3VHCA 3BM9A 1PVGA 5D7RA 3M7ND 2VWCA 4JI3I 1AM1A 2BM1A 2CVEA 4AM3A 4YKQA 3EHHA 2R3VA 2BA1G 1IBME 2YJWA 3TUHA 2GS8A 3H80A 1KTVA 2BYHA 1I94I 1US7A 2IWSA 4BXIA 2BTZA 2YI6A 5CF0A 5IDJA 4DV3E 3M6AA 1Y6ZA 4B3RI 4FMTA 3GIGA 2YEFA 4JV5I 2BA0D 2YKBA 2NN6A 5BODA 3LTOA 5IWAE 4XCJA 1NHJA 4MYTA 3J81C 4GFNA 2XHXA 4YKUA 2YEJA 1JM6A 1UY6A 1XNQI 3K1JA 1XXEA 4DPYA 4NXNE 4DPXA 4GKJI 3U1KA 3OTOE 5IDMA 3K98A 3EKRA 3F0NA 1KKHA 2E5LE 1B3QA 3G7BA 3HZ1A 2VCIA 5BOCA 4YHHI 5JENA 1VISA 2O1TA 1GJVA 3B78A 2BR2A 5DNLA 4LFCI 2DEIA 1HNWI 5A2QC 4DR1I 5DNXA 3EHFA 4DPTA 3HZ5A 3PEJA 4EEHA 1I59A 4EGIA 3CWVA 4BA1B 2NPFA 3QTFA 2HK2A 2NN6C 4UT4A 1N34I 1ZXMA 1XMOI 2YEGA 3M7NG 4YKTA 4LWEA 3ZXOA 4EFUA 1ZM2A 4OO1A 2NN6E 1UDOA 4X62E 2XX4A 4AIDA 4FWHA 2YE4A 5EL9A 4XE2A 5EKWA 2YE2A 4FW9A 2IWUA 4FCPA 4GT8A 2CG9A 2BV3A 4JI8E 4LF7I 2UUCE 1XMQI 1VI7A 2IESA 3A0RA 2ZITA 3P06A 2IWXA 4JI7I 2PNZB 3QT6A 3HJCA 3OWDA 3PYFA 4EFTA 4W7TA 3CRLA 2BA0G 2F4VE 1I5CA 2BZ5A 2WP8A 4MDTA 1Y4UA 4RPFA 1UY8A 4WUCA 4IFDA 4CWRA 4HACA 2FYPA 2Q8HA 1PIEA 3Q5LA 2UXDI 4OO1D 1MG7A 1Z0WA 5CTUA 3CDJA 2BSMA 1UDNA 3RLRA 3O2FA 3FT8A 1N36E 1EA6A 4E01A 3L7ZA 4OO1E 4DPWA 1L0OA 3WQ9A 4X64I 1U0ZA 2Z5BA 4NXME 4XITA 4FW5A 1U2OA 1IBLI 2XX5A 4KTNA 5JEAA 1FKAE 5C0XC 1Y5YA 3H4LA 1UDQA 4DU8A 4JI6E 3Q1QA 4IFDD 4L8ZA 4URNA 4O07A 4YY3I 2YEAA 3DGEA 1I5AA 4FN5A 3H1CA 4XKOA 2VCJA 3ZKBA 2CCTA 2BU6A 2UXCI 4IFDE 3FT5A 4B3SE 2Q8GA 4LF4E 4HZ5A 1Z0BA 2E0AA 2NN6B 2HHHE 2JT2A 4DR7I 5D6PA 4X66E 4YKWA 3UHMA 4B3MI 3QDDA 3T1KA 3P3CA 3TTZA 4LFBI 3GCMA 4DR6I 5JEAD 4U3DA 2PO1A 2XDLA 3J7AM 1AH8A 3G7EA 1UYIA 2QG0A 1R6LA 1TILA 3K85A 3V5RA 3OPDA 3QT7A 1PKPA 5JEAE 4X65E 4BIZA 1Z0CA 3QT5A 4V26A 2E1RA 4O0BA 5CTXA 2FWZA 2HKEA 4FCQA 2HG1A 1OYRA 2YECA 4NH8A 2GO3A 4DV7I 1RR9A 3EKOA 2JEAA 1Z5BA 2BRCA 2WI3A 4BQJA 1KVKA 4ZVIA 4DR2I 4OO1B 2CCUA 2Z5CA 2YEBA 2ESAA 2UUAE 2YI7A 2VQEI 2UUBI 1AH6A 4XDMA 3RKZA 1YETA 2J65A 1S14A 3INXA 4ASGA 3PYDA 1UYCA 4MBCA 3R91A 4DZYA 4CE3A 1BYQA 4LCHA 3B25A 2GQ0A 2VESA 4DV4I 2IOQA 2OI2A 5LMUE 2UU9E 4JI0E 5C0XB 4B3TE 2WP8B 1UEKA 4IFDB 5M4PA 3PYEA 4HACB 2YE9A 2VQFE 4AWQA 1KIJA 4U7OA 5D7DA 5BR8I 4DV1E 1UYGA 2YKJA 2JKIA 4MU3A 1FI4A 4MP7A 4DV2I 2Q8FA 4AWOA 4CWPA 3JAMQ 4LWGA 1H72C 4DV0E 5M4EA 4CWOA 5K36A 1GKXA 4PL9A 4LF9I 4JI1E 4DV6I 4FWGA 3B27A 4FW4A 4DUZE 3R92A 3VHDA 3Q6NA 4K0KE 3P3EA 2GFDA 2HCHA 4KP4A 4KSHA 3PS1A 1Y4SA 2YGEA 1Y8NA 3A0YA 1IBMI 4CWSA 3B8HA 2UXBE 1UY9A 3HYZA 2ZDXA 2YKEA 3K97A 2GQPA 4DV3I 5GGZA 2WEQA 2IERA 3BMYA 1H73A 5K36D 2BU8A 1USUA 1TBWA 5LMNI 2DEJA 2O1UA 1YERA 5IWAI 3J80Q 5IT9Q 3M85D 3PYGA 4XIRA 5IN9A 2XJJA 2PO1B 2YE6A 2ZDYA 4YKXA 3TZ4A 5K36E 4CWFA 1FJGE 2XJXA 3B4TA 4Q20A 4NXNI 1ELOA 3CYGA 1XNQE 1B62A 3OTOI 2J7KA 1KZNA 5C93A 2E5LI 1Z59A 2WNRB 2CCSA 4USMA 5DRPA 2O1WA 2YEIA 4LPBA 1HK7A 4MPNA 4HYMA 4YHHE 4MOTA 4DR4E 2WI5A 2H55A 2XABA 2XDXA 3SL2A 2JEAB 3IEDA 4DR1E 1H74A 3ZZ0A 4E72A 1N0VC 2XD6A 2FTKA 1FWLA 2Z5CB 2YK9A 4LFAE 5GMDA 4X62I 1IBKI 3R4OA 4LWHA 4P8OA 2JJCA 2X36A 2IOPA 4JI8I 2UUCI 3T1YE 3NZKA 4CWNA 5FLXC 1R62A 1UYFA 3B26A 4XD8A 4FW6A 3JZ3A 2C38A 3J81Q 4LPFA 2IORA 2C37A 4IZKA 4LF8I 4OO1C 1WUUA 2F4VI 1HR0E 4V25A 4H85A 2A2DA 2Q2EB 3M85G 2XX2A 3GIFA 4OX9E 3A0WA 3T0HA 3A0XA 3R4NA 2EFGA 1N33E 4GEEA 1TH8A 1N36I 2V8PA 5K36B 2K5BA 3CGZA 3GIEA 4HXWA 3LMMA 2AJ4A 3NMQA 4P52A 4IFDC 2VF3A 5DRQA 1IXMA 4NXMI 1YC3A 2XDKA 1YH8A 3GIGB 1DARA 3P3GA 3P76A 3WU5A 4JI6I 4KQVA 4U7NA 4UROA 4XCLA 1USVA 4DV5E 4DR5E 1AMWA 1UYHA 5CPHA 3T2SA 1ZM4A 2NN6F 3GONA 1TIDA 1HNZE 4H81A 4OZEA 4B3SI 4LF5E 2WI1A 3EHJA 5JEAC 4LF4I 2YE5A 4NBQA 2XDUA 2HHHI 1YSZA 2H8MA 1OYSA 4HXZA
chains in the Genus database with same CATH topology
2FWYA 4YKYA 3R4MA 3O0IA 2BM0A 3TZ0A 4CWQA 4R1FA 4N3OA 4DR3E 2WI7A 4KHPE 5J71A 1BKNA 4JI5E 4X65I 2WEPA 5L3JA 1N32E 2PNLA 1OJ4A 1OSFA 2EXLA 4QPJA 1UYMA 1YC1A 2V34A 4MB9A 3VHAA 4DUYE 2LJPA 2CGFA 4JAUA 1YT1A 4EGHA 3JAMC 4AQYE 4JI2E 3B28A 1Z5AA 2V2VA 1ZW9A 3CGYA 2ZM6E 1HNXI 1XNRE 2BT0A 4QPKA 2WI4A 2YGFA 4DUHA 2WW4A 2XHRA 2UUAI 4R3AA 4L93A 5M4NA 2CH4A 1Y8PA 1QYEA 3U67A 1A6FA 3WHAA 5FNDA 3U2KA 3HULA 1EI1A 2C2AA 4WUDA 4JI0I 5LMUI 2Z5EA 4IZKB 2UU9I 4GKKE 1I58A 4BAEA 4B3TI 1FNMA 3B82A 2YEHA 2YE8A 2YI5A 3T1HI 3T10A 2R42A 2VQFI 4LWFA 2V2ZA 3TZ5A 4B7PA 4JI4E 4FPPA 4HZ0A 4URMA 4DV1I 2Z5BB 4E00A 4LF6E 4JYAE 4EGKA 3J80C 5IT9C 2YI0A 5M4MA 4X9LA 5J6AA 4NH9A 4PRVA 4EMDA 2CGEA 1J5EE 4DV0I 1Z0GA 2QG2A 2WI2A 3PRYA 3WU4A 1ZM3A 2XHTA 3HYYA 1XHKA 1H7SA 4JI1I 3D36A 1ID0A 5F3KA 4DUZI 4K0KI 4JI3E 4U93A 3RLPA 5FWKA 4JQLA 1B63A 1Z5CA 1ZXNA 3A0TA 1Z0TA 2BU7A 4XIPA 4WUBA 1I94E 5D7CA 4LWIA 4DPUA 1YC4A 4B3RE 1NZ0A 4JV5E 2UXBI 4O09A 1UYDA 4FCRA 2X7IA 3K60A 3D0BA 1I5DA 2BYIA 4CE1A 2YJXA 4EMVA 1S4EA 3WU6A 3INWA 1BXDA 4MPCA 1TC0A 3B24A 2V2QA 2XDSA 3ZXQA 2WI6A 2BU5A 5LMNE 3K17A 4GKJE 3VADA 4IZJA 1QZRA 4KFGA 1FJGI 1YESA 4ASAA 1QY8A 3V2UC 2XCMA 2A2CA 1HNWE 4LFCE 3ZZUA 4ED4A 2YGAA 4DXLA 4YKRA 2PNMA 1AJ6A 2WERA 1N34E 3C11A 1UY7A 4UTGA 1XMOE 1YT2A 4DR4I 3MNRP 4CWTA 4YKZA 5D6QA 2YEEA 2AKPA 4IZJD 3PEHA 3WU3A 4LF7E 4AWPA 4LFAI 1XMQE 3EHGA 4MP2A 2BU2A 4JI7E 1S16A 4Z7YA 4MYUA 4GGLA 4ZKIA 1H7UA 4XTJA 1IBKE 3T1YI 5M4HA 2FXSA 4O04A 4O05A 2XEXA 4B6CA 1GKZA 2YKCA 4R3MA 3O6OA 4KSGA 1NHHA 1Z0VA 3J7AG 5F5RA 1HR0I 2UXDE 5A2QQ 1FWKA 4M1KA 4LF8E 1UYEA 1MU5A 1Y8OA 4OX9I 5GMEA 4XC0A 2HK3A 3D4JA 4EM7A 1MX0A 2XK2A 3LPSA 4PU9A 4USKA 1RREA 1N33I 3C0EA 4FWDA 4XKKA 5LL6R 4X64E 2HFUA 2HKJA 2YE3A 1IBLE 1TC6A 1YT0A 2ZKJA 1THNA 5FNFA 3K99A 3RLQA 3TZ2A 4YY3E 4I5SA 4L94A 2YKIA 4DV5I 4DR5I 2UXCE 5CTYA 4XIQA 4X66I 5FLXQ 2BREA 4DR7E 4JAVA 1HNZI 4GQTA 4BIUA 4LF5I 1U2RA 4B3ME 4LFBE 4DR6E 3KE6A 1UYLA 4L90A 2O1VA 3HHUA 4LP0A 3ZKDA 4IZJB 2QFOA 4PRXA 3Q5JA 2Q8IA 4GCZA 2YE7A 4HY6A 4DR3I 3FV5A 4KHPI 2XJGA 4ASFA 4JG4A 4JI5I 3QT8A 1N32I 1BGQA 4DV7E 4K4OA 2PNRA 4JASA 3Q5KA 3G75A 4E02A 1NHIA 2YEDA 3CRKA 4Z7CA 3U2DA 4DUYI 4DR2E 1I5BA 4AQYI 4JI2I 2ZBKB 3Q6MA 3ZZTA 2VQEE 2UUBE 1YSRA 4MPEA 3D2RA 2ZM6I 2YK2A 1XNRI 5CTWA 4P7AA 1Z0EA 1A4HA 1UYKA 4NH7A 4HY1A 1HNXE 4HYPA 4ASBA 1ZM9A 3LNUA 2HFSA 4DV4E 4AS9A 4CE2A 5FNCA 3A0ZA 5M4KA 1K47A 4DU7A 4GKKI 1YS3A 4URLA 3HEKA 3R4PA 4BQGA 1ZWHA 2UWDA 1N0UA 5BR8E 3OW6A 4L91A 3OWBA 2QF6A 4DV2E 4JI4I 4I3HA 4LF6I 4JYAI 3OMUA 3ZM7A 3T1HE 2CZ9A 1D6TA 4LF9E 4DV6E 4H7QA 3T0ZA 2VW5A 1J5EI 4XKAA 3VHCA 3BM9A 1PVGA 5D7RA 2VWCA 4JI3I 1AM1A 2BM1A 4YKQA 3EHHA 2R3VA 1IBME 2YJWA 3TUHA 2GS8A 3H80A 1KTVA 2BYHA 1I94I 1US7A 2IWSA 4BXIA 2BTZA 2YI6A 5CF0A 5IDJA 4DV3E 3M6AA 1Y6ZA 4B3RI 4FMTA 3GIGA 2YEFA 4JV5I 2YKBA 5BODA 3LTOA 5IWAE 4XCJA 1NHJA 4MYTA 3J81C 4GFNA 2XHXA 4YKUA 2YEJA 1JM6A 1UY6A 1XNQI 3K1JA 4DPYA 4NXNE 4DPXA 4GKJI 5IDMA 3OTOE 3K98A 3EKRA 3F0NA 1KKHA 2E5LE 1B3QA 3G7BA 3HZ1A 2VCIA 5BOCA 4YHHI 1VISA 2O1TA 1GJVA 3B78A 1HNWI 4LFCI 2DEIA 5A2QC 4DR1I 3EHFA 3PEJA 4DPTA 3HZ5A 4EEHA 1I59A 4EGIA 3CWVA 2NPFA 3QTFA 2HK2A 4UT4A 1N34I 1ZXMA 1XMOI 2YEGA 4YKTA 3ZXOA 4LWEA 4EFUA 1ZM2A 4X62E 2XX4A 4FWHA 2YE4A 4XE2A 2YE2A 4FW9A 2IWUA 4FCPA 4GT8A 2CG9A 2BV3A 4JI8E 4LF7I 2UUCE 1XMQI 3A0RA 2ZITA 3P06A 2IWXA 4JI7I 3OWDA 3QT6A 3HJCA 3PYFA 4EFTA 4W7TA 3CRLA 2F4VE 1I5CA 2BZ5A 1Y4UA 4RPFA 1UY8A 4WUCA 4CWRA 4HACA 2FYPA 2Q8HA 1PIEA 3Q5LA 2UXDI 1MG7A 1Z0WA 5CTUA 2BSMA 3RLRA 3O2FA 3FT8A 1N36E 1EA6A 4E01A 4DPWA 1L0OA 3WQ9A 4X64I 1U0ZA 2Z5BA 4NXME 4XITA 1U2OA 1IBLI 2XX5A 4KTNA 1FKAE 3H4LA 4DU8A 4JI6E 3Q1QA 4L8ZA 4URNA 4O07A 4YY3I 2YEAA 3DGEA 1I5AA 4FN5A 4XKOA 2VCJA 3ZKBA 2CCTA 2BU6A 2UXCI 3FT5A 4B3SE 2Q8GA 4LF4E 4HZ5A 1Z0BA 2E0AA 4DR7I 2HHHE 5D6PA 4X66E 4YKWA 4B3MI 3QDDA 3T1KA 3TTZA 4LFBI 4DR6I 2XDLA 3J7AM 1AH8A 3G7EA 1UYIA 2QG0A 1TILA 3K85A 3V5RA 3OPDA 3QT7A 1PKPA 4X65E 4BIZA 1Z0CA 3QT5A 4V26A 2E1RA 4O0BA 5CTXA 2FWZA 2HKEA 4FCQA 2HG1A 2YECA 4NH8A 4DV7I 1RR9A 3EKOA 1Z5BA 2BRCA 2WI3A 4BQJA 1KVKA 4ZVIA 4DR2I 2CCUA 2Z5CA 2YEBA 2ESAA 2UUAE 2YI7A 2VQEI 2UUBI 1AH6A 4XDMA 3RKZA 1YETA 1S14A 3INXA 4ASGA 3PYDA 1UYCA 4MBCA 3R91A 4DZYA 4CE3A 1BYQA 3B25A 2GQ0A 4DV4I 4JI0E 2IOQA 2OI2A 5LMUE 2UU9E 4B3TE 1UEKA 5M4PA 3PYEA 4HACB 2YE9A 2VQFE 4AWQA 1KIJA 4U7OA 5D7DA 5BR8I 4DV1E 1UYGA 2YKJA 2JKIA 2Q8FA 1FI4A 4MP7A 4DV2I 4AWOA 4CWPA 3JAMQ 4LWGA 1H72C 4DV0E 5M4EA 4CWOA 1GKXA 4PL9A 4LF9I 4JI1E 4DV6I 4FWGA 3B27A 4DUZE 3R92A 3VHDA 3Q6NA 4K0KE 2GFDA 2HCHA 4KP4A 4KSHA 1Y4SA 2YGEA 1Y8NA 3A0YA 1IBMI 4CWSA 3B8HA 2UXBE 1UY9A 3HYZA 2ZDXA 2YKEA 3K97A 2GQPA 4DV3I 5GGZA 2WEQA 3BMYA 1H73A 2BU8A 1USUA 1TBWA 5LMNI 2DEJA 2O1UA 1YERA 5IWAI 3J80Q 5IT9Q 3PYGA 4XIRA 5IN9A 2XJJA 2YE6A 2ZDYA 4YKXA 3TZ4A 4CWFA 1FJGE 2XJXA 4Q20A 4NXNI 1ELOA 1XNQE 1B62A 3OTOI 2J7KA 1KZNA 5C93A 2E5LI 1Z59A 2CCSA 4USMA 2YEIA 2O1WA 4LPBA 1HK7A 4MPNA 4HYMA 4YHHE 4MOTA 4DR4E 2WI5A 2H55A 2XABA 2XDXA 3SL2A 3IEDA 4DR1E 1H74A 3ZZ0A 1N0VC 2XD6A 1FWLA 2Z5CB 2YK9A 4LFAE 5GMDA 4X62I 1IBKI 3R4OA 4LWHA 4P8OA 2JJCA 2X36A 2IOPA 4JI8I 2UUCI 3T1YE 4CWNA 5FLXC 1R62A 1UYFA 3B26A 4XD8A 3JZ3A 3J81Q 2IORA 4IZKA 4LF8I 1WUUA 2F4VI 1HR0E 4V25A 4H85A 2A2DA 2Q2EB 2XX2A 3GIFA 4OX9E 3A0WA 3T0HA 3A0XA 3R4NA 2EFGA 1N33E 4GEEA 1TH8A 1N36I 2V8PA 2K5BA 3CGZA 3GIEA 4HXWA 2AJ4A 3NMQA 4P52A 2VF3A 4NXMI 1YC3A 2XDKA 3GIGB 1DARA 3WU5A 4JI6I 4KQVA 4U7NA 4UROA 4XCLA 1USVA 4DV5E 4DR5E 1AMWA 1UYHA 5CPHA 3T2SA 1ZM4A 3GONA 1TIDA 1HNZE 4H81A 4B3SI 2WI1A 4LF5E 3EHJA 4LF4I 2YE5A 2XDUA 2HHHI 1YSZA 2H8MA 4HXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FWY A;  4YKY A;  3R4M A;  3O0I A;  2BM0 A;  3TZ0 A;  4CWQ A;  4R1F A;  4DR3 E;  2WI7 A;  4KHP E;  5J71 A;  1BKN A;  4JI5 E;  4X65 I;  2WEP A;  5L3J A;  1N32 E;  1OJ4 A;  1OSF A;  2EXL A;  4QPJ A;  1UYM A;  1YC1 A;  2V34 A;  4MB9 A;  3VHA A;  4DUY E;  2LJP A;  2CGF A;  4JAU A;  1YT1 A;  4EGH A;  3JAM C;  4AQY E;  4JI2 E;  3B28 A;  1Z5A A;  2V2V A;  1ZW9 A;  3CGY A;  2ZM6 E;  1HNX I;  1XNR E;  2BT0 A;  4QPK A;  2WI4 A;  2YGF A;  4DUH A;  2WW4 A;  2XHR A;  2UUA I;  4R3A A;  4L93 A;  5M4N A;  2CH4 A;  1Y8P A;  1QYE A;  3U67 A;  1A6F A;  3WHA A;  5FND A;  3U2K A;  3HUL A;  1EI1 A;  2C2A A;  4WUD A;  4JI0 I;  5LMU I;  4GKK E;  2UU9 I;  1I58 A;  4BAE A;  4B3T I;  1FNM A;  3B82 A;  2YEH A;  2YE8 A;  2YI5 A;  3T1H I;  3T10 A;  2R42 A;  2VQF I;  4LWF A;  2V2Z A;  3TZ5 A;  4B7P A;  4JI4 E;  4FPP A;  4HZ0 A;  4URM A;  4DV1 I;  4EGK A;  4E00 A;  4LF6 E;  4JYA E;  3J80 C;  5IT9 C;  2YI0 A;  5M4M A;  4X9L A;  5J6A A;  4NH9 A;  4PRV A;  4EMD A;  1J5E E;  4DV0 I;  1Z0G A;  2QG2 A;  2WI2 A;  2XHT A;  3WU4 A;  1ZM3 A;  5F3K A;  3HYY A;  1XHK A;  1H7S A;  4JI1 I;  3D36 A;  1ID0 A;  4CE2 A;  4DUZ I;  4K0K I;  4JI3 E;  4U93 A;  3RLP A;  5FWK A;  4JQL A;  1B63 A;  1Z5C A;  1ZXN A;  3A0T A;  1Z0T A;  2BU7 A;  4XIP A;  4WUB A;  1I94 E;  5D7C A;  4LWI A;  4DPU A;  1YC4 A;  4B3R E;  1NZ0 A;  4JV5 E;  2UXB I;  4O09 A;  1UYD A;  4FCR A;  2X7I A;  3K60 A;  3D0B A;  1I5D A;  2BYI A;  4CE1 A;  2YJX A;  4EMV A;  1S4E A;  3WU6 A;  3INW A;  1BXD A;  4MPC A;  1TC0 A;  3B24 A;  2V2Q A;  2XDS A;  3ZXQ A;  2WI6 A;  2BU5 A;  5LMN E;  3K17 A;  4GKJ E;  3VAD A;  1QZR A;  4KFG A;  1FJG I;  1YES A;  4ASA A;  1QY8 A;  3V2U C;  2XCM A;  2A2C A;  1HNW E;  4LFC E;  3ZZU A;  4ED4 A;  2YGA A;  4DXL A;  4YKR A;  1AJ6 A;  2WER A;  1N34 E;  3C11 A;  1UY7 A;  4UTG A;  1XMO E;  1YT2 A;  4DR4 I;  3MNR P;  4CWT A;  4YKZ A;  5D6Q A;  2YEE A;  2AKP A;  3PEH A;  3WU3 A;  4LF7 E;  4AWP A;  4LFA I;  1XMQ E;  3EHG A;  4MP2 A;  2BU2 A;  4JI7 E;  1S16 A;  4Z7Y A;  4MYU A;  4GGL A;  4ZKI A;  1H7U A;  4XTJ A;  1IBK E;  3T1Y I;  5M4H A;  2FXS A;  4O04 A;  4O05 A;  2XEX A;  4B6C A;  1GKZ A;  2YKC A;  4R3M A;  3O6O A;  4KSG A;  1NHH A;  1Z0V A;  3J7A G;  5F5R A;  1HR0 I;  2UXD E;  5A2Q Q;  1FWK A;  4M1K A;  4LF8 E;  1UYE A;  1MU5 A;  1Y8O A;  4OX9 I;  5GME A;  4XC0 A;  2HK3 A;  3D4J A;  4EM7 A;  1MX0 A;  2XK2 A;  3LPS A;  4PU9 A;  4USK A;  1RRE A;  1N33 I;  3C0E A;  4FWD A;  4XKK A;  5LL6 R;  4X64 E;  2HFU A;  2HKJ A;  2YE3 A;  1IBL E;  1TC6 A;  1YT0 A;  2ZKJ A;  1THN A;  5FNF A;  3K99 A;  3RLQ A;  3TZ2 A;  4YY3 E;  4I5S A;  4L94 A;  2YKI A;  4DV5 I;  4DR5 I;  2UXC E;  5CTY A;  4XIQ A;  4X66 I;  5FLX Q;  2BRE A;  4DR7 E;  4JAV A;  1HNZ I;  4GQT A;  4BIU A;  4LF5 I;  1U2R A;  4B3M E;  4LFB E;  4DR6 E;  3KE6 A;  1UYL A;  4L90 A;  2O1V A;  3HHU A;  4LP0 A;  3ZKD A;  2QFO A;  4PRX A;  3Q5J A;  2Q8I A;  4GCZ A;  2YE7 A;  4HY6 A;  4DR3 I;  3FV5 A;  4KHP I;  2XJG A;  4ASF A;  4JG4 A;  4JI5 I;  3QT8 A;  1N32 I;  1BGQ A;  4DV7 E;  4K4O A;  2PNR A;  4JAS A;  3Q5K A;  3G75 A;  4E02 A;  1NHI A;  2YED A;  3CRK A;  4Z7C A;  3U2D A;  4DUY I;  4DR2 E;  1I5B A;  4AQY I;  4JI2 I;  2ZBK B;  3ZZT A;  2VQE E;  2UUB E;  1YSR A;  4MPE A;  3D2R A;  2ZM6 I;  2YK2 A;  1XNR I;  5CTW A;  4P7A A;  1Z0E A;  1A4H A;  1UYK A;  4NH7 A;  4HY1 A;  1HNX E;  4HYP A;  4ASB A;  1ZM9 A;  3LNU A;  2HFS A;  4DV4 E;  4AS9 A;  5FNC A;  3A0Z A;  5M4K A;  1K47 A;  4DU7 A;  4GKK I;  1YS3 A;  4URL A;  3HEK A;  3R4P A;  4BQG A;  1ZWH A;  2UWD A;  1N0U A;  5BR8 E;  3OW6 A;  4L91 A;  3OWB A;  2QF6 A;  4DV2 E;  4JI4 I;  4I3H A;  4LF6 I;  4JYA I;  3OMU A;  3ZM7 A;  3T1H E;  2CZ9 A;  1D6T A;  4LF9 E;  4DV6 E;  4H7Q A;  3T0Z A;  2VW5 A;  1J5E I;  4XKA A;  3VHC A;  3BM9 A;  1PVG A;  5D7R A;  2VWC A;  4JI3 I;  1AM1 A;  2BM1 A;  4YKQ A;  3EHH A;  2R3V A;  1IBM E;  2YJW A;  3TUH A;  2GS8 A;  3H80 A;  1KTV A;  2BYH A;  1I94 I;  1US7 A;  2IWS A;  4BXI A;  2BTZ A;  2YI6 A;  5CF0 A;  5IDJ A;  4DV3 E;  3M6A A;  4B3R I;  4FMT A;  3GIG A;  2YEF A;  4JV5 I;  2YKB A;  5BOD A;  3LTO A;  5IWA E;  4XCJ A;  1NHJ A;  4MYT A;  3J81 C;  4GFN A;  2XHX A;  4YKU A;  2YEJ A;  1JM6 A;  1UY6 A;  1XNQ I;  3K1J A;  4DPY A;  4NXN E;  4DPX A;  4GKJ I;  5IDM A;  3OTO E;  3K98 A;  3EKR A;  3F0N A;  1KKH A;  2E5L E;  1B3Q A;  3G7B A;  3HZ1 A;  2VCI A;  5BOC A;  4YHH I;  1VIS A;  1GJV A;  3B78 A;  1HNW I;  4LFC I;  2DEI A;  5A2Q C;  4DR1 I;  3EHF A;  3PEJ A;  4DPT A;  3HZ5 A;  4EEH A;  1I59 A;  4EGI A;  3CWV A;  2NPF A;  3QTF A;  2HK2 A;  4UT4 A;  1N34 I;  1ZXM A;  1XMO I;  2YEG A;  4YKT A;  3ZXO A;  4LWE A;  4EFU A;  1ZM2 A;  4X62 E;  2XX4 A;  4FWH A;  2YE4 A;  4XE2 A;  2YE2 A;  4FW9 A;  2IWU A;  4FCP A;  4GT8 A;  4LF7 I;  2BV3 A;  4JI8 E;  2CG9 A;  2UUC E;  1XMQ I;  3A0R A;  2ZIT A;  2IWX A;  4JI7 I;  3OWD A;  3QT6 A;  3PYF A;  4EFT A;  4W7T A;  3CRL A;  2F4V E;  1I5C A;  2BZ5 A;  1Y4U A;  4RPF A;  1UY8 A;  4WUC A;  4CWR A;  4HAC A;  2FYP A;  2Q8H A;  1PIE A;  3Q5L A;  2UXD I;  1MG7 A;  1Z0W A;  5CTU A;  2BSM A;  3RLR A;  3O2F A;  3FT8 A;  1N36 E;  1EA6 A;  4E01 A;  4DPW A;  1L0O A;  3WQ9 A;  4X64 I;  1U0Z A;  4NXM E;  4XIT A;  1U2O A;  1IBL I;  2XX5 A;  4KTN A;  1FKA E;  3H4L A;  4DU8 A;  4JI6 E;  3Q1Q A;  4L8Z A;  4URN A;  4O07 A;  4YY3 I;  2YEA A;  3DGE A;  1I5A A;  4FN5 A;  4XKO A;  2VCJ A;  3ZKB A;  2CCT A;  2BU6 A;  2UXC I;  3FT5 A;  4B3S E;  2Q8G A;  4LF4 E;  4HZ5 A;  1Z0B A;  2E0A A;  4DR7 I;  2HHH E;  5D6P A;  4X66 E;  4YKW A;  4B3M I;  3QDD A;  3T1K A;  3TTZ A;  4LFB I;  4DR6 I;  2XDL A;  3J7A M;  1AH8 A;  3G7E A;  1UYI A;  2QG0 A;  1TIL A;  3V5R A;  3OPD A;  3QT7 A;  1PKP A;  4X65 E;  4BIZ A;  1Z0C A;  3QT5 A;  4V26 A;  2E1R A;  4O0B A;  5CTX A;  2FWZ A;  2HKE A;  4FCQ A;  2HG1 A;  2YEC A;  4NH8 A;  4DV7 I;  1RR9 A;  3EKO A;  1Z5B A;  2BRC A;  2WI3 A;  4BQJ A;  1KVK A;  4ZVI A;  4DR2 I;  2CCU A;  2YEB A;  2ESA A;  2UUA E;  2YI7 A;  2VQE I;  2UUB I;  1AH6 A;  4XDM A;  3RKZ A;  1YET A;  1S14 A;  3INX A;  4ASG A;  3PYD A;  1UYC A;  4MBC A;  3R91 A;  4DZY A;  4CE3 A;  1BYQ A;  3B25 A;  4DV4 I;  4JI0 E;  5LMU E;  2OI2 A;  2IOQ A;  2UU9 E;  4B3T E;  1UEK A;  5M4P A;  3PYE A;  4HAC B;  2YE9 A;  2VQF E;  4AWQ A;  1KIJ A;  4U7O A;  5D7D A;  5BR8 I;  4DV1 E;  1UYG A;  2YKJ A;  2JKI A;  2Q8F A;  1FI4 A;  4MP7 A;  4DV2 I;  4AWO A;  4CWP A;  3JAM Q;  4LWG A;  1H72 C;  4DV0 E;  5M4E A;  4CWO A;  1GKX A;  4PL9 A;  4LF9 I;  4JI1 E;  4DV6 I;  4FWG A;  3B27 A;  4DUZ E;  3R92 A;  3VHD A;  4K0K E;  2GFD A;  2HCH A;  4KP4 A;  4KSH A;  1Y4S A;  2YGE A;  1Y8N A;  3A0Y A;  1IBM I;  4CWS A;  3B8H A;  2UXB E;  1UY9 A;  3HYZ A;  2ZDX A;  2YKE A;  3K97 A;  2GQP A;  4DV3 I;  5GGZ A;  2WEQ A;  3BMY A;  1H73 A;  2BU8 A;  1TBW A;  5LMN I;  2DEJ A;  1YER A;  2O1U A;  5IWA I;  3J80 Q;  5IT9 Q;  3PYG A;  4XIR A;  5IN9 A;  2XJJ A;  2YE6 A;  2ZDY A;  4YKX A;  3TZ4 A;  4CWF A;  1FJG E;  2XJX A;  4Q20 A;  4NXN I;  1ELO A;  1XNQ E;  1B62 A;  3OTO I;  2J7K A;  1KZN A;  5C93 A;  2E5L I;  1Z59 A;  2CCS A;  4USM A;  2YEI A;  2O1W A;  4LPB A;  4MPN A;  4HYM A;  4YHH E;  4MOT A;  4DR4 E;  2WI5 A;  2H55 A;  2XAB A;  2XDX A;  3SL2 A;  3IED A;  4DR1 E;  1H74 A;  3ZZ0 A;  1N0V C;  2XD6 A;  1FWL A;  2YK9 A;  4LFA E;  5GMD A;  4X62 I;  1IBK I;  3R4O A;  4LWH A;  4P8O A;  2JJC A;  2X36 A;  2IOP A;  4JI8 I;  2UUC I;  3T1Y E;  4CWN A;  5FLX C;  1R62 A;  1UYF A;  3B26 A;  4XD8 A;  3JZ3 A;  3J81 Q;  2IOR A;  4LF8 I;  1WUU A;  2F4V I;  1HR0 E;  4V25 A;  4H85 A;  2A2D A;  2Q2E B;  2XX2 A;  3GIF A;  4OX9 E;  3A0W A;  3T0H A;  3A0X A;  3R4N A;  2EFG A;  1N33 E;  4GEE A;  1TH8 A;  1N36 I;  2V8P A;  2K5B A;  3CGZ A;  3GIE A;  4HXW A;  2AJ4 A;  3NMQ A;  4P52 A;  2VF3 A;  4NXM I;  1YC3 A;  2XDK A;  3GIG B;  1DAR A;  3WU5 A;  4JI6 I;  4KQV A;  4U7N A;  4URO A;  4XCL A;  4DV5 E;  4DR5 E;  1UYH A;  1AMW A;  5CPH A;  3T2S A;  1ZM4 A;  3GON A;  1TID A;  1HNZ E;  4H81 A;  4B3S I;  2WI1 A;  4LF5 E;  3EHJ A;  4LF4 I;  2YE5 A;  2XDU A;  2HHH I;  1YSZ A;  2H8M A;  4HXZ A; 
#chains in the Genus database with same CATH topology
 2FWY A;  4YKY A;  3R4M A;  1R6M A;  2BR2 B;  3O0I A;  2BM0 A;  2AE8 A;  3TZ0 A;  4R1F A;  4CWQ A;  4N3O A;  4DR3 E;  2WI7 A;  4KHP E;  5J71 A;  1BKN A;  4JI5 E;  4X65 I;  2WEP A;  5L3J A;  1N32 E;  2PNL A;  1OJ4 A;  1P42 A;  1OSF A;  2EXL A;  4OKG A;  4OO1 F;  4QPJ A;  1UYM A;  1YC1 A;  2V34 A;  4MB9 A;  3VHA A;  4DUY E;  2LJP A;  2CGF A;  4JAU A;  1YT1 A;  4EGH A;  3JAM C;  4AQY E;  4JI2 E;  4GQU A;  3B28 A;  1Z5A A;  2V2V A;  1ZW9 A;  3CGY A;  2ZM6 E;  1HNX I;  1XNR E;  2BT0 A;  4QPK A;  2WI4 A;  4BA1 A;  2YGF A;  2WW4 A;  2BA1 D;  4DUH A;  2XHR A;  2UUA I;  4R3A A;  4L93 A;  5M4N A;  2CH4 A;  1Y8P A;  2GO4 A;  1QYE A;  1A6F A;  2JE6 A;  3U67 A;  5C0X F;  3WHA A;  4LOM A;  5FND A;  3U2K A;  4IFD F;  3HUL A;  1EI1 A;  2C2A A;  4WUD A;  4JI0 I;  5LMU I;  2Z5E A;  2C37 B;  4IZK B;  2UU9 I;  4GKK E;  1I58 A;  4BAE A;  4QNK A;  4B3T I;  1FNM A;  3B82 A;  2YEH A;  2YE8 A;  2YI5 A;  5F3K A;  3T1H I;  3L7Z B;  3T10 A;  2R42 A;  2VQF I;  4LWF A;  2V2Z A;  3TZ5 A;  4B7P A;  4JI4 E;  4FPP A;  4HZ0 A;  4URM A;  4DV1 I;  2Z5B B;  4E00 A;  4LF6 E;  4JYA E;  4EGK A;  3J80 C;  5IT9 C;  2YI0 A;  5M4M A;  4X9L A;  5J6A A;  4NH9 A;  4PRV A;  5JEA B;  4EMD A;  2CGE A;  1J5E E;  5JEA F;  4DV0 I;  1Z0G A;  2QG2 A;  2WI2 A;  3PRY A;  3WU4 A;  1ZM3 A;  2XHT A;  3HYY A;  1XHK A;  1H7S A;  4JI1 I;  5DRO A;  1ID0 A;  3D36 A;  4DUZ I;  4K0K I;  4JI3 E;  4U93 A;  3RLP A;  5FWK A;  4JQL A;  1B63 A;  1Z5C A;  1ZXN A;  3A0T A;  1Z0T A;  2BU7 A;  4XIP A;  4WUB A;  4MU4 A;  1I94 E;  3HKM A;  5D7C A;  4LWI A;  5K36 C;  4DPU A;  1YC4 A;  4B3R E;  4AIM A;  2PO2 A;  1NZ0 A;  4JV5 E;  2UXB I;  4O09 A;  1UYD A;  4FCR A;  2X7I A;  3K60 A;  3S5T A;  1YHC A;  1I5D A;  2BYI A;  3D0B A;  2YJX A;  4CE1 A;  4EMV A;  1S4E A;  3WU6 A;  3INW A;  1BXD A;  4MPC A;  1TC0 A;  3B24 A;  2V2Q A;  2XDS A;  3ZXQ A;  3U1Y A;  1Y60 A;  2BU5 A;  2WI6 A;  1RHY A;  5LMN E;  3K17 A;  4BA2 A;  4GKJ E;  3VAD A;  4IZJ A;  4IS9 A;  1QZR A;  4QNJ A;  1FJG I;  4KFG A;  1YES A;  4ASA A;  1QY8 A;  3V2U C;  2XCM A;  2A2C A;  1HNW E;  4LFC E;  3ZZU A;  4ED4 A;  2YGA A;  4DXL A;  4YKR A;  2PNM A;  1AJ6 A;  2WER A;  1N34 E;  3C11 A;  1UY7 A;  4UTG A;  1XMO E;  1YT2 A;  4DR4 I;  3MNR P;  4CWT A;  4YKZ A;  1UDS A;  5D6Q A;  1OYP A;  2NN6 D;  2YEE A;  2AKP A;  4IZJ D;  3PEH A;  3WU3 A;  2C39 A;  4LF7 E;  4AWP A;  4LFA I;  1XMQ E;  3EHG A;  4MP2 A;  2JE6 B;  2BU2 A;  4JI7 E;  1S16 A;  4Z7Y A;  4MYU A;  4GGL A;  4ZKI A;  2PO0 A;  1H7U A;  4XTJ A;  1IBK E;  3T1Y I;  5M4H A;  2FXS A;  4O04 A;  2JEB A;  4O05 A;  2XEX A;  4B6C A;  1GKZ A;  4MU1 A;  2YKC A;  4R3M A;  3O6O A;  4KSG A;  1NHH A;  1Z0V A;  3J7A G;  5F5R A;  1HR0 I;  2UXD E;  5A2Q Q;  1FWK A;  4M1K A;  4LF8 E;  1UYE A;  1MU5 A;  5C0X A;  4OX9 I;  5GME A;  5K36 F;  1Y8O A;  4XC0 A;  2HK3 A;  3D4J A;  4EM7 A;  1MX0 A;  2XK2 A;  3LPS A;  4PU9 A;  4USK A;  1RRE A;  1N33 I;  3C0E A;  4FWD A;  4XKK A;  5LL6 R;  5ELW A;  4X64 E;  2HFU A;  2HKJ A;  2YE3 A;  1IBL E;  1TC6 A;  1YT0 A;  2ZKJ A;  3KRN A;  1THN A;  5FNF A;  3K99 A;  3RLQ A;  1F51 A;  4MU0 A;  3TZ2 A;  4YY3 E;  4I5S A;  4L94 A;  2YKI A;  5C0X D;  4DV5 I;  4DR5 I;  2UXC E;  3PS3 A;  2PO2 B;  4XIQ A;  4X66 I;  5CTY A;  5FLX Q;  2BRE A;  4DR7 E;  4JAV A;  1HNZ I;  4GQT A;  4BIU A;  4LF5 I;  5C0X E;  1U2R A;  4B3M E;  4LFB E;  4DR6 E;  3KE6 A;  4FW7 A;  1UYL A;  4L90 A;  2O1V A;  3HHU A;  4LP0 A;  4BA2 B;  3ZKD A;  4IZJ B;  2QFO A;  4PRX A;  3Q5J A;  2Q8I A;  4GCZ A;  4ISA A;  2YE7 A;  1E3P A;  1E3H A;  4U3B A;  4HY6 A;  4DR3 I;  3FV5 A;  4KHP I;  2XJG A;  4ASF A;  4JG4 A;  4JI5 I;  3QT8 A;  3GLL A;  4FW3 A;  1N32 I;  1BGQ A;  4DV7 E;  4K4O A;  2PNR A;  4JAS A;  3Q5K A;  3G75 A;  4E02 A;  1NHI A;  2WNR A;  2YED A;  4Z7C A;  3CRK A;  4DUY I;  4DR2 E;  3U2D A;  1I5B A;  4AQY I;  4JI2 I;  2ZBK B;  3Q6M A;  4J3D A;  3ZZT A;  2VQE E;  2UUB E;  1YSR A;  4MPE A;  3D2R A;  2ZM6 I;  2YK2 A;  1XNR I;  2C38 B;  5CTW A;  2C39 B;  2C1G A;  4P7A A;  1Z0E A;  1A4H A;  1UYK A;  3GME A;  4NH7 A;  3CDI A;  4HY1 A;  1HNX E;  4HYP A;  4ASB A;  1ZM9 A;  3LNU A;  2HFS A;  2PNZ A;  2PO0 B;  4DV4 E;  4AS9 A;  4CE2 A;  5FNC A;  2JEB B;  3A0Z A;  5M4K A;  1K47 A;  3PS2 A;  4DU7 A;  4GKK I;  2C1I A;  1YS3 A;  4URL A;  3HEK A;  3R4P A;  4BQG A;  5DRR A;  1ZWH A;  4MQY A;  2UWD A;  1N0U A;  5BR8 E;  3OW6 A;  4L91 A;  3OWB A;  2QF6 A;  4DV2 E;  4LCF A;  4JI4 I;  4I3H A;  4LF6 I;  4JYA I;  3OMU A;  3ZM7 A;  3T1H E;  2O3Z A;  2CZ9 A;  4LCG A;  4LF9 E;  1D6T A;  4DV6 E;  4H7Q A;  3T0Z A;  2HHI A;  2VW5 A;  1J5E I;  4XKA A;  3DD6 A;  2F1D A;  3VHC A;  3BM9 A;  1PVG A;  5D7R A;  3M7N D;  2VWC A;  4JI3 I;  1AM1 A;  2BM1 A;  2CVE A;  4AM3 A;  4YKQ A;  3EHH A;  2R3V A;  2BA1 G;  1IBM E;  2YJW A;  3TUH A;  2GS8 A;  3H80 A;  1KTV A;  2BYH A;  1I94 I;  1US7 A;  2IWS A;  4BXI A;  2BTZ A;  2YI6 A;  5CF0 A;  5IDJ A;  4DV3 E;  3M6A A;  1Y6Z A;  4B3R I;  4FMT A;  3GIG A;  2YEF A;  4JV5 I;  2BA0 D;  2YKB A;  2NN6 A;  5BOD A;  3LTO A;  5IWA E;  4XCJ A;  1NHJ A;  4MYT A;  3J81 C;  4GFN A;  2XHX A;  4YKU A;  2YEJ A;  1JM6 A;  1UY6 A;  1XNQ I;  3K1J A;  1XXE A;  4DPY A;  4NXN E;  4DPX A;  4GKJ I;  3U1K A;  3OTO E;  5IDM A;  3K98 A;  3EKR A;  3F0N A;  1KKH A;  2E5L E;  1B3Q A;  3G7B A;  3HZ1 A;  2VCI A;  5BOC A;  4YHH I;  5JEN A;  1VIS A;  2O1T A;  1GJV A;  3B78 A;  2BR2 A;  5DNL A;  4LFC I;  2DEI A;  1HNW I;  5A2Q C;  4DR1 I;  5DNX A;  3EHF A;  4DPT A;  3HZ5 A;  3PEJ A;  4EEH A;  1I59 A;  4EGI A;  3CWV A;  4BA1 B;  2NPF A;  3QTF A;  2HK2 A;  2NN6 C;  4UT4 A;  1N34 I;  1ZXM A;  1XMO I;  2YEG A;  3M7N G;  4YKT A;  4LWE A;  3ZXO A;  4EFU A;  1ZM2 A;  4OO1 A;  2NN6 E;  1UDO A;  4X62 E;  2XX4 A;  4AID A;  4FWH A;  2YE4 A;  5EL9 A;  4XE2 A;  5EKW A;  2YE2 A;  4FW9 A;  2IWU A;  4FCP A;  4GT8 A;  2CG9 A;  2BV3 A;  4JI8 E;  4LF7 I;  2UUC E;  1XMQ I;  1VI7 A;  2IES A;  3A0R A;  2ZIT A;  3P06 A;  2IWX A;  4JI7 I;  2PNZ B;  3QT6 A;  3HJC A;  3OWD A;  3PYF A;  4EFT A;  4W7T A;  3CRL A;  2BA0 G;  2F4V E;  1I5C A;  2BZ5 A;  2WP8 A;  4MDT A;  1Y4U A;  4RPF A;  1UY8 A;  4WUC A;  4IFD A;  4CWR A;  4HAC A;  2FYP A;  2Q8H A;  1PIE A;  3Q5L A;  2UXD I;  4OO1 D;  1MG7 A;  1Z0W A;  5CTU A;  3CDJ A;  2BSM A;  1UDN A;  3RLR A;  3O2F A;  3FT8 A;  1N36 E;  1EA6 A;  4E01 A;  3L7Z A;  4OO1 E;  4DPW A;  1L0O A;  3WQ9 A;  4X64 I;  1U0Z A;  2Z5B A;  4NXM E;  4XIT A;  4FW5 A;  1U2O A;  1IBL I;  2XX5 A;  4KTN A;  5JEA A;  1FKA E;  5C0X C;  1Y5Y A;  3H4L A;  1UDQ A;  4DU8 A;  4JI6 E;  3Q1Q A;  4IFD D;  4L8Z A;  4URN A;  4O07 A;  4YY3 I;  2YEA A;  3DGE A;  1I5A A;  4FN5 A;  3H1C A;  4XKO A;  2VCJ A;  3ZKB A;  2CCT A;  2BU6 A;  2UXC I;  4IFD E;  3FT5 A;  4B3S E;  2Q8G A;  4LF4 E;  4HZ5 A;  1Z0B A;  2E0A A;  2NN6 B;  2HHH E;  2JT2 A;  4DR7 I;  5D6P A;  4X66 E;  4YKW A;  3UHM A;  4B3M I;  3QDD A;  3T1K A;  3P3C A;  3TTZ A;  4LFB I;  3GCM A;  4DR6 I;  5JEA D;  4U3D A;  2PO1 A;  2XDL A;  3J7A M;  1AH8 A;  3G7E A;  1UYI A;  2QG0 A;  1R6L A;  1TIL A;  3K85 A;  3V5R A;  3OPD A;  3QT7 A;  1PKP A;  5JEA E;  4X65 E;  4BIZ A;  1Z0C A;  3QT5 A;  4V26 A;  2E1R A;  4O0B A;  5CTX A;  2FWZ A;  2HKE A;  4FCQ A;  2HG1 A;  1OYR A;  2YEC A;  4NH8 A;  2GO3 A;  4DV7 I;  1RR9 A;  3EKO A;  2JEA A;  1Z5B A;  2BRC A;  2WI3 A;  4BQJ A;  1KVK A;  4ZVI A;  4DR2 I;  4OO1 B;  2CCU A;  2Z5C A;  2YEB A;  2ESA A;  2UUA E;  2YI7 A;  2VQE I;  2UUB I;  1AH6 A;  4XDM A;  3RKZ A;  1YET A;  2J65 A;  1S14 A;  3INX A;  4ASG A;  3PYD A;  1UYC A;  4MBC A;  3R91 A;  4DZY A;  4CE3 A;  1BYQ A;  4LCH A;  3B25 A;  2GQ0 A;  2VES A;  4DV4 I;  2IOQ A;  2OI2 A;  5LMU E;  2UU9 E;  4JI0 E;  5C0X B;  4B3T E;  2WP8 B;  1UEK A;  4IFD B;  5M4P A;  3PYE A;  4HAC B;  2YE9 A;  2VQF E;  4AWQ A;  1KIJ A;  4U7O A;  5D7D A;  5BR8 I;  4DV1 E;  1UYG A;  2YKJ A;  2JKI A;  4MU3 A;  1FI4 A;  4MP7 A;  4DV2 I;  2Q8F A;  4AWO A;  4CWP A;  3JAM Q;  4LWG A;  1H72 C;  4DV0 E;  5M4E A;  4CWO A;  5K36 A;  1GKX A;  4PL9 A;  4LF9 I;  4JI1 E;  4DV6 I;  4FWG A;  3B27 A;  4FW4 A;  4DUZ E;  3R92 A;  3VHD A;  3Q6N A;  4K0K E;  3P3E A;  2GFD A;  2HCH A;  4KP4 A;  4KSH A;  3PS1 A;  1Y4S A;  2YGE A;  1Y8N A;  3A0Y A;  1IBM I;  4CWS A;  3B8H A;  2UXB E;  1UY9 A;  3HYZ A;  2ZDX A;  2YKE A;  3K97 A;  2GQP A;  4DV3 I;  5GGZ A;  2WEQ A;  2IER A;  3BMY A;  1H73 A;  5K36 D;  2BU8 A;  1USU A;  1TBW A;  5LMN I;  2DEJ A;  2O1U A;  1YER A;  5IWA I;  3J80 Q;  5IT9 Q;  3M85 D;  3PYG A;  4XIR A;  5IN9 A;  2XJJ A;  2PO1 B;  2YE6 A;  2ZDY A;  4YKX A;  3TZ4 A;  5K36 E;  4CWF A;  1FJG E;  2XJX A;  3B4T A;  4Q20 A;  4NXN I;  1ELO A;  3CYG A;  1XNQ E;  1B62 A;  3OTO I;  2J7K A;  1KZN A;  5C93 A;  2E5L I;  1Z59 A;  2WNR B;  2CCS A;  4USM A;  5DRP A;  2O1W A;  2YEI A;  4LPB A;  1HK7 A;  4MPN A;  4HYM A;  4YHH E;  4MOT A;  4DR4 E;  2WI5 A;  2H55 A;  2XAB A;  2XDX A;  3SL2 A;  2JEA B;  3IED A;  4DR1 E;  1H74 A;  3ZZ0 A;  4E72 A;  1N0V C;  2XD6 A;  2FTK A;  1FWL A;  2Z5C B;  2YK9 A;  4LFA E;  5GMD A;  4X62 I;  1IBK I;  3R4O A;  4LWH A;  4P8O A;  2JJC A;  2X36 A;  2IOP A;  4JI8 I;  2UUC I;  3T1Y E;  3NZK A;  4CWN A;  5FLX C;  1R62 A;  1UYF A;  3B26 A;  4XD8 A;  4FW6 A;  3JZ3 A;  2C38 A;  3J81 Q;  4LPF A;  2IOR A;  2C37 A;  4IZK A;  4LF8 I;  4OO1 C;  1WUU A;  2F4V I;  1HR0 E;  4V25 A;  4H85 A;  2A2D A;  2Q2E B;  3M85 G;  2XX2 A;  3GIF A;  4OX9 E;  3A0W A;  3T0H A;  3A0X A;  3R4N A;  2EFG A;  1N33 E;  4GEE A;  1TH8 A;  1N36 I;  2V8P A;  5K36 B;  2K5B A;  3CGZ A;  3GIE A;  4HXW A;  3LMM A;  2AJ4 A;  3NMQ A;  4P52 A;  4IFD C;  2VF3 A;  5DRQ A;  1IXM A;  4NXM I;  1YC3 A;  2XDK A;  1YH8 A;  3GIG B;  1DAR A;  3P3G A;  3P76 A;  3WU5 A;  4JI6 I;  4KQV A;  4U7N A;  4URO A;  4XCL A;  1USV A;  4DV5 E;  4DR5 E;  1AMW A;  1UYH A;  5CPH A;  3T2S A;  1ZM4 A;  2NN6 F;  3GON A;  1TID A;  1HNZ E;  4H81 A;  4OZE A;  4B3S I;  4LF5 E;  2WI1 A;  3EHJ A;  5JEA C;  4LF4 I;  2YE5 A;  4NBQ A;  2XDU A;  2HHH I;  1YSZ A;  2H8M A;  1OYS A;  4HXZ A; 
#chains in the Genus database with same CATH homology
 2FWY A;  4YKY A;  3R4M A;  3O0I A;  2BM0 A;  3TZ0 A;  4CWQ A;  4R1F A;  4N3O A;  4DR3 E;  2WI7 A;  4KHP E;  5J71 A;  1BKN A;  4JI5 E;  4X65 I;  2WEP A;  5L3J A;  1N32 E;  2PNL A;  1OJ4 A;  1OSF A;  2EXL A;  4QPJ A;  1UYM A;  1YC1 A;  2V34 A;  4MB9 A;  3VHA A;  4DUY E;  2LJP A;  2CGF A;  4JAU A;  1YT1 A;  4EGH A;  3JAM C;  4AQY E;  4JI2 E;  3B28 A;  1Z5A A;  2V2V A;  1ZW9 A;  3CGY A;  2ZM6 E;  1HNX I;  1XNR E;  2BT0 A;  4QPK A;  2WI4 A;  2YGF A;  4DUH A;  2WW4 A;  2XHR A;  2UUA I;  4R3A A;  4L93 A;  5M4N A;  2CH4 A;  1Y8P A;  1QYE A;  3U67 A;  1A6F A;  3WHA A;  5FND A;  3U2K A;  3HUL A;  1EI1 A;  2C2A A;  4WUD A;  4JI0 I;  5LMU I;  2Z5E A;  4IZK B;  2UU9 I;  4GKK E;  1I58 A;  4BAE A;  4B3T I;  1FNM A;  3B82 A;  2YEH A;  2YE8 A;  2YI5 A;  3T1H I;  3T10 A;  2R42 A;  2VQF I;  4LWF A;  2V2Z A;  3TZ5 A;  4B7P A;  4JI4 E;  4FPP A;  4HZ0 A;  4URM A;  4DV1 I;  2Z5B B;  4E00 A;  4LF6 E;  4JYA E;  4EGK A;  3J80 C;  5IT9 C;  2YI0 A;  5M4M A;  4X9L A;  5J6A A;  4NH9 A;  4PRV A;  4EMD A;  2CGE A;  1J5E E;  4DV0 I;  1Z0G A;  2QG2 A;  2WI2 A;  3PRY A;  3WU4 A;  1ZM3 A;  2XHT A;  3HYY A;  1XHK A;  1H7S A;  4JI1 I;  3D36 A;  1ID0 A;  5F3K A;  4DUZ I;  4K0K I;  4JI3 E;  4U93 A;  3RLP A;  5FWK A;  4JQL A;  1B63 A;  1Z5C A;  1ZXN A;  3A0T A;  1Z0T A;  2BU7 A;  4XIP A;  4WUB A;  1I94 E;  5D7C A;  4LWI A;  4DPU A;  1YC4 A;  4B3R E;  1NZ0 A;  4JV5 E;  2UXB I;  4O09 A;  1UYD A;  4FCR A;  2X7I A;  3K60 A;  3D0B A;  1I5D A;  2BYI A;  4CE1 A;  2YJX A;  4EMV A;  1S4E A;  3WU6 A;  3INW A;  1BXD A;  4MPC A;  1TC0 A;  3B24 A;  2V2Q A;  2XDS A;  3ZXQ A;  2WI6 A;  2BU5 A;  5LMN E;  3K17 A;  4GKJ E;  3VAD A;  4IZJ A;  1QZR A;  4KFG A;  1FJG I;  1YES A;  4ASA A;  1QY8 A;  3V2U C;  2XCM A;  2A2C A;  1HNW E;  4LFC E;  3ZZU A;  4ED4 A;  2YGA A;  4DXL A;  4YKR A;  2PNM A;  1AJ6 A;  2WER A;  1N34 E;  3C11 A;  1UY7 A;  4UTG A;  1XMO E;  1YT2 A;  4DR4 I;  3MNR P;  4CWT A;  4YKZ A;  5D6Q A;  2YEE A;  2AKP A;  4IZJ D;  3PEH A;  3WU3 A;  4LF7 E;  4AWP A;  4LFA I;  1XMQ E;  3EHG A;  4MP2 A;  2BU2 A;  4JI7 E;  1S16 A;  4Z7Y A;  4MYU A;  4GGL A;  4ZKI A;  1H7U A;  4XTJ A;  1IBK E;  3T1Y I;  5M4H A;  2FXS A;  4O04 A;  4O05 A;  2XEX A;  4B6C A;  1GKZ A;  2YKC A;  4R3M A;  3O6O A;  4KSG A;  1NHH A;  1Z0V A;  3J7A G;  5F5R A;  1HR0 I;  2UXD E;  5A2Q Q;  1FWK A;  4M1K A;  4LF8 E;  1UYE A;  1MU5 A;  1Y8O A;  4OX9 I;  5GME A;  4XC0 A;  2HK3 A;  3D4J A;  4EM7 A;  1MX0 A;  2XK2 A;  3LPS A;  4PU9 A;  4USK A;  1RRE A;  1N33 I;  3C0E A;  4FWD A;  4XKK A;  5LL6 R;  4X64 E;  2HFU A;  2HKJ A;  2YE3 A;  1IBL E;  1TC6 A;  1YT0 A;  2ZKJ A;  1THN A;  5FNF A;  3K99 A;  3RLQ A;  3TZ2 A;  4YY3 E;  4I5S A;  4L94 A;  2YKI A;  4DV5 I;  4DR5 I;  2UXC E;  5CTY A;  4XIQ A;  4X66 I;  5FLX Q;  2BRE A;  4DR7 E;  4JAV A;  1HNZ I;  4GQT A;  4BIU A;  4LF5 I;  1U2R A;  4B3M E;  4LFB E;  4DR6 E;  3KE6 A;  1UYL A;  4L90 A;  2O1V A;  3HHU A;  4LP0 A;  3ZKD A;  4IZJ B;  2QFO A;  4PRX A;  3Q5J A;  2Q8I A;  4GCZ A;  2YE7 A;  4HY6 A;  4DR3 I;  3FV5 A;  4KHP I;  2XJG A;  4ASF A;  4JG4 A;  4JI5 I;  3QT8 A;  1N32 I;  1BGQ A;  4DV7 E;  4K4O A;  2PNR A;  4JAS A;  3Q5K A;  3G75 A;  4E02 A;  1NHI A;  2YED A;  3CRK A;  4Z7C A;  3U2D A;  4DUY I;  4DR2 E;  1I5B A;  4AQY I;  4JI2 I;  2ZBK B;  3Q6M A;  3ZZT A;  2VQE E;  2UUB E;  1YSR A;  4MPE A;  3D2R A;  2ZM6 I;  2YK2 A;  1XNR I;  5CTW A;  4P7A A;  1Z0E A;  1A4H A;  1UYK A;  4NH7 A;  4HY1 A;  1HNX E;  4HYP A;  4ASB A;  1ZM9 A;  3LNU A;  2HFS A;  4DV4 E;  4AS9 A;  4CE2 A;  5FNC A;  3A0Z A;  5M4K A;  1K47 A;  4DU7 A;  4GKK I;  1YS3 A;  4URL A;  3HEK A;  3R4P A;  4BQG A;  1ZWH A;  2UWD A;  1N0U A;  5BR8 E;  3OW6 A;  4L91 A;  3OWB A;  2QF6 A;  4DV2 E;  4JI4 I;  4I3H A;  4LF6 I;  4JYA I;  3OMU A;  3ZM7 A;  3T1H E;  2CZ9 A;  1D6T A;  4LF9 E;  4DV6 E;  4H7Q A;  3T0Z A;  2VW5 A;  1J5E I;  4XKA A;  3VHC A;  3BM9 A;  1PVG A;  5D7R A;  2VWC A;  4JI3 I;  1AM1 A;  2BM1 A;  4YKQ A;  3EHH A;  2R3V A;  1IBM E;  2YJW A;  3TUH A;  2GS8 A;  3H80 A;  1KTV A;  2BYH A;  1I94 I;  1US7 A;  2IWS A;  4BXI A;  2BTZ A;  2YI6 A;  5CF0 A;  5IDJ A;  4DV3 E;  3M6A A;  1Y6Z A;  4B3R I;  4FMT A;  3GIG A;  2YEF A;  4JV5 I;  2YKB A;  5BOD A;  3LTO A;  5IWA E;  4XCJ A;  1NHJ A;  4MYT A;  3J81 C;  4GFN A;  2XHX A;  4YKU A;  2YEJ A;  1JM6 A;  1UY6 A;  1XNQ I;  3K1J A;  4DPY A;  4NXN E;  4DPX A;  4GKJ I;  5IDM A;  3OTO E;  3K98 A;  3EKR A;  3F0N A;  1KKH A;  2E5L E;  1B3Q A;  3G7B A;  3HZ1 A;  2VCI A;  5BOC A;  4YHH I;  1VIS A;  2O1T A;  1GJV A;  3B78 A;  1HNW I;  4LFC I;  2DEI A;  5A2Q C;  4DR1 I;  3EHF A;  3PEJ A;  4DPT A;  3HZ5 A;  4EEH A;  1I59 A;  4EGI A;  3CWV A;  2NPF A;  3QTF A;  2HK2 A;  4UT4 A;  1N34 I;  1ZXM A;  1XMO I;  2YEG A;  4YKT A;  3ZXO A;  4LWE A;  4EFU A;  1ZM2 A;  4X62 E;  2XX4 A;  4FWH A;  2YE4 A;  4XE2 A;  2YE2 A;  4FW9 A;  2IWU A;  4FCP A;  4GT8 A;  2CG9 A;  2BV3 A;  4JI8 E;  4LF7 I;  2UUC E;  1XMQ I;  3A0R A;  2ZIT A;  3P06 A;  2IWX A;  4JI7 I;  3OWD A;  3QT6 A;  3HJC A;  3PYF A;  4EFT A;  4W7T A;  3CRL A;  2F4V E;  1I5C A;  2BZ5 A;  1Y4U A;  4RPF A;  1UY8 A;  4WUC A;  4CWR A;  4HAC A;  2FYP A;  2Q8H A;  1PIE A;  3Q5L A;  2UXD I;  1MG7 A;  1Z0W A;  5CTU A;  2BSM A;  3RLR A;  3O2F A;  3FT8 A;  1N36 E;  1EA6 A;  4E01 A;  4DPW A;  1L0O A;  3WQ9 A;  4X64 I;  1U0Z A;  2Z5B A;  4NXM E;  4XIT A;  1U2O A;  1IBL I;  2XX5 A;  4KTN A;  1FKA E;  3H4L A;  4DU8 A;  4JI6 E;  3Q1Q A;  4L8Z A;  4URN A;  4O07 A;  4YY3 I;  2YEA A;  3DGE A;  1I5A A;  4FN5 A;  4XKO A;  2VCJ A;  3ZKB A;  2CCT A;  2BU6 A;  2UXC I;  3FT5 A;  4B3S E;  2Q8G A;  4LF4 E;  4HZ5 A;  1Z0B A;  2E0A A;  4DR7 I;  2HHH E;  5D6P A;  4X66 E;  4YKW A;  4B3M I;  3QDD A;  3T1K A;  3TTZ A;  4LFB I;  4DR6 I;  2XDL A;  3J7A M;  1AH8 A;  3G7E A;  1UYI A;  2QG0 A;  1TIL A;  3K85 A;  3V5R A;  3OPD A;  3QT7 A;  1PKP A;  4X65 E;  4BIZ A;  1Z0C A;  3QT5 A;  4V26 A;  2E1R A;  4O0B A;  5CTX A;  2FWZ A;  2HKE A;  4FCQ A;  2HG1 A;  2YEC A;  4NH8 A;  4DV7 I;  1RR9 A;  3EKO A;  1Z5B A;  2BRC A;  2WI3 A;  4BQJ A;  1KVK A;  4ZVI A;  4DR2 I;  2CCU A;  2Z5C A;  2YEB A;  2ESA A;  2UUA E;  2YI7 A;  2VQE I;  2UUB I;  1AH6 A;  4XDM A;  3RKZ A;  1YET A;  1S14 A;  3INX A;  4ASG A;  3PYD A;  1UYC A;  4MBC A;  3R91 A;  4DZY A;  4CE3 A;  1BYQ A;  3B25 A;  2GQ0 A;  4DV4 I;  4JI0 E;  2IOQ A;  2OI2 A;  5LMU E;  2UU9 E;  4B3T E;  1UEK A;  5M4P A;  3PYE A;  4HAC B;  2YE9 A;  2VQF E;  4AWQ A;  1KIJ A;  4U7O A;  5D7D A;  5BR8 I;  4DV1 E;  1UYG A;  2YKJ A;  2JKI A;  2Q8F A;  1FI4 A;  4MP7 A;  4DV2 I;  4AWO A;  4CWP A;  3JAM Q;  4LWG A;  1H72 C;  4DV0 E;  5M4E A;  4CWO A;  1GKX A;  4PL9 A;  4LF9 I;  4JI1 E;  4DV6 I;  4FWG A;  3B27 A;  4DUZ E;  3R92 A;  3VHD A;  3Q6N A;  4K0K E;  2GFD A;  2HCH A;  4KP4 A;  4KSH A;  1Y4S A;  2YGE A;  1Y8N A;  3A0Y A;  1IBM I;  4CWS A;  3B8H A;  2UXB E;  1UY9 A;  3HYZ A;  2ZDX A;  2YKE A;  3K97 A;  2GQP A;  4DV3 I;  5GGZ A;  2WEQ A;  3BMY A;  1H73 A;  2BU8 A;  1USU A;  1TBW A;  5LMN I;  2DEJ A;  2O1U A;  1YER A;  5IWA I;  3J80 Q;  5IT9 Q;  3PYG A;  4XIR A;  5IN9 A;  2XJJ A;  2YE6 A;  2ZDY A;  4YKX A;  3TZ4 A;  4CWF A;  1FJG E;  2XJX A;  4Q20 A;  4NXN I;  1ELO A;  1XNQ E;  1B62 A;  3OTO I;  2J7K A;  1KZN A;  5C93 A;  2E5L I;  1Z59 A;  2CCS A;  4USM A;  2YEI A;  2O1W A;  4LPB A;  1HK7 A;  4MPN A;  4HYM A;  4YHH E;  4MOT A;  4DR4 E;  2WI5 A;  2H55 A;  2XAB A;  2XDX A;  3SL2 A;  3IED A;  4DR1 E;  1H74 A;  3ZZ0 A;  1N0V C;  2XD6 A;  1FWL A;  2Z5C B;  2YK9 A;  4LFA E;  5GMD A;  4X62 I;  1IBK I;  3R4O A;  4LWH A;  4P8O A;  2JJC A;  2X36 A;  2IOP A;  4JI8 I;  2UUC I;  3T1Y E;  4CWN A;  5FLX C;  1R62 A;  1UYF A;  3B26 A;  4XD8 A;  3JZ3 A;  3J81 Q;  2IOR A;  4IZK A;  4LF8 I;  1WUU A;  2F4V I;  1HR0 E;  4V25 A;  4H85 A;  2A2D A;  2Q2E B;  2XX2 A;  3GIF A;  4OX9 E;  3A0W A;  3T0H A;  3A0X A;  3R4N A;  2EFG A;  1N33 E;  4GEE A;  1TH8 A;  1N36 I;  2V8P A;  2K5B A;  3CGZ A;  3GIE A;  4HXW A;  2AJ4 A;  3NMQ A;  4P52 A;  2VF3 A;  4NXM I;  1YC3 A;  2XDK A;  3GIG B;  1DAR A;  3WU5 A;  4JI6 I;  4KQV A;  4U7N A;  4URO A;  4XCL A;  1USV A;  4DV5 E;  4DR5 E;  1AMW A;  1UYH A;  5CPH A;  3T2S A;  1ZM4 A;  3GON A;  1TID A;  1HNZ E;  4H81 A;  4B3S I;  2WI1 A;  4LF5 E;  3EHJ A;  4LF4 I;  2YE5 A;  2XDU A;  2HHH I;  1YSZ A;  2H8M A;  4HXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...