1EA6A

N-terminal 40kda fragment of nhpms2 complexed with adp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
338
structure length
304
Chain Sequence
CSGQVVLSLSTAVKELVENSLDAGATNIDLKLKDYGVDLIEVSDNGCGVEEENFEGLTLEALSSLCALSDVTISTCHASAKVGTRLMFDHNGKIIQKTPYPRPRGTTVSVQQLFSTLPVRHKEFQRNIKKEYAKMVQVLHAYCIISAGIRVSCTNQLGQGKRQPVVCTGGSPSIKENIGSVFGQKQLQSLIPFVQLPPSDSVCEEYGLSCSDALHNLFYISGFISQCTHGVGRSSTDRQFFFINRRPCDPAKVCRLVNEVYHMYNRHQYPFVVLNISVDSECVLLQEEKLLLAVLKTSLIGMFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PMS1 PROTEIN HOMOLOG 2
publication title Structure and Function of the N-Terminal 40 kDa Fragment of Human Pms2: A Monomeric Ghl ATPase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna repair
total genus 86
structure length 304
sequence length 338
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01119 DNA_mis_repair DNA mismatch repair protein, C-terminal domain
A PF13589 HATPase_c_3 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1ea6A02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1ea6A01
2C2AA 4DUZE 2DEIA 4DR3I 2IWUA 1XNQE 1UYIA 4QPJA 3BM9A 4EFUA 3LNUA 3R4PA 4JI2I 3H4LA 5IT9Q 1R62A 1Z0GA 1IBMI 4YKRA 4NXNI 1S4EA 2HFSA 4YY3E 4LF7E 2XHXA 2YEAA 5IDMA 1ZW9A 3KE6A 1TIDA 3G7BA 2NPFA 3PEJA 4LFBI 1B3QA 1Y4UA 4USMA 1Z59A 4AWQA 2EXLA 1AH6A 5A2QC 4HZ0A 4MYTA 1XMOI 1IBME 3QT5A 5D6PA 5IDJA 3HZ1A 1N32I 2R3VA 1YC1A 3A0YA 4AS9A 4RPFA 4AQYI 3GIEA 4V26A 2XEXA 2UXCI 1PIEA 4LFBE 2XCMA 2XDXA 1Z0BA 2J7KA 4LFCE 1FJGE 1D6TA 1GKXA 2BYIA 2HHHE 2XDUA 2CG9A 4B3SE 4GGLA 1XMOE 4E00A 4DV1E 4HACA 5CTXA 1N0VC 4ASGA 5M4HA 5GGZA 1HNWI 4GT8A 3A0ZA 3RKZA 4EMVA 3B78A 4AQYE 2FWYA 4KHPE 1MG7A 2EFGA 4U7OA 5D7RA 2BZ5A 3G7EA 3V5RA 5CF0A 1ELOA 1J5EE 4MP7A 1UEKA 1ZM2A 4NH7A 4MPCA 4NXMI 1UYKA 4H81A 4XIRA 4XCJA 4CWRA 1HNWE 3QTFA 4B6CA 3ZZTA 1Y8NA 4KSGA 2BM0A 4LF9I 2BSMA 5M4PA 4DUHA 2HK2A 1UY7A 5IWAE 2O1WA 5FNFA 2LJPA 2O1VA 3T0HA 4B3TI 1Y8PA 3J7AG 4FCPA 2YEHA 4BIZA 2YKEA 4DR6E 4EFTA 2VQFE 3B28A 4YKTA 2YKIA 1QZRA 4CWTA 4MPEA 4P52A 4LF6E 1A4HA 1N36E 2GS8A 3U67A 2ZDYA 5FNCA 3EKOA 4HACB 2CGFA 3WQ9A 1IBLI 3B26A 2XD6A 1YT1A 2FWZA 2XABA 4JV5E 2YE4A 3H80A 4B3TE 2VCJA 1MX0A 4DPUA 3JAMQ 3OWDA 2WEPA 3WU4A 4URLA 4Z7CA 1KZNA 2UUAI 4DV4E 2V34A 4FWDA 2BU5A 2QG2A 4JAUA 4R1FA 1ID0A 3K99A 4XTJA 4NH9A 2XJJA 3OTOI 1OSFA 3ZM7A 1YS3A 1Z0WA 1RR9A 1IBLE 2ZM6I 1ZM3A 1KTVA 4DV0I 2Q8FA 3CGZA 1Z0EA 5M4EA 2YEEA 2AJ4A 2UU9I 2UUAE 4DR2E 4CE3A 5FWKA 5M4MA 2PNRA 1AMWA 3J80C 2ESAA 2H55A 4YKYA 4DV2E 3T1YI 4CWOA 3OTOE 1S14A 1XHKA 3D4JA 1FI4A 2ZM6E 1ZM4A 2UUBI 5A2QQ 1UYMA 4DUYE 4DR7I 1QY8A 3GONA 1XNRE 1ZWHA 4ZVIA 3B24A 4XKKA 4JI5I 1I59A 2VQEE 2V2ZA 4NH8A 2V8PA 4XIQA 1UYCA 4MOTA 4XITA 3T1HE 2XJXA 3T1YE 4AWOA 2VF3A 5IN9A 4DPTA 3ZXOA 4X62I 1Z5CA 4EGKA 1TH8A 4B3RE 4YKQA 3SL2A 3QT7A 1YT2A 2UXBI 1UYLA 5LMNI 4DR7E 4WUCA 3A0TA 4DR1I 3FT5A 4R3AA 4GQTA 4JI3I 3T0ZA 2YGEA 5CPHA 3RLPA 4I5SA 3TZ4A 2YJXA 2YI7A 1EI1A 1UYDA 4JYAE 4CWSA 4MBCA 3R4OA 1KVKA 2X36A 1TC6A 3C0EA 1ZXNA 4ASAA 2UXBE 1N34E 4L94A 2YKJA 4JI1I 4GKJI 1KKHA 4DR3E 4JASA 4DV6I 4EGHA 4EMDA 4JI2E 1Y4SA 1UY9A 2WI6A 3M6AA 1UYHA 4DV7I 2O1UA 4H85A 4NXNE 4DU8A 3J81Q 4KTNA 4X66I 2CH4A 2AKPA 1Z5BA 4X65I 3G75A 4GKKI 2A2DA 4BQGA 2BREA 2ZITA 4L90A 3F0NA 3HZ5A 4LFAI 2BU2A 3QDDA 4B3MI 3EHGA 3O6OA 3V2UC 5LMUI 3FV5A 2K5BA 1TBWA 3OMUA 2WI4A 4MPNA 1N32E 2UWDA 3INWA 4XC0A 2YEDA 3CRKA 4LWGA 1KIJA 4CWNA 2WERA 4GEEA 3ZZ0A 4LFAE 2UXCE 2JKIA 3CGYA 1BYQA 1I58A 1L0OA 4DR5I 3HHUA 2YEGA 1BXDA 2XDLA 3GIFA 4WUBA 4K0KI 3MNRP 5L3JA 2BU7A 3PEHA 1H73A 4LWIA 3VHDA 1VISA 3A0XA 3EHJA 3HYZA 1B62A 3T1KA 2IOPA 4JI6I 3R4NA 4OX9I 4DR5E 4P8OA 4PL9A 2E5LI 4L8ZA 3IEDA 4HY1A 1JM6A 4NXME 4PRXA 4JI4I 2V2VA 3DGEA 3GIGA 3Q5LA 3TZ5A 1I5DA 3U2DA 2XHRA 4FWHA 4E02A 2HKJA 2HKEA 4HXZA 5FLXC 4LF9E 5J6AA 4H7QA 2JJCA 1NHJA 1ZM9A 2R42A 2V2QA 4OX9E 2YE3A 1GKZA 4V25A 3PYEA 2XX5A 4DU7A 2HG1A 5GMEA 4JI4E 4DPYA 4DV5I 4LF4I 4JI8I 4XDMA 3K60A 3PYFA 2QFOA 1HNXI 4W7TA 4DV3I 1OJ4A 4HYMA 1NHIA 1HR0I 4O05A 2XDKA 2UXDI 4HZ5A 2XHTA 4JG4A 4DPWA 2GQPA 1FWLA 3CWVA 2DEJA 4DXLA 4JI0I 4XCLA 2YE2A 4UT4A 4YHHI 2VWCA 1Y8OA 2BU8A 1N0UA 3JZ3A 3OWBA 2HCHA 1HNZI 4X64I 2VW5A 5CTYA 3ZKDA 3Q5JA 1H72C 1PVGA 1HR0E 4FPPA 2FXSA 1Z0VA 3GIGB 2YKBA 4O09A 1H7UA 4LWFA 4XIPA 2ZDXA 2BU6A 4DV0E 4WUDA 5LL6R 2BM1A 3A0RA 1NZ0A 1YSRA 3K97A 4YKZA 4JI7I 1N33I 2UU9E 1HNZE 4X64E 3J7AM 2IWSA 3O2FA 1YESA 1GJVA 5J71A 3HYYA 2HFUA 3QT8A 4LF5I 2XJGA 2UUBE 1IBKI 4ASFA 3NMQA 2YE9A 2WI5A 2UUCI 2YKCA 4DZYA 3BMYA 1THNA 1FKAE 4JQLA 4URMA 5F5RA 4JI7E 2QG0A 3OPDA 1I94I 4LF8I 4JI5E 4DUZI 4LWHA 1XNQI 2YEJA 3EHFA 5FNDA 4ZKIA 1BGQA 1UYFA 4HY6A 4K4OA 4X62E 3OW6A 3U2KA 5CTWA 2YI0A 3RLRA 1MU5A 1YC4A 3B8HA 4DPXA 2YEFA 5LMNE 2IORA 4YY3I 4LF7I 2BV3A 4FWGA 4DR1E 2YE6A 4KP4A 4LPBA 1I5BA 4JI3E 1AJ6A 5BOCA 1I94E 1U0ZA 3B25A 2E1RA 2H8MA 2YECA 4MB9A 5F3KA 4MYUA 4DR4I 1YT0A 3INXA 4O04A 3Q5KA 1US7A 1UY8A 1YETA 2F4VI 3D0BA 2ZKJA 4KQVA 1FNMA 4GFNA 4YKWA 2YI5A 1BKNA 3K98A 3A0WA 4XE2A 1RREA 4JI1E 4GKJE 2YEBA 4DV6E 4AWPA 4L91A 4LWEA 4YKUA 1I5CA 4KSHA 4HYPA 5D7CA 3R91A 1YC3A 4EEHA 1I5AA 5FLXQ 3WHAA 1DARA 1H74A 2BRCA 3TZ0A 4CWFA 4DV7E 5BR8I 4DR4E 5BODA 4FW9A 4X66E 1QYEA 4LFCI 4X65E 4BIUA 1FJGI 4BQJA 2HHHI 2F4VE 4GKKE 2YGAA 4B3SI 4FCQA 1AH8A 3EKRA 4ASBA 4DV1I 2HK3A 2YE5A 2WW4A 3K17A 4HXWA 4YKXA 4B3ME 4O0BA 4USKA 5LMUE 4KHPI 2GFDA 1UYGA 3B27A 4CWPA 5BR8E 5GMDA 4B7PA 3VHCA 5D6QA 1J5EI 5D7DA 3D36A 1Z0TA 2IOQA 1K47A 1AM1A 2WI7A 4GCZA 2WI2A 1YERA 4PRVA 1Z5AA 4EM7A 2YK2A 2OI2A 2YE8A 2XDSA 2WEQA 2Q8HA 5IT9C 5C93A 1S16A 4FN5A 4MP2A 3J80Q 1Z0CA 5IWAI 2Q8IA 3ZZUA 2CCTA 5CTUA 4K0KE 4O07A 3R4MA 4M1KA 4UROA 4U7NA 5M4KA 1WUUA 4UTGA 4BXIA 1UY6A 4DR6I 3R92A 2VQFI 4JI6E 3B82A 2Q2EB 3TUHA 1FWKA 3CRLA 3ZKBA 1ZXMA 4LF6I 1N36I 2E5LE 3C11A 4U93A 3J81C 4XD8A 2WI1A 2BYHA 4E01A 4I3HA 2YK9A 4JV5I 1U2RA 4Q20A 3D2RA 2YE7A 1EA6A 4PU9A 2YJWA 3VHAA 1NHHA 2ZBKB 4DV4I 4QPKA 3PYGA 1TC0A 3WU6A 2IWXA 4CE1A 5M4NA 4DV5E 4LF4E 4JI8E 4FCRA 2X7IA 2CZ9A 1HNXE 2CCUA 4DV3E 2XX2A 4XKOA 2BT0A 3PYDA 2YGFA 3VADA 2UXDE 4FMTA 3LPSA 4DR2I 1UYEA 4XKAA 4BAEA 4CWQA 3LTOA 1XMQI 4DV2I 2QF6A 4URNA 4ED4A 4JI0E 2CCSA 4YHHE 2BTZA 3T10A 3ZXQA 3TTZA 2VCIA 4LP0A 2FYPA 4DUYI 1U2OA 3WU5A 3HEKA 1XNRI 1PKPA 3WU3A 1TILA 2Q8GA 4Z7YA 3Q1QA 2WI3A 4L93A 2E0AA 2VQEI 1H7SA 2YI6A 1A6FA 3T1HI 1XMQE 3QT6A 4JAVA 4X9LA 3T2SA 3O0IA 3HULA 4B3RI 1N33E 4EGIA 3FT8A 3TZ2A 3EHHA 4LF5E 3K1JA 4CE2A 1IBKE 3JAMC 4JYAI 2A2CA 4KFGA 1YSZA 2XX4A 2UUCE 2XK2A 1B63A 4R3MA 4P7AA 3RLQA 2YEIA 4LF8E 1N34I
chains in the Genus database with same CATH superfamily
2C2AA 4DUZE 2DEIA 4DR3I 2IWUA 1XNQE 1UYIA 4QPJA 3BM9A 5C0XA 3LNUA 3R4PA 5ELWA 4IZJB 4JI2I 3H4LA 4EFUA 5IT9Q 1R62A 1Z0GA 1IBMI 4YKRA 4NXNI 1S4EA 2HFSA 4YY3E 4LF7E 2XHXA 2YEAA 5IDMA 1ZW9A 3KE6A 3P76A 1TIDA 4AM3A 3G7BA 2NPFA 3PEJA 1Y4UA 4LFBI 1B3QA 4USMA 5K36C 5K36D 2O1TA 1Z59A 4AWQA 2EXLA 4QNKA 5A2QC 1AH6A 4HZ0A 4MYTA 1XMOI 1IBME 4ISAA 3QT5A 5D6PA 5IDJA 4OO1E 3HZ1A 1N32I 2R3VA 1YC1A 3A0YA 4AS9A 4RPFA 5DNXA 4AQYI 3GIEA 4V26A 2XEXA 2UXCI 2Z5CB 1PIEA 4LFBE 2XCMA 2XDXA 1Z0BA 2J7KA 4LFCE 1FJGE 1D6TA 1GKXA 2BYIA 2HHHE 2XDUA 2CG9A 4IFDB 4B3SE 2CVEA 4GGLA 3CDIA 3K85A 1XMOE 3L7ZB 4E00A 4DV1E 4HACA 5C0XB 5CTXA 1N0VC 4ASGA 5M4HA 5GGZA 1HNWI 4GT8A 3A0ZA 3RKZA 4EMVA 3B78A 4AQYE 2FWYA 4KHPE 1USUA 1MG7A 2EFGA 4U7OA 5D7RA 2BZ5A 3G7EA 3V5RA 5CF0A 1ELOA 1J5EE 4MP7A 1UDSA 1UEKA 2IERA 1ZM2A 4NH7A 4MPCA 4NXMI 1UYKA 5K36A 2PO0B 4H81A 2FTKA 4XIRA 4XCJA 4CWRA 1HNWE 3QTFA 4B6CA 3ZZTA 1Y8NA 5JENA 4KSGA 2BM0A 4LF9I 2BSMA 5M4PA 4DUHA 1YH8A 2HK2A 3PRYA 1UY7A 5IWAE 2NN6A 2O1WA 5FNFA 2Z5EA 2LJPA 2O1VA 4IZKB 3T0HA 1OYPA 4B3TI 1Y8PA 3J7AG 4FCPA 2YEHA 3PS1A 2YKEA 4DR6E 4BIZA 2VQFE 4EFTA 1HK7A 3B28A 4YKTA 2YKIA 1QZRA 4OO1C 2IESA 4P52A 4OO1D 2CGEA 4MPEA 4LF6E 1A4HA 4CWTA 1N36E 2GS8A 3U67A 2ZDYA 5FNCA 3EKOA 4HACB 2CGFA 3WQ9A 1IBLI 3B26A 2XD6A 1YT1A 2FWZA 2XABA 4JV5E 2YE4A 3H80A 4B3TE 2VCJA 1MX0A 4DPUA 3JAMQ 3OWDA 1Y5YA 3WU4A 2WEPA 4URLA 4Z7CA 1KZNA 3S5TA 2UUAI 4MU3A 4DV4E 2V34A 4FWDA 2BU5A 2QG2A 4JAUA 4R1FA 1ID0A 3K99A 4XTJA 4NH9A 2XJJA 3OTOI 2Z5BB 1OSFA 3ZM7A 1YS3A 1Z0WA 1RR9A 2ZM6I 1IBLE 1ZM3A 1KTVA 4J3DA 4DV0I 2Q8FA 3CGZA 1Z0EA 5M4EA 1Y60A 2YEEA 2AJ4A 2UU9I 5JEAF 2UUAE 4DR2E 5FWKA 4CE3A 5M4MA 4GQUA 1YHCA 4BA1A 3J80C 1AMWA 2ESAA 2NN6E 4DV2E 3T1YI 2H55A 4YKYA 4CWOA 2C1IA 3OTOE 1S14A 1XHKA 3D4JA 1FI4A 2ZM6E 1ZM4A 2UUBI 5A2QQ 1UYMA 4DUYE 4DR7I 1QY8A 3GONA 1XNRE 1ZWHA 4ZVIA 1VI7A 1UDOA 3B24A 4XKKA 5DRPA 4JI5I 1I59A 2VQEE 3PS3A 2V2ZA 4NH8A 2V8PA 4XIQA 1UYCA 4MOTA 4XITA 3T1HE 2XJXA 3T1YE 4AWOA 2VF3A 5IN9A 4DPTA 3M7ND 3ZXOA 4MQYA 4X62I 1Z5CA 4AIDA 4EGKA 1TH8A 4B3RE 4YKQA 3SL2A 3QT7A 1YT2A 2UXBI 1UYLA 5LMNI 4DR7E 4WUCA 2PO1A 3A0TA 4DR1I 1OYRA 3FT5A 4R3AA 4U3DA 4FW5A 4N3OA 4AIMA 4JI3I 4GQTA 3T0ZA 2YGEA 5CPHA 3DD6A 3RLPA 4I5SA 3TZ4A 2YJXA 2YI7A 1EI1A 1UYDA 4JYAE 2JEAB 4CWSA 4MBCA 3R4OA 1KVKA 2X36A 1TC6A 3C0EA 4QNJA 5JEAE 1ZXNA 4ASAA 2UXBE 1N34E 4L94A 2YKJA 5EL9A 4JI1I 4GKJI 1KKHA 4DR3E 4JASA 4E72A 4DV6I 4EGHA 4OO1B 2PNRA 4EMDA 1Y4SA 4JI2E 1UY9A 1XXEA 3M6AA 2WI6A 1UYHA 4DV7I 2O1UA 4H85A 2JE6A 2O3ZA 4DU8A 3J81Q 4X66I 4NXNE 4IFDF 1Z5BA 4X65I 2AKPA 2CH4A 3G75A 2NN6C 2NN6D 4GKKI 2A2DA 4BQGA 2BREA 5C0XF 2ZITA 4L90A 4BA2A 3F0NA 3HZ5A 4LFAI 2BU2A 3QDDA 4B3MI 3EHGA 5DROA 3V2UC 5LMUI 3O6OA 3FV5A 2K5BA 1TBWA 2WP8A 3OMUA 2WNRA 2WI4A 4MPNA 1N32E 2UWDA 3INWA 4XC0A 4MDTA 2YEDA 3CRKA 4LWGA 1KIJA 4CWNA 2WERA 4GEEA 3ZZ0A 4LFAE 2UXCE 1F51A 2JKIA 3CGYA 2BR2A 1BYQA 1I58A 1L0OA 4DR5I 3HHUA 2YEGA 1BXDA 2JEBA 2XDLA 3GIFA 4WUBA 4K0KI 3MNRP 5L3JA 2BU7A 3PEHA 1H73A 4LWIA 3VHDA 1VISA 2J65A 3A0XA 3EHJA 3HYZA 1B62A 3T1KA 2IOPA 2AE8A 4JI6I 5JEAC 3P3GA 3R4NA 4OX9I 1P42A 4DR5E 4P8OA 4PL9A 2E5LI 4L8ZA 3IEDA 4HY1A 1JM6A 4NXME 4PRXA 4JI4I 2V2VA 3DGEA 3GIGA 3Q5LA 3TZ5A 1I5DA 3U2DA 2XHRA 4FWHA 4E02A 2HKJA 2HKEA 2BA1D 4HXZA 5FLXC 4LF9E 5J6AA 2WP8B 3B4TA 4H7QA 2JJCA 1NHJA 1ZM9A 2R42A 2V2QA 2PNZA 3M85D 4OX9E 5K36F 1GKZA 2YE3A 4V25A 4NBQA 3CDJA 3PYEA 2XX5A 4DU7A 2HG1A 1OYSA 5DRRA 5GMEA 4JI4E 4DPYA 4DV5I 4LF4I 2BR2B 4JI8I 4XDMA 3K60A 3PYFA 2JEBB 1HNXI 2QFOA 4DV3I 1OJ4A 4W7TA 4HYMA 1NHIA 1HR0I 4O05A 2XDKA 4LCFA 5K36B 2UXDI 3HJCA 2XHTA 4JG4A 4DPWA 2GQPA 4HZ5A 3CYGA 1FWLA 3CWVA 2DEJA 4DXLA 2C39A 4JI0I 4XCLA 2YE2A 4UT4A 4YHHI 5JEAA 2NN6B 2VWCA 1Y8OA 2BU8A 1N0UA 3JZ3A 3OWBA 2HCHA 1HNZI 4X64I 2VW5A 5CTYA 3ZKDA 3Q5JA 1H72C 1PVGA 1HR0E 4FPPA 3UHMA 1Z0VA 4MU0A 2FXSA 3GIGB 2YKBA 4O09A 1H7UA 4LWFA 4XIPA 2ZDXA 2GO4A 2BA0D 2BU6A 2C38A 4DV0E 4WUDA 5LL6R 2BM1A 3A0RA 1NZ0A 1YSRA 3GCMA 3K97A 4YKZA 4JI7I 1N33I 2UU9E 1HNZE 4X64E 3J7AM 2IWSA 3PS2A 3Q6MA 3O2FA 5EKWA 1YESA 3P06A 1GJVA 5J71A 2C1GA 3HYYA 2HFUA 3QT8A 4LF5I 2XJGA 2UUBE 1IBKI 4ASFA 3NMQA 2YE9A 2WI5A 4LOMA 2UUCI 2YKCA 2GO3A 4DZYA 1Y6ZA 1THNA 1FKAE 3BMYA 4JQLA 4URMA 5F5RA 4JI7E 2QG0A 3OPDA 1I94I 4LF8I 4JI5E 4OO1F 4DUZI 4LWHA 1XNQI 2YEJA 1R6MA 3EHFA 5FNDA 4ZKIA 1BGQA 1UYFA 4HY6A 4K4OA 4X62E 2HHIA 3OW6A 3U2KA 5CTWA 2YI0A 3RLRA 4BA1B 1MU5A 3U1YA 1YC4A 3B8HA 4DPXA 2YEFA 5LMNE 2IORA 4YY3I 4LF7I 2BV3A 2Z5CA 4FWGA 4DR1E 2YE6A 4KP4A 4LPBA 1E3HA 1I5BA 4JI3E 1AJ6A 5BOCA 1I94E 1U0ZA 3B25A 4LCHA 2E1RA 2H8MA 2YECA 4IFDA 4MB9A 5F3KA 3L7ZA 4FW4A 4MYUA 4DR4I 1YT0A 3GMEA 3INXA 4O04A 4OKGA 3Q5KA 1US7A 1UY8A 1YETA 2F4VI 3D0BA 2ZKJA 4KQVA 1FNMA 4GFNA 4YKWA 2YI5A 1BKNA 3M7NG 3A0WA 3K98A 4XE2A 1RREA 4JI1E 4GKJE 2YEBA 3P3CA 4DV6E 4AWPA 4L91A 4LWEA 4YKUA 1I5CA 4KSHA 4HYPA 5D7CA 3R91A 1YC3A 4EEHA 2JT2A 1I5AA 2PO1B 5FLXQ 3WHAA 1DARA 1H74A 4LPFA 2BRCA 3TZ0A 4DV7E 5BR8I 4CWFA 3GLLA 4DR4E 5BODA 2PO0A 4FW9A 4X66E 4LFCI 4X65E 1QYEA 1FJGI 4BIUA 4BQJA 1RHYA 2HHHI 2F4VE 4GKKE 2YGAA 4B3SI 4FCQA 1AH8A 3EKRA 4ASBA 4DV1I 2HK3A 2YE5A 2WW4A 3K17A 4HXWA 4YKXA 4B3ME 4O0BA 4IZKA 4USKA 5LMUE 4KHPI 4FW7A 1UYGA 2GFDA 3B27A 3LMMA 4CWPA 5BR8E 5GMDA 4B7PA 3VHCA 5D6QA 1J5EI 5D7DA 3D36A 1Z0TA 2IOQA 1K47A 1AM1A 2WI7A 4GCZA 2WI2A 1YERA 4PRVA 1Z5AA 4EM7A 2JE6B 2YK2A 2OI2A 2YE8A 2XDSA 5JEAD 2WEQA 2Q8HA 4IFDE 5IT9C 1R6LA 4BA2B 1E3PA 1IXMA 1S16A 4FN5A 4MP2A 5C93A 3J80Q 1Z0CA 5IWAI 5C0XE 3ZZUA 2CCTA 2Q8IA 5CTUA 4K0KE 3U1KA 3NZKA 4O07A 3R4MA 2PO2A 4FW6A 4M1KA 4UROA 4U7NA 2C37A 5M4KA 1WUUA 4UTGA 4BXIA 1UY6A 4DR6I 3R92A 2VQFI 2Z5BA 4JI6E 1UDQA 2Q2EB 2WNRB 3B82A 3TUHA 1FWKA 3KRNA 3CRLA 3ZKBA 1ZXMA 4LF6I 4IZJD 4MU4A 1N36I 2E5LE 3C11A 4U93A 3J81C 4XD8A 2WI1A 2BYHA 3P3EA 1USVA 4E01A 4I3HA 2YK9A 4JV5I 1U2RA 2NN6F 4Q20A 3D2RA 2YE7A 1EA6A 2GQ0A 4PU9A 5DRQA 2YJWA 4KTNA 3VHAA 4U3BA 1NHHA 2ZBKB 4DV4I 3HKMA 4QPKA 3PYGA 2PNLA 2F1DA 1UDNA 1TC0A 4OZEA 3WU6A 2IWXA 4CE1A 5M4NA 4DV5E 4LF4E 4JI8E 4FCRA 2X7IA 2CZ9A 4FW3A 1HNXE 2CCUA 4DV3E 2XX2A 4XKOA 2BT0A 3PYDA 2YGFA 3VADA 2UXDE 4FMTA 3LPSA 4DR2I 2PO2B 1UYEA 4XKAA 4BAEA 3LTOA 4CWQA 2BA1G 2C37B 1XMQI 4DV2I 4IFDD 4IFDC 2QF6A 4URNA 4ED4A 4JI0E 2CCSA 3M85G 4YHHE 2BTZA 3T10A 3ZXQA 5DNLA 3TTZA 2PNZB 2VCIA 5C0XC 5C0XD 2FYPA 4LP0A 3H1CA 4DUYI 4IZJA 1U2OA 3WU5A 5K36E 3HEKA 1XNRI 1PKPA 3WU3A 1TILA 2Q8GA 2PNMA 4Z7YA 3Q1QA 2JEAA 2WI3A 4L93A 2E0AA 2VQEI 1H7SA 4MU1A 2YI6A 1A6FA 3T1HI 1XMQE 3QT6A 4JAVA 4X9LA 3T2SA 4IS9A 3O0IA 3HULA 4B3RI 1N33E 2C39B 4OO1A 4EGIA 5JEAB 3FT8A 4LCGA 3TZ2A 3EHHA 4LF5E 3K1JA 4CE2A 1IBKE 3JAMC 3Q6NA 2A2CA 4JYAI 4KFGA 1YSZA 2XX4A 2UUCE 2XK2A 2VESA 1B63A 2BA0G 4R3MA 4P7AA 3RLQA 2YEIA 4LF8E 2C38B 1N34I
chains in the Genus database with same CATH topology
2C2AA 4DUZE 2DEIA 4DR3I 2IWUA 1XNQE 1UYIA 4QPJA 3BM9A 4EFUA 3LNUA 3R4PA 4IZJB 4JI2I 3H4LA 5IT9Q 1R62A 1Z0GA 1IBMI 4YKRA 4NXNI 1S4EA 2HFSA 4YY3E 4LF7E 2XHXA 2YEAA 5IDMA 1ZW9A 3KE6A 1TIDA 3G7BA 2NPFA 3PEJA 1Y4UA 4LFBI 1B3QA 4USMA 2O1TA 1Z59A 4AWQA 2EXLA 1AH6A 5A2QC 4HZ0A 4MYTA 1XMOI 1IBME 3QT5A 5D6PA 5IDJA 3HZ1A 1N32I 2R3VA 1YC1A 3A0YA 4AS9A 4RPFA 4AQYI 3GIEA 4V26A 2XEXA 2UXCI 2Z5CB 1PIEA 4LFBE 2XCMA 2XDXA 1Z0BA 2J7KA 4LFCE 1FJGE 1D6TA 1GKXA 2BYIA 2HHHE 2XDUA 2CG9A 4B3SE 4GGLA 3K85A 1XMOE 4E00A 4DV1E 4HACA 5CTXA 1N0VC 4ASGA 5M4HA 5GGZA 1HNWI 4GT8A 3A0ZA 3RKZA 4EMVA 3B78A 4AQYE 2FWYA 4KHPE 1USUA 1MG7A 2EFGA 4U7OA 5D7RA 2BZ5A 3G7EA 3V5RA 5CF0A 1ELOA 1J5EE 4MP7A 1UEKA 1ZM2A 4NH7A 4MPCA 4NXMI 1UYKA 4H81A 4XIRA 4XCJA 4CWRA 1HNWE 3QTFA 4B6CA 3ZZTA 1Y8NA 4KSGA 2BM0A 4LF9I 2BSMA 5M4PA 4DUHA 2HK2A 3PRYA 1UY7A 5IWAE 2O1WA 5FNFA 2Z5EA 2LJPA 2O1VA 4IZKB 3T0HA 4B3TI 1Y8PA 3J7AG 4FCPA 2YEHA 4BIZA 2YKEA 4DR6E 4EFTA 2VQFE 1HK7A 3B28A 4YKTA 2YKIA 1QZRA 4CWTA 4MPEA 4P52A 2CGEA 4LF6E 1A4HA 1N36E 2GS8A 3U67A 2ZDYA 5FNCA 3EKOA 4HACB 2CGFA 3WQ9A 1IBLI 3B26A 2XD6A 1YT1A 2FWZA 2XABA 4JV5E 2YE4A 3H80A 4B3TE 2VCJA 1MX0A 4DPUA 3JAMQ 3OWDA 2WEPA 3WU4A 4URLA 4Z7CA 1KZNA 2UUAI 4DV4E 2V34A 4FWDA 2BU5A 2QG2A 4JAUA 4R1FA 1ID0A 3K99A 4XTJA 4NH9A 2XJJA 3OTOI 2Z5BB 1OSFA 3ZM7A 1YS3A 1Z0WA 2ZM6I 1RR9A 1IBLE 1ZM3A 1KTVA 4DV0I 2Q8FA 3CGZA 1Z0EA 5M4EA 2YEEA 2AJ4A 2UU9I 2UUAE 4DR2E 5FWKA 4CE3A 5M4MA 2PNRA 1AMWA 3J80C 2ESAA 2H55A 4YKYA 4DV2E 3T1YI 4CWOA 3OTOE 1S14A 1XHKA 3D4JA 1FI4A 2ZM6E 1ZM4A 2UUBI 5A2QQ 1UYMA 4DUYE 4DR7I 1QY8A 3GONA 1XNRE 1ZWHA 4ZVIA 3B24A 4XKKA 4JI5I 1I59A 2VQEE 2V2ZA 4NH8A 2V8PA 4XIQA 1UYCA 4MOTA 4XITA 3T1HE 2XJXA 3T1YE 4AWOA 2VF3A 5IN9A 4DPTA 3ZXOA 4X62I 1Z5CA 4EGKA 1TH8A 4B3RE 4YKQA 3SL2A 3QT7A 1YT2A 2UXBI 1UYLA 5LMNI 4DR7E 4WUCA 3A0TA 4DR1I 3FT5A 4R3AA 4GQTA 4N3OA 4JI3I 3T0ZA 2YGEA 5CPHA 3RLPA 4I5SA 3TZ4A 2YJXA 2YI7A 1EI1A 1UYDA 4JYAE 4CWSA 4MBCA 3R4OA 1KVKA 2X36A 1TC6A 3C0EA 1ZXNA 4ASAA 2UXBE 1N34E 4L94A 2YKJA 4JI1I 4GKJI 1KKHA 4DR3E 4JASA 4DV6I 4EGHA 4EMDA 1Y4SA 4JI2E 1UY9A 2WI6A 3M6AA 1UYHA 4DV7I 2O1UA 4H85A 4NXNE 4DU8A 3J81Q 4KTNA 4X66I 2CH4A 2AKPA 1Z5BA 4X65I 3G75A 4GKKI 2A2DA 4BQGA 2BREA 2ZITA 4L90A 3F0NA 3HZ5A 4LFAI 2BU2A 3QDDA 4B3MI 3EHGA 3O6OA 3V2UC 5LMUI 3FV5A 2K5BA 1TBWA 3OMUA 2WI4A 4MPNA 1N32E 2UWDA 3INWA 4XC0A 2YEDA 3CRKA 4LWGA 1KIJA 4CWNA 2WERA 4GEEA 3ZZ0A 4LFAE 2UXCE 2JKIA 3CGYA 1BYQA 1I58A 1L0OA 4DR5I 3HHUA 2YEGA 1BXDA 2XDLA 3GIFA 4WUBA 4K0KI 3MNRP 5L3JA 2BU7A 3PEHA 1H73A 4LWIA 3VHDA 1VISA 3A0XA 3EHJA 3HYZA 1B62A 3T1KA 2IOPA 4JI6I 3R4NA 4OX9I 4DR5E 4P8OA 4PL9A 2E5LI 4L8ZA 3IEDA 4HY1A 1JM6A 4NXME 4PRXA 4JI4I 2V2VA 3DGEA 3GIGA 3Q5LA 3TZ5A 1I5DA 3U2DA 2XHRA 4FWHA 4E02A 2HKJA 2HKEA 4HXZA 5FLXC 4LF9E 5J6AA 4H7QA 2JJCA 1NHJA 1ZM9A 2R42A 2V2QA 4OX9E 2YE3A 1GKZA 4V25A 3PYEA 2XX5A 4DU7A 2HG1A 5GMEA 4JI4E 4DPYA 4DV5I 4LF4I 4JI8I 4XDMA 3K60A 3PYFA 2QFOA 1HNXI 4W7TA 4DV3I 1OJ4A 4HYMA 1NHIA 1HR0I 4O05A 2XDKA 2UXDI 3HJCA 2XHTA 4JG4A 4DPWA 2GQPA 4HZ5A 1FWLA 3CWVA 2DEJA 4DXLA 4JI0I 4XCLA 2YE2A 4UT4A 4YHHI 2VWCA 1Y8OA 2BU8A 1N0UA 3JZ3A 3OWBA 2HCHA 1HNZI 4X64I 2VW5A 5CTYA 3ZKDA 3Q5JA 1H72C 1PVGA 1HR0E 4FPPA 2FXSA 1Z0VA 3GIGB 2YKBA 4O09A 1H7UA 4LWFA 4XIPA 2ZDXA 2BU6A 4DV0E 4WUDA 5LL6R 2BM1A 3A0RA 1NZ0A 1YSRA 3K97A 4YKZA 4JI7I 1N33I 2UU9E 1HNZE 4X64E 3J7AM 2IWSA 3Q6MA 3O2FA 1YESA 3P06A 1GJVA 5J71A 3HYYA 2HFUA 3QT8A 4LF5I 2XJGA 2UUBE 1IBKI 4ASFA 3NMQA 2YE9A 2WI5A 2UUCI 2YKCA 4DZYA 1Y6ZA 1THNA 1FKAE 3BMYA 4JQLA 4URMA 5F5RA 4JI7E 2QG0A 3OPDA 1I94I 4LF8I 4JI5E 4DUZI 4LWHA 1XNQI 2YEJA 3EHFA 5FNDA 4ZKIA 1BGQA 1UYFA 4HY6A 4K4OA 4X62E 3OW6A 3U2KA 5CTWA 2YI0A 3RLRA 1MU5A 1YC4A 3B8HA 4DPXA 2YEFA 5LMNE 2IORA 4YY3I 4LF7I 2BV3A 2Z5CA 4FWGA 4DR1E 2YE6A 4KP4A 4LPBA 1I5BA 4JI3E 1AJ6A 5BOCA 1I94E 1U0ZA 3B25A 2E1RA 2H8MA 2YECA 4MB9A 5F3KA 4MYUA 4DR4I 1YT0A 3INXA 4O04A 3Q5KA 1US7A 1UY8A 1YETA 2F4VI 3D0BA 2ZKJA 4KQVA 1FNMA 4GFNA 4YKWA 2YI5A 1BKNA 3K98A 3A0WA 4XE2A 1RREA 4JI1E 4GKJE 2YEBA 4DV6E 4AWPA 4L91A 4LWEA 4YKUA 1I5CA 4KSHA 4HYPA 5D7CA 3R91A 1YC3A 4EEHA 1I5AA 5FLXQ 3WHAA 1DARA 1H74A 2BRCA 3TZ0A 4CWFA 4DV7E 5BR8I 4DR4E 5BODA 4FW9A 4X66E 1QYEA 4LFCI 4X65E 4BIUA 1FJGI 4BQJA 2HHHI 2F4VE 4GKKE 2YGAA 4B3SI 4FCQA 1AH8A 3EKRA 4ASBA 4DV1I 2HK3A 2YE5A 2WW4A 3K17A 4HXWA 4YKXA 4B3ME 4O0BA 4IZKA 4USKA 5LMUE 4KHPI 2GFDA 1UYGA 3B27A 4CWPA 5BR8E 5GMDA 4B7PA 3VHCA 5D6QA 1J5EI 5D7DA 3D36A 1Z0TA 2IOQA 1K47A 1AM1A 2WI7A 4GCZA 2WI2A 1YERA 4PRVA 1Z5AA 4EM7A 2YK2A 2OI2A 2YE8A 2XDSA 2WEQA 2Q8HA 5IT9C 5C93A 1S16A 4FN5A 4MP2A 3J80Q 1Z0CA 5IWAI 2Q8IA 3ZZUA 2CCTA 5CTUA 4K0KE 4O07A 3R4MA 4M1KA 4UROA 4U7NA 5M4KA 1WUUA 4UTGA 4BXIA 1UY6A 4DR6I 3R92A 2VQFI 2Z5BA 4JI6E 3B82A 2Q2EB 3TUHA 1FWKA 3CRLA 3ZKBA 1ZXMA 4LF6I 4IZJD 1N36I 2E5LE 3C11A 4U93A 3J81C 4XD8A 2WI1A 2BYHA 1USVA 4E01A 4I3HA 2YK9A 4JV5I 1U2RA 4Q20A 3D2RA 2YE7A 1EA6A 2GQ0A 4PU9A 2YJWA 3VHAA 1NHHA 2ZBKB 4DV4I 4QPKA 3PYGA 2PNLA 1TC0A 3WU6A 2IWXA 4CE1A 5M4NA 4DV5E 4LF4E 4JI8E 4FCRA 2X7IA 2CZ9A 1HNXE 2CCUA 4DV3E 2XX2A 4XKOA 2BT0A 3PYDA 2YGFA 3VADA 2UXDE 4FMTA 3LPSA 4DR2I 1UYEA 4XKAA 4BAEA 4CWQA 3LTOA 1XMQI 4DV2I 2QF6A 4URNA 4ED4A 4JI0E 2CCSA 4YHHE 2BTZA 3T10A 3ZXQA 3TTZA 2VCIA 4LP0A 2FYPA 4DUYI 4IZJA 1U2OA 3WU5A 3HEKA 1XNRI 1PKPA 3WU3A 1TILA 2Q8GA 2PNMA 4Z7YA 3Q1QA 2WI3A 4L93A 2E0AA 2VQEI 1H7SA 2YI6A 1A6FA 3T1HI 1XMQE 3QT6A 4JAVA 4X9LA 3T2SA 3O0IA 3HULA 4B3RI 1N33E 4EGIA 3FT8A 3TZ2A 3EHHA 4LF5E 3K1JA 4CE2A 1IBKE 3JAMC 3Q6NA 2A2CA 4JYAI 4KFGA 1YSZA 2XX4A 2UUCE 2XK2A 1B63A 4R3MA 4P7AA 3RLQA 2YEIA 4LF8E 1N34I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C2A A;  4DUZ E;  2DEI A;  4DR3 I;  2IWU A;  1XNQ E;  1UYI A;  4QPJ A;  3BM9 A;  4EFU A;  3LNU A;  3R4P A;  4JI2 I;  3H4L A;  5IT9 Q;  1R62 A;  1Z0G A;  1IBM I;  4YKR A;  4NXN I;  1S4E A;  2HFS A;  4YY3 E;  4LF7 E;  2XHX A;  2YEA A;  5IDM A;  1ZW9 A;  3KE6 A;  1TID A;  3G7B A;  2NPF A;  3PEJ A;  4LFB I;  1B3Q A;  1Y4U A;  4USM A;  1Z59 A;  4AWQ A;  2EXL A;  1AH6 A;  5A2Q C;  4HZ0 A;  4MYT A;  1XMO I;  1IBM E;  3QT5 A;  5D6P A;  5IDJ A;  3HZ1 A;  1N32 I;  2R3V A;  1YC1 A;  3A0Y A;  4AS9 A;  4RPF A;  4AQY I;  3GIE A;  4V26 A;  2XEX A;  2UXC I;  1PIE A;  4LFB E;  2XCM A;  2XDX A;  1Z0B A;  2J7K A;  4LFC E;  1FJG E;  1D6T A;  1GKX A;  2BYI A;  2HHH E;  2XDU A;  2CG9 A;  4B3S E;  4GGL A;  1XMO E;  4E00 A;  4DV1 E;  4HAC A;  5CTX A;  1N0V C;  4ASG A;  5M4H A;  5GGZ A;  1HNW I;  4GT8 A;  3A0Z A;  3RKZ A;  4EMV A;  3B78 A;  4AQY E;  2FWY A;  4KHP E;  1MG7 A;  2EFG A;  4U7O A;  5D7R A;  2BZ5 A;  3G7E A;  3V5R A;  5CF0 A;  1ELO A;  1J5E E;  4MP7 A;  1UEK A;  1ZM2 A;  4NH7 A;  4MPC A;  4NXM I;  1UYK A;  4H81 A;  4XIR A;  4XCJ A;  4CWR A;  1HNW E;  3QTF A;  4B6C A;  3ZZT A;  1Y8N A;  4KSG A;  2BM0 A;  4LF9 I;  2BSM A;  5M4P A;  4DUH A;  2HK2 A;  1UY7 A;  5IWA E;  2O1W A;  5FNF A;  2LJP A;  2O1V A;  3T0H A;  4B3T I;  1Y8P A;  3J7A G;  4FCP A;  2YEH A;  4BIZ A;  2YKE A;  4DR6 E;  4EFT A;  2VQF E;  3B28 A;  4YKT A;  2YKI A;  1QZR A;  4CWT A;  4MPE A;  4P52 A;  4LF6 E;  1A4H A;  1N36 E;  2GS8 A;  3U67 A;  2ZDY A;  5FNC A;  3EKO A;  4HAC B;  2CGF A;  3WQ9 A;  1IBL I;  3B26 A;  2XD6 A;  1YT1 A;  2FWZ A;  2XAB A;  4JV5 E;  2YE4 A;  3H80 A;  4B3T E;  2VCJ A;  1MX0 A;  4DPU A;  3JAM Q;  3OWD A;  2WEP A;  3WU4 A;  4URL A;  4Z7C A;  1KZN A;  2UUA I;  4DV4 E;  2V34 A;  4FWD A;  2BU5 A;  2QG2 A;  4JAU A;  4R1F A;  1ID0 A;  3K99 A;  4XTJ A;  4NH9 A;  2XJJ A;  3OTO I;  1OSF A;  3ZM7 A;  1YS3 A;  1Z0W A;  1RR9 A;  1IBL E;  2ZM6 I;  1ZM3 A;  1KTV A;  4DV0 I;  2Q8F A;  3CGZ A;  1Z0E A;  5M4E A;  2YEE A;  2AJ4 A;  2UU9 I;  2UUA E;  4DR2 E;  4CE3 A;  5FWK A;  5M4M A;  2PNR A;  1AMW A;  3J80 C;  2ESA A;  2H55 A;  4YKY A;  4DV2 E;  3T1Y I;  4CWO A;  3OTO E;  1S14 A;  1XHK A;  3D4J A;  1FI4 A;  2ZM6 E;  1ZM4 A;  2UUB I;  5A2Q Q;  1UYM A;  4DUY E;  4DR7 I;  1QY8 A;  3GON A;  1XNR E;  1ZWH A;  4ZVI A;  3B24 A;  4XKK A;  4JI5 I;  1I59 A;  2VQE E;  2V2Z A;  4NH8 A;  2V8P A;  4XIQ A;  1UYC A;  4MOT A;  4XIT A;  3T1H E;  2XJX A;  3T1Y E;  4AWO A;  2VF3 A;  5IN9 A;  4DPT A;  3ZXO A;  4X62 I;  1Z5C A;  4EGK A;  1TH8 A;  4B3R E;  4YKQ A;  3SL2 A;  3QT7 A;  1YT2 A;  2UXB I;  1UYL A;  5LMN I;  4DR7 E;  4WUC A;  3A0T A;  4DR1 I;  3FT5 A;  4R3A A;  4GQT A;  4JI3 I;  3T0Z A;  2YGE A;  5CPH A;  3RLP A;  4I5S A;  3TZ4 A;  2YJX A;  2YI7 A;  1EI1 A;  1UYD A;  4JYA E;  4CWS A;  4MBC A;  3R4O A;  1KVK A;  2X36 A;  1TC6 A;  3C0E A;  1ZXN A;  4ASA A;  2UXB E;  1N34 E;  4L94 A;  2YKJ A;  4JI1 I;  4GKJ I;  1KKH A;  4DR3 E;  4JAS A;  4DV6 I;  4EGH A;  4EMD A;  4JI2 E;  1Y4S A;  1UY9 A;  2WI6 A;  3M6A A;  1UYH A;  4DV7 I;  2O1U A;  4H85 A;  4NXN E;  4DU8 A;  3J81 Q;  4KTN A;  4X66 I;  2CH4 A;  2AKP A;  1Z5B A;  4X65 I;  3G75 A;  4GKK I;  2A2D A;  4BQG A;  2BRE A;  2ZIT A;  4L90 A;  3F0N A;  3HZ5 A;  4LFA I;  2BU2 A;  3QDD A;  4B3M I;  3EHG A;  3O6O A;  3V2U C;  5LMU I;  3FV5 A;  2K5B A;  1TBW A;  3OMU A;  2WI4 A;  4MPN A;  1N32 E;  2UWD A;  3INW A;  4XC0 A;  2YED A;  3CRK A;  4LWG A;  1KIJ A;  4CWN A;  2WER A;  4GEE A;  3ZZ0 A;  4LFA E;  2UXC E;  2JKI A;  3CGY A;  1BYQ A;  1I58 A;  1L0O A;  4DR5 I;  3HHU A;  2YEG A;  1BXD A;  2XDL A;  3GIF A;  4WUB A;  4K0K I;  3MNR P;  5L3J A;  2BU7 A;  3PEH A;  1H73 A;  4LWI A;  3VHD A;  1VIS A;  3A0X A;  3EHJ A;  3HYZ A;  1B62 A;  3T1K A;  2IOP A;  4JI6 I;  3R4N A;  4OX9 I;  4DR5 E;  4P8O A;  4PL9 A;  2E5L I;  4L8Z A;  3IED A;  4HY1 A;  1JM6 A;  4NXM E;  4PRX A;  4JI4 I;  2V2V A;  3DGE A;  3GIG A;  3Q5L A;  3TZ5 A;  1I5D A;  3U2D A;  2XHR A;  4FWH A;  4E02 A;  2HKJ A;  2HKE A;  4HXZ A;  5FLX C;  4LF9 E;  5J6A A;  4H7Q A;  2JJC A;  1NHJ A;  1ZM9 A;  2R42 A;  2V2Q A;  4OX9 E;  2YE3 A;  1GKZ A;  4V25 A;  3PYE A;  2XX5 A;  4DU7 A;  2HG1 A;  5GME A;  4JI4 E;  4DPY A;  4DV5 I;  4LF4 I;  4JI8 I;  4XDM A;  3K60 A;  3PYF A;  2QFO A;  1HNX I;  4W7T A;  4DV3 I;  1OJ4 A;  4HYM A;  1NHI A;  1HR0 I;  4O05 A;  2XDK A;  2UXD I;  4HZ5 A;  2XHT A;  4JG4 A;  4DPW A;  2GQP A;  1FWL A;  3CWV A;  2DEJ A;  4DXL A;  4JI0 I;  4XCL A;  2YE2 A;  4UT4 A;  4YHH I;  2VWC A;  1Y8O A;  2BU8 A;  1N0U A;  3JZ3 A;  3OWB A;  2HCH A;  1HNZ I;  4X64 I;  2VW5 A;  5CTY A;  3ZKD A;  3Q5J A;  1H72 C;  1PVG A;  1HR0 E;  4FPP A;  2FXS A;  1Z0V A;  3GIG B;  2YKB A;  4O09 A;  1H7U A;  4LWF A;  4XIP A;  2ZDX A;  2BU6 A;  4DV0 E;  4WUD A;  5LL6 R;  2BM1 A;  3A0R A;  1NZ0 A;  1YSR A;  3K97 A;  4YKZ A;  4JI7 I;  1N33 I;  2UU9 E;  1HNZ E;  4X64 E;  3J7A M;  2IWS A;  3O2F A;  1YES A;  1GJV A;  5J71 A;  3HYY A;  2HFU A;  3QT8 A;  4LF5 I;  2XJG A;  2UUB E;  1IBK I;  4ASF A;  3NMQ A;  2YE9 A;  2WI5 A;  2UUC I;  2YKC A;  4DZY A;  3BMY A;  1THN A;  1FKA E;  4JQL A;  4URM A;  5F5R A;  4JI7 E;  2QG0 A;  3OPD A;  1I94 I;  4LF8 I;  4JI5 E;  4DUZ I;  4LWH A;  1XNQ I;  2YEJ A;  3EHF A;  5FND A;  4ZKI A;  1BGQ A;  1UYF A;  4HY6 A;  4K4O A;  4X62 E;  3OW6 A;  3U2K A;  5CTW A;  2YI0 A;  3RLR A;  1MU5 A;  1YC4 A;  3B8H A;  4DPX A;  2YEF A;  5LMN E;  2IOR A;  4YY3 I;  4LF7 I;  2BV3 A;  4FWG A;  4DR1 E;  2YE6 A;  4KP4 A;  4LPB A;  1I5B A;  4JI3 E;  1AJ6 A;  5BOC A;  1I94 E;  1U0Z A;  3B25 A;  2E1R A;  2H8M A;  2YEC A;  4MB9 A;  5F3K A;  4MYU A;  4DR4 I;  1YT0 A;  3INX A;  4O04 A;  3Q5K A;  1US7 A;  1UY8 A;  1YET A;  2F4V I;  3D0B A;  2ZKJ A;  4KQV A;  1FNM A;  4GFN A;  4YKW A;  2YI5 A;  1BKN A;  3K98 A;  3A0W A;  4XE2 A;  1RRE A;  4JI1 E;  4GKJ E;  2YEB A;  4DV6 E;  4AWP A;  4L91 A;  4LWE A;  4YKU A;  1I5C A;  4KSH A;  4HYP A;  5D7C A;  3R91 A;  1YC3 A;  4EEH A;  1I5A A;  5FLX Q;  3WHA A;  1DAR A;  1H74 A;  2BRC A;  3TZ0 A;  4CWF A;  4DV7 E;  5BR8 I;  4DR4 E;  5BOD A;  4FW9 A;  4X66 E;  1QYE A;  4LFC I;  4X65 E;  4BIU A;  1FJG I;  4BQJ A;  2HHH I;  2F4V E;  4GKK E;  2YGA A;  4B3S I;  4FCQ A;  1AH8 A;  3EKR A;  4ASB A;  4DV1 I;  2HK3 A;  2YE5 A;  2WW4 A;  3K17 A;  4HXW A;  4YKX A;  4B3M E;  4O0B A;  4USK A;  5LMU E;  4KHP I;  2GFD A;  1UYG A;  3B27 A;  4CWP A;  5BR8 E;  5GMD A;  4B7P A;  3VHC A;  5D6Q A;  1J5E I;  5D7D A;  3D36 A;  1Z0T A;  2IOQ A;  1K47 A;  1AM1 A;  2WI7 A;  4GCZ A;  2WI2 A;  1YER A;  4PRV A;  1Z5A A;  4EM7 A;  2YK2 A;  2OI2 A;  2YE8 A;  2XDS A;  2WEQ A;  2Q8H A;  5IT9 C;  5C93 A;  1S16 A;  4FN5 A;  4MP2 A;  3J80 Q;  1Z0C A;  5IWA I;  2Q8I A;  3ZZU A;  2CCT A;  5CTU A;  4K0K E;  4O07 A;  3R4M A;  4M1K A;  4URO A;  4U7N A;  5M4K A;  1WUU A;  4UTG A;  4BXI A;  1UY6 A;  4DR6 I;  3R92 A;  2VQF I;  4JI6 E;  3B82 A;  2Q2E B;  3TUH A;  1FWK A;  3CRL A;  3ZKB A;  1ZXM A;  4LF6 I;  1N36 I;  2E5L E;  3C11 A;  4U93 A;  3J81 C;  4XD8 A;  2WI1 A;  2BYH A;  4E01 A;  4I3H A;  2YK9 A;  4JV5 I;  1U2R A;  4Q20 A;  3D2R A;  2YE7 A;  1EA6 A;  4PU9 A;  2YJW A;  3VHA A;  1NHH A;  2ZBK B;  4DV4 I;  4QPK A;  3PYG A;  1TC0 A;  3WU6 A;  2IWX A;  4CE1 A;  5M4N A;  4DV5 E;  4LF4 E;  4JI8 E;  4FCR A;  2X7I A;  2CZ9 A;  1HNX E;  2CCU A;  4DV3 E;  2XX2 A;  4XKO A;  2BT0 A;  3PYD A;  2YGF A;  3VAD A;  2UXD E;  4FMT A;  3LPS A;  4DR2 I;  1UYE A;  4XKA A;  4BAE A;  4CWQ A;  3LTO A;  1XMQ I;  4DV2 I;  2QF6 A;  4URN A;  4ED4 A;  4JI0 E;  2CCS A;  4YHH E;  2BTZ A;  3T10 A;  3ZXQ A;  3TTZ A;  2VCI A;  4LP0 A;  2FYP A;  4DUY I;  1U2O A;  3WU5 A;  3HEK A;  1XNR I;  1PKP A;  3WU3 A;  1TIL A;  2Q8G A;  4Z7Y A;  3Q1Q A;  2WI3 A;  4L93 A;  2E0A A;  2VQE I;  1H7S A;  2YI6 A;  1A6F A;  3T1H I;  1XMQ E;  3QT6 A;  4JAV A;  4X9L A;  3T2S A;  3O0I A;  3HUL A;  4B3R I;  1N33 E;  4EGI A;  3FT8 A;  3TZ2 A;  3EHH A;  4LF5 E;  3K1J A;  4CE2 A;  1IBK E;  3JAM C;  4JYA I;  2A2C A;  4KFG A;  1YSZ A;  2XX4 A;  2UUC E;  2XK2 A;  1B63 A;  4R3M A;  4P7A A;  3RLQ A;  2YEI A;  4LF8 E;  1N34 I; 
#chains in the Genus database with same CATH topology
 2C2A A;  4DUZ E;  2DEI A;  4DR3 I;  2IWU A;  1XNQ E;  1UYI A;  4QPJ A;  3BM9 A;  5C0X A;  3LNU A;  3R4P A;  5ELW A;  4IZJ B;  4JI2 I;  3H4L A;  4EFU A;  5IT9 Q;  1R62 A;  1Z0G A;  1IBM I;  4YKR A;  4NXN I;  1S4E A;  2HFS A;  4YY3 E;  4LF7 E;  2XHX A;  2YEA A;  5IDM A;  1ZW9 A;  3KE6 A;  3P76 A;  1TID A;  4AM3 A;  3G7B A;  2NPF A;  3PEJ A;  1Y4U A;  4LFB I;  1B3Q A;  4USM A;  5K36 C;  5K36 D;  2O1T A;  1Z59 A;  4AWQ A;  2EXL A;  4QNK A;  5A2Q C;  1AH6 A;  4HZ0 A;  4MYT A;  1XMO I;  1IBM E;  4ISA A;  3QT5 A;  5D6P A;  5IDJ A;  4OO1 E;  3HZ1 A;  1N32 I;  2R3V A;  1YC1 A;  3A0Y A;  4AS9 A;  4RPF A;  5DNX A;  4AQY I;  3GIE A;  4V26 A;  2XEX A;  2UXC I;  2Z5C B;  1PIE A;  4LFB E;  2XCM A;  2XDX A;  1Z0B A;  2J7K A;  4LFC E;  1FJG E;  1D6T A;  1GKX A;  2BYI A;  2HHH E;  2XDU A;  2CG9 A;  4IFD B;  4B3S E;  2CVE A;  4GGL A;  3CDI A;  3K85 A;  1XMO E;  3L7Z B;  4E00 A;  4DV1 E;  4HAC A;  5C0X B;  5CTX A;  1N0V C;  4ASG A;  5M4H A;  5GGZ A;  1HNW I;  4GT8 A;  3A0Z A;  3RKZ A;  4EMV A;  3B78 A;  4AQY E;  2FWY A;  4KHP E;  1USU A;  1MG7 A;  2EFG A;  4U7O A;  5D7R A;  2BZ5 A;  3G7E A;  3V5R A;  5CF0 A;  1ELO A;  1J5E E;  4MP7 A;  1UDS A;  1UEK A;  2IER A;  1ZM2 A;  4NH7 A;  4MPC A;  4NXM I;  1UYK A;  5K36 A;  2PO0 B;  4H81 A;  2FTK A;  4XIR A;  4XCJ A;  4CWR A;  1HNW E;  3QTF A;  4B6C A;  3ZZT A;  1Y8N A;  5JEN A;  4KSG A;  2BM0 A;  4LF9 I;  2BSM A;  5M4P A;  4DUH A;  1YH8 A;  2HK2 A;  3PRY A;  1UY7 A;  5IWA E;  2NN6 A;  2O1W A;  5FNF A;  2Z5E A;  2LJP A;  2O1V A;  4IZK B;  3T0H A;  1OYP A;  4B3T I;  1Y8P A;  3J7A G;  4FCP A;  2YEH A;  3PS1 A;  2YKE A;  4DR6 E;  4BIZ A;  2VQF E;  4EFT A;  1HK7 A;  3B28 A;  4YKT A;  2YKI A;  1QZR A;  4OO1 C;  2IES A;  4P52 A;  4OO1 D;  2CGE A;  4MPE A;  4LF6 E;  1A4H A;  4CWT A;  1N36 E;  2GS8 A;  3U67 A;  2ZDY A;  5FNC A;  3EKO A;  4HAC B;  2CGF A;  3WQ9 A;  1IBL I;  3B26 A;  2XD6 A;  1YT1 A;  2FWZ A;  2XAB A;  4JV5 E;  2YE4 A;  3H80 A;  4B3T E;  2VCJ A;  1MX0 A;  4DPU A;  3JAM Q;  3OWD A;  1Y5Y A;  3WU4 A;  2WEP A;  4URL A;  4Z7C A;  1KZN A;  3S5T A;  2UUA I;  4MU3 A;  4DV4 E;  2V34 A;  4FWD A;  2BU5 A;  2QG2 A;  4JAU A;  4R1F A;  1ID0 A;  3K99 A;  4XTJ A;  4NH9 A;  2XJJ A;  3OTO I;  2Z5B B;  1OSF A;  3ZM7 A;  1YS3 A;  1Z0W A;  1RR9 A;  2ZM6 I;  1IBL E;  1ZM3 A;  1KTV A;  4J3D A;  4DV0 I;  2Q8F A;  3CGZ A;  1Z0E A;  5M4E A;  1Y60 A;  2YEE A;  2AJ4 A;  2UU9 I;  5JEA F;  2UUA E;  4DR2 E;  5FWK A;  4CE3 A;  5M4M A;  4GQU A;  1YHC A;  4BA1 A;  3J80 C;  1AMW A;  2ESA A;  2NN6 E;  4DV2 E;  3T1Y I;  2H55 A;  4YKY A;  4CWO A;  2C1I A;  3OTO E;  1S14 A;  1XHK A;  3D4J A;  1FI4 A;  2ZM6 E;  1ZM4 A;  2UUB I;  5A2Q Q;  1UYM A;  4DUY E;  4DR7 I;  1QY8 A;  3GON A;  1XNR E;  1ZWH A;  4ZVI A;  1VI7 A;  1UDO A;  3B24 A;  4XKK A;  5DRP A;  4JI5 I;  1I59 A;  2VQE E;  3PS3 A;  2V2Z A;  4NH8 A;  2V8P A;  4XIQ A;  1UYC A;  4MOT A;  4XIT A;  3T1H E;  2XJX A;  3T1Y E;  4AWO A;  2VF3 A;  5IN9 A;  4DPT A;  3M7N D;  3ZXO A;  4MQY A;  4X62 I;  1Z5C A;  4AID A;  4EGK A;  1TH8 A;  4B3R E;  4YKQ A;  3SL2 A;  3QT7 A;  1YT2 A;  2UXB I;  1UYL A;  5LMN I;  4DR7 E;  4WUC A;  2PO1 A;  3A0T A;  4DR1 I;  1OYR A;  3FT5 A;  4R3A A;  4U3D A;  4FW5 A;  4N3O A;  4AIM A;  4JI3 I;  4GQT A;  3T0Z A;  2YGE A;  5CPH A;  3DD6 A;  3RLP A;  4I5S A;  3TZ4 A;  2YJX A;  2YI7 A;  1EI1 A;  1UYD A;  4JYA E;  2JEA B;  4CWS A;  4MBC A;  3R4O A;  1KVK A;  2X36 A;  1TC6 A;  3C0E A;  4QNJ A;  5JEA E;  1ZXN A;  4ASA A;  2UXB E;  1N34 E;  4L94 A;  2YKJ A;  5EL9 A;  4JI1 I;  4GKJ I;  1KKH A;  4DR3 E;  4JAS A;  4E72 A;  4DV6 I;  4EGH A;  4OO1 B;  2PNR A;  4EMD A;  1Y4S A;  4JI2 E;  1UY9 A;  1XXE A;  3M6A A;  2WI6 A;  1UYH A;  4DV7 I;  2O1U A;  4H85 A;  2JE6 A;  2O3Z A;  4DU8 A;  3J81 Q;  4X66 I;  4NXN E;  4IFD F;  1Z5B A;  4X65 I;  2AKP A;  2CH4 A;  3G75 A;  2NN6 C;  2NN6 D;  4GKK I;  2A2D A;  4BQG A;  2BRE A;  5C0X F;  2ZIT A;  4L90 A;  4BA2 A;  3F0N A;  3HZ5 A;  4LFA I;  2BU2 A;  3QDD A;  4B3M I;  3EHG A;  5DRO A;  3V2U C;  5LMU I;  3O6O A;  3FV5 A;  2K5B A;  1TBW A;  2WP8 A;  3OMU A;  2WNR A;  2WI4 A;  4MPN A;  1N32 E;  2UWD A;  3INW A;  4XC0 A;  4MDT A;  2YED A;  3CRK A;  4LWG A;  1KIJ A;  4CWN A;  2WER A;  4GEE A;  3ZZ0 A;  4LFA E;  2UXC E;  1F51 A;  2JKI A;  3CGY A;  2BR2 A;  1BYQ A;  1I58 A;  1L0O A;  4DR5 I;  3HHU A;  2YEG A;  1BXD A;  2JEB A;  2XDL A;  3GIF A;  4WUB A;  4K0K I;  3MNR P;  5L3J A;  2BU7 A;  3PEH A;  1H73 A;  4LWI A;  3VHD A;  1VIS A;  2J65 A;  3A0X A;  3EHJ A;  3HYZ A;  1B62 A;  3T1K A;  2IOP A;  2AE8 A;  4JI6 I;  5JEA C;  3P3G A;  3R4N A;  4OX9 I;  1P42 A;  4DR5 E;  4P8O A;  4PL9 A;  2E5L I;  4L8Z A;  3IED A;  4HY1 A;  1JM6 A;  4NXM E;  4PRX A;  4JI4 I;  2V2V A;  3DGE A;  3GIG A;  3Q5L A;  3TZ5 A;  1I5D A;  3U2D A;  2XHR A;  4FWH A;  4E02 A;  2HKJ A;  2HKE A;  2BA1 D;  4HXZ A;  5FLX C;  4LF9 E;  5J6A A;  2WP8 B;  3B4T A;  4H7Q A;  2JJC A;  1NHJ A;  1ZM9 A;  2R42 A;  2V2Q A;  2PNZ A;  3M85 D;  4OX9 E;  5K36 F;  1GKZ A;  2YE3 A;  4V25 A;  4NBQ A;  3CDJ A;  3PYE A;  2XX5 A;  4DU7 A;  2HG1 A;  1OYS A;  5DRR A;  5GME A;  4JI4 E;  4DPY A;  4DV5 I;  4LF4 I;  2BR2 B;  4JI8 I;  4XDM A;  3K60 A;  3PYF A;  2JEB B;  1HNX I;  2QFO A;  4DV3 I;  1OJ4 A;  4W7T A;  4HYM A;  1NHI A;  1HR0 I;  4O05 A;  2XDK A;  4LCF A;  5K36 B;  2UXD I;  3HJC A;  2XHT A;  4JG4 A;  4DPW A;  2GQP A;  4HZ5 A;  3CYG A;  1FWL A;  3CWV A;  2DEJ A;  4DXL A;  2C39 A;  4JI0 I;  4XCL A;  2YE2 A;  4UT4 A;  4YHH I;  5JEA A;  2NN6 B;  2VWC A;  1Y8O A;  2BU8 A;  1N0U A;  3JZ3 A;  3OWB A;  2HCH A;  1HNZ I;  4X64 I;  2VW5 A;  5CTY A;  3ZKD A;  3Q5J A;  1H72 C;  1PVG A;  1HR0 E;  4FPP A;  3UHM A;  1Z0V A;  4MU0 A;  2FXS A;  3GIG B;  2YKB A;  4O09 A;  1H7U A;  4LWF A;  4XIP A;  2ZDX A;  2GO4 A;  2BA0 D;  2BU6 A;  2C38 A;  4DV0 E;  4WUD A;  5LL6 R;  2BM1 A;  3A0R A;  1NZ0 A;  1YSR A;  3GCM A;  3K97 A;  4YKZ A;  4JI7 I;  1N33 I;  2UU9 E;  1HNZ E;  4X64 E;  3J7A M;  2IWS A;  3PS2 A;  3Q6M A;  3O2F A;  5EKW A;  1YES A;  3P06 A;  1GJV A;  5J71 A;  2C1G A;  3HYY A;  2HFU A;  3QT8 A;  4LF5 I;  2XJG A;  2UUB E;  1IBK I;  4ASF A;  3NMQ A;  2YE9 A;  2WI5 A;  4LOM A;  2UUC I;  2YKC A;  2GO3 A;  4DZY A;  1Y6Z A;  1THN A;  1FKA E;  3BMY A;  4JQL A;  4URM A;  5F5R A;  4JI7 E;  2QG0 A;  3OPD A;  1I94 I;  4LF8 I;  4JI5 E;  4OO1 F;  4DUZ I;  4LWH A;  1XNQ I;  2YEJ A;  1R6M A;  3EHF A;  5FND A;  4ZKI A;  1BGQ A;  1UYF A;  4HY6 A;  4K4O A;  4X62 E;  2HHI A;  3OW6 A;  3U2K A;  5CTW A;  2YI0 A;  3RLR A;  4BA1 B;  1MU5 A;  3U1Y A;  1YC4 A;  3B8H A;  4DPX A;  2YEF A;  5LMN E;  2IOR A;  4YY3 I;  4LF7 I;  2BV3 A;  2Z5C A;  4FWG A;  4DR1 E;  2YE6 A;  4KP4 A;  4LPB A;  1E3H A;  1I5B A;  4JI3 E;  1AJ6 A;  5BOC A;  1I94 E;  1U0Z A;  3B25 A;  4LCH A;  2E1R A;  2H8M A;  2YEC A;  4IFD A;  4MB9 A;  5F3K A;  3L7Z A;  4FW4 A;  4MYU A;  4DR4 I;  1YT0 A;  3GME A;  3INX A;  4O04 A;  4OKG A;  3Q5K A;  1US7 A;  1UY8 A;  1YET A;  2F4V I;  3D0B A;  2ZKJ A;  4KQV A;  1FNM A;  4GFN A;  4YKW A;  2YI5 A;  1BKN A;  3M7N G;  3A0W A;  3K98 A;  4XE2 A;  1RRE A;  4JI1 E;  4GKJ E;  2YEB A;  3P3C A;  4DV6 E;  4AWP A;  4L91 A;  4LWE A;  4YKU A;  1I5C A;  4KSH A;  4HYP A;  5D7C A;  3R91 A;  1YC3 A;  4EEH A;  2JT2 A;  1I5A A;  2PO1 B;  5FLX Q;  3WHA A;  1DAR A;  1H74 A;  4LPF A;  2BRC A;  3TZ0 A;  4DV7 E;  5BR8 I;  4CWF A;  3GLL A;  4DR4 E;  5BOD A;  2PO0 A;  4FW9 A;  4X66 E;  4LFC I;  4X65 E;  1QYE A;  1FJG I;  4BIU A;  4BQJ A;  1RHY A;  2HHH I;  2F4V E;  4GKK E;  2YGA A;  4B3S I;  4FCQ A;  1AH8 A;  3EKR A;  4ASB A;  4DV1 I;  2HK3 A;  2YE5 A;  2WW4 A;  3K17 A;  4HXW A;  4YKX A;  4B3M E;  4O0B A;  4IZK A;  4USK A;  5LMU E;  4KHP I;  4FW7 A;  1UYG A;  2GFD A;  3B27 A;  3LMM A;  4CWP A;  5BR8 E;  5GMD A;  4B7P A;  3VHC A;  5D6Q A;  1J5E I;  5D7D A;  3D36 A;  1Z0T A;  2IOQ A;  1K47 A;  1AM1 A;  2WI7 A;  4GCZ A;  2WI2 A;  1YER A;  4PRV A;  1Z5A A;  4EM7 A;  2JE6 B;  2YK2 A;  2OI2 A;  2YE8 A;  2XDS A;  5JEA D;  2WEQ A;  2Q8H A;  4IFD E;  5IT9 C;  1R6L A;  4BA2 B;  1E3P A;  1IXM A;  1S16 A;  4FN5 A;  4MP2 A;  5C93 A;  3J80 Q;  1Z0C A;  5IWA I;  5C0X E;  3ZZU A;  2CCT A;  2Q8I A;  5CTU A;  4K0K E;  3U1K A;  3NZK A;  4O07 A;  3R4M A;  2PO2 A;  4FW6 A;  4M1K A;  4URO A;  4U7N A;  2C37 A;  5M4K A;  1WUU A;  4UTG A;  4BXI A;  1UY6 A;  4DR6 I;  3R92 A;  2VQF I;  2Z5B A;  4JI6 E;  1UDQ A;  2Q2E B;  2WNR B;  3B82 A;  3TUH A;  1FWK A;  3KRN A;  3CRL A;  3ZKB A;  1ZXM A;  4LF6 I;  4IZJ D;  4MU4 A;  1N36 I;  2E5L E;  3C11 A;  4U93 A;  3J81 C;  4XD8 A;  2WI1 A;  2BYH A;  3P3E A;  1USV A;  4E01 A;  4I3H A;  2YK9 A;  4JV5 I;  1U2R A;  2NN6 F;  4Q20 A;  3D2R A;  2YE7 A;  1EA6 A;  2GQ0 A;  4PU9 A;  5DRQ A;  2YJW A;  4KTN A;  3VHA A;  4U3B A;  1NHH A;  2ZBK B;  4DV4 I;  3HKM A;  4QPK A;  3PYG A;  2PNL A;  2F1D A;  1UDN A;  1TC0 A;  4OZE A;  3WU6 A;  2IWX A;  4CE1 A;  5M4N A;  4DV5 E;  4LF4 E;  4JI8 E;  4FCR A;  2X7I A;  2CZ9 A;  4FW3 A;  1HNX E;  2CCU A;  4DV3 E;  2XX2 A;  4XKO A;  2BT0 A;  3PYD A;  2YGF A;  3VAD A;  2UXD E;  4FMT A;  3LPS A;  4DR2 I;  2PO2 B;  1UYE A;  4XKA A;  4BAE A;  3LTO A;  4CWQ A;  2BA1 G;  2C37 B;  1XMQ I;  4DV2 I;  4IFD D;  4IFD C;  2QF6 A;  4URN A;  4ED4 A;  4JI0 E;  2CCS A;  3M85 G;  4YHH E;  2BTZ A;  3T10 A;  3ZXQ A;  5DNL A;  3TTZ A;  2PNZ B;  2VCI A;  5C0X C;  5C0X D;  2FYP A;  4LP0 A;  3H1C A;  4DUY I;  4IZJ A;  1U2O A;  3WU5 A;  5K36 E;  3HEK A;  1XNR I;  1PKP A;  3WU3 A;  1TIL A;  2Q8G A;  2PNM A;  4Z7Y A;  3Q1Q A;  2JEA A;  2WI3 A;  4L93 A;  2E0A A;  2VQE I;  1H7S A;  4MU1 A;  2YI6 A;  1A6F A;  3T1H I;  1XMQ E;  3QT6 A;  4JAV A;  4X9L A;  3T2S A;  4IS9 A;  3O0I A;  3HUL A;  4B3R I;  1N33 E;  2C39 B;  4OO1 A;  4EGI A;  5JEA B;  3FT8 A;  4LCG A;  3TZ2 A;  3EHH A;  4LF5 E;  3K1J A;  4CE2 A;  1IBK E;  3JAM C;  3Q6N A;  2A2C A;  4JYA I;  4KFG A;  1YSZ A;  2XX4 A;  2UUC E;  2XK2 A;  2VES A;  1B63 A;  2BA0 G;  4R3M A;  4P7A A;  3RLQ A;  2YEI A;  4LF8 E;  2C38 B;  1N34 I; 
#chains in the Genus database with same CATH homology
 2C2A A;  4DUZ E;  2DEI A;  4DR3 I;  2IWU A;  1XNQ E;  1UYI A;  4QPJ A;  3BM9 A;  4EFU A;  3LNU A;  3R4P A;  4IZJ B;  4JI2 I;  3H4L A;  5IT9 Q;  1R62 A;  1Z0G A;  1IBM I;  4YKR A;  4NXN I;  1S4E A;  2HFS A;  4YY3 E;  4LF7 E;  2XHX A;  2YEA A;  5IDM A;  1ZW9 A;  3KE6 A;  1TID A;  3G7B A;  2NPF A;  3PEJ A;  1Y4U A;  4LFB I;  1B3Q A;  4USM A;  2O1T A;  1Z59 A;  4AWQ A;  2EXL A;  1AH6 A;  5A2Q C;  4HZ0 A;  4MYT A;  1XMO I;  1IBM E;  3QT5 A;  5D6P A;  5IDJ A;  3HZ1 A;  1N32 I;  2R3V A;  1YC1 A;  3A0Y A;  4AS9 A;  4RPF A;  4AQY I;  3GIE A;  4V26 A;  2XEX A;  2UXC I;  2Z5C B;  1PIE A;  4LFB E;  2XCM A;  2XDX A;  1Z0B A;  2J7K A;  4LFC E;  1FJG E;  1D6T A;  1GKX A;  2BYI A;  2HHH E;  2XDU A;  2CG9 A;  4B3S E;  4GGL A;  3K85 A;  1XMO E;  4E00 A;  4DV1 E;  4HAC A;  5CTX A;  1N0V C;  4ASG A;  5M4H A;  5GGZ A;  1HNW I;  4GT8 A;  3A0Z A;  3RKZ A;  4EMV A;  3B78 A;  4AQY E;  2FWY A;  4KHP E;  1USU A;  1MG7 A;  2EFG A;  4U7O A;  5D7R A;  2BZ5 A;  3G7E A;  3V5R A;  5CF0 A;  1ELO A;  1J5E E;  4MP7 A;  1UEK A;  1ZM2 A;  4NH7 A;  4MPC A;  4NXM I;  1UYK A;  4H81 A;  4XIR A;  4XCJ A;  4CWR A;  1HNW E;  3QTF A;  4B6C A;  3ZZT A;  1Y8N A;  4KSG A;  2BM0 A;  4LF9 I;  2BSM A;  5M4P A;  4DUH A;  2HK2 A;  3PRY A;  1UY7 A;  5IWA E;  2O1W A;  5FNF A;  2Z5E A;  2LJP A;  2O1V A;  4IZK B;  3T0H A;  4B3T I;  1Y8P A;  3J7A G;  4FCP A;  2YEH A;  4BIZ A;  2YKE A;  4DR6 E;  4EFT A;  2VQF E;  1HK7 A;  3B28 A;  4YKT A;  2YKI A;  1QZR A;  4CWT A;  4MPE A;  4P52 A;  2CGE A;  4LF6 E;  1A4H A;  1N36 E;  2GS8 A;  3U67 A;  2ZDY A;  5FNC A;  3EKO A;  4HAC B;  2CGF A;  3WQ9 A;  1IBL I;  3B26 A;  2XD6 A;  1YT1 A;  2FWZ A;  2XAB A;  4JV5 E;  2YE4 A;  3H80 A;  4B3T E;  2VCJ A;  1MX0 A;  4DPU A;  3JAM Q;  3OWD A;  2WEP A;  3WU4 A;  4URL A;  4Z7C A;  1KZN A;  2UUA I;  4DV4 E;  2V34 A;  4FWD A;  2BU5 A;  2QG2 A;  4JAU A;  4R1F A;  1ID0 A;  3K99 A;  4XTJ A;  4NH9 A;  2XJJ A;  3OTO I;  2Z5B B;  1OSF A;  3ZM7 A;  1YS3 A;  1Z0W A;  2ZM6 I;  1RR9 A;  1IBL E;  1ZM3 A;  1KTV A;  4DV0 I;  2Q8F A;  3CGZ A;  1Z0E A;  5M4E A;  2YEE A;  2AJ4 A;  2UU9 I;  2UUA E;  4DR2 E;  5FWK A;  4CE3 A;  5M4M A;  2PNR A;  1AMW A;  3J80 C;  2ESA A;  2H55 A;  4YKY A;  4DV2 E;  3T1Y I;  4CWO A;  3OTO E;  1S14 A;  1XHK A;  3D4J A;  1FI4 A;  2ZM6 E;  1ZM4 A;  2UUB I;  5A2Q Q;  1UYM A;  4DUY E;  4DR7 I;  1QY8 A;  3GON A;  1XNR E;  1ZWH A;  4ZVI A;  3B24 A;  4XKK A;  4JI5 I;  1I59 A;  2VQE E;  2V2Z A;  4NH8 A;  2V8P A;  4XIQ A;  1UYC A;  4MOT A;  4XIT A;  3T1H E;  2XJX A;  3T1Y E;  4AWO A;  2VF3 A;  5IN9 A;  4DPT A;  3ZXO A;  4X62 I;  1Z5C A;  4EGK A;  1TH8 A;  4B3R E;  4YKQ A;  3SL2 A;  3QT7 A;  1YT2 A;  2UXB I;  1UYL A;  5LMN I;  4DR7 E;  4WUC A;  3A0T A;  4DR1 I;  3FT5 A;  4R3A A;  4GQT A;  4N3O A;  4JI3 I;  3T0Z A;  2YGE A;  5CPH A;  3RLP A;  4I5S A;  3TZ4 A;  2YJX A;  2YI7 A;  1EI1 A;  1UYD A;  4JYA E;  4CWS A;  4MBC A;  3R4O A;  1KVK A;  2X36 A;  1TC6 A;  3C0E A;  1ZXN A;  4ASA A;  2UXB E;  1N34 E;  4L94 A;  2YKJ A;  4JI1 I;  4GKJ I;  1KKH A;  4DR3 E;  4JAS A;  4DV6 I;  4EGH A;  4EMD A;  1Y4S A;  4JI2 E;  1UY9 A;  2WI6 A;  3M6A A;  1UYH A;  4DV7 I;  2O1U A;  4H85 A;  4NXN E;  4DU8 A;  3J81 Q;  4KTN A;  4X66 I;  2CH4 A;  2AKP A;  1Z5B A;  4X65 I;  3G75 A;  4GKK I;  2A2D A;  4BQG A;  2BRE A;  2ZIT A;  4L90 A;  3F0N A;  3HZ5 A;  4LFA I;  2BU2 A;  3QDD A;  4B3M I;  3EHG A;  3O6O A;  3V2U C;  5LMU I;  3FV5 A;  2K5B A;  1TBW A;  3OMU A;  2WI4 A;  4MPN A;  1N32 E;  2UWD A;  3INW A;  4XC0 A;  2YED A;  3CRK A;  4LWG A;  1KIJ A;  4CWN A;  2WER A;  4GEE A;  3ZZ0 A;  4LFA E;  2UXC E;  2JKI A;  3CGY A;  1BYQ A;  1I58 A;  1L0O A;  4DR5 I;  3HHU A;  2YEG A;  1BXD A;  2XDL A;  3GIF A;  4WUB A;  4K0K I;  3MNR P;  5L3J A;  2BU7 A;  3PEH A;  1H73 A;  4LWI A;  3VHD A;  1VIS A;  3A0X A;  3EHJ A;  3HYZ A;  1B62 A;  3T1K A;  2IOP A;  4JI6 I;  3R4N A;  4OX9 I;  4DR5 E;  4P8O A;  4PL9 A;  2E5L I;  4L8Z A;  3IED A;  4HY1 A;  1JM6 A;  4NXM E;  4PRX A;  4JI4 I;  2V2V A;  3DGE A;  3GIG A;  3Q5L A;  3TZ5 A;  1I5D A;  3U2D A;  2XHR A;  4FWH A;  4E02 A;  2HKJ A;  2HKE A;  4HXZ A;  5FLX C;  4LF9 E;  5J6A A;  4H7Q A;  2JJC A;  1NHJ A;  1ZM9 A;  2R42 A;  2V2Q A;  4OX9 E;  2YE3 A;  1GKZ A;  4V25 A;  3PYE A;  2XX5 A;  4DU7 A;  2HG1 A;  5GME A;  4JI4 E;  4DPY A;  4DV5 I;  4LF4 I;  4JI8 I;  4XDM A;  3K60 A;  3PYF A;  2QFO A;  1HNX I;  4W7T A;  4DV3 I;  1OJ4 A;  4HYM A;  1NHI A;  1HR0 I;  4O05 A;  2XDK A;  2UXD I;  3HJC A;  2XHT A;  4JG4 A;  4DPW A;  2GQP A;  4HZ5 A;  1FWL A;  3CWV A;  2DEJ A;  4DXL A;  4JI0 I;  4XCL A;  2YE2 A;  4UT4 A;  4YHH I;  2VWC A;  1Y8O A;  2BU8 A;  1N0U A;  3JZ3 A;  3OWB A;  2HCH A;  1HNZ I;  4X64 I;  2VW5 A;  5CTY A;  3ZKD A;  3Q5J A;  1H72 C;  1PVG A;  1HR0 E;  4FPP A;  2FXS A;  1Z0V A;  3GIG B;  2YKB A;  4O09 A;  1H7U A;  4LWF A;  4XIP A;  2ZDX A;  2BU6 A;  4DV0 E;  4WUD A;  5LL6 R;  2BM1 A;  3A0R A;  1NZ0 A;  1YSR A;  3K97 A;  4YKZ A;  4JI7 I;  1N33 I;  2UU9 E;  1HNZ E;  4X64 E;  3J7A M;  2IWS A;  3Q6M A;  3O2F A;  1YES A;  3P06 A;  1GJV A;  5J71 A;  3HYY A;  2HFU A;  3QT8 A;  4LF5 I;  2XJG A;  2UUB E;  1IBK I;  4ASF A;  3NMQ A;  2YE9 A;  2WI5 A;  2UUC I;  2YKC A;  4DZY A;  1Y6Z A;  1THN A;  1FKA E;  3BMY A;  4JQL A;  4URM A;  5F5R A;  4JI7 E;  2QG0 A;  3OPD A;  1I94 I;  4LF8 I;  4JI5 E;  4DUZ I;  4LWH A;  1XNQ I;  2YEJ A;  3EHF A;  5FND A;  4ZKI A;  1BGQ A;  1UYF A;  4HY6 A;  4K4O A;  4X62 E;  3OW6 A;  3U2K A;  5CTW A;  2YI0 A;  3RLR A;  1MU5 A;  1YC4 A;  3B8H A;  4DPX A;  2YEF A;  5LMN E;  2IOR A;  4YY3 I;  4LF7 I;  2BV3 A;  2Z5C A;  4FWG A;  4DR1 E;  2YE6 A;  4KP4 A;  4LPB A;  1I5B A;  4JI3 E;  1AJ6 A;  5BOC A;  1I94 E;  1U0Z A;  3B25 A;  2E1R A;  2H8M A;  2YEC A;  4MB9 A;  5F3K A;  4MYU A;  4DR4 I;  1YT0 A;  3INX A;  4O04 A;  3Q5K A;  1US7 A;  1UY8 A;  1YET A;  2F4V I;  3D0B A;  2ZKJ A;  4KQV A;  1FNM A;  4GFN A;  4YKW A;  2YI5 A;  1BKN A;  3K98 A;  3A0W A;  4XE2 A;  1RRE A;  4JI1 E;  4GKJ E;  2YEB A;  4DV6 E;  4AWP A;  4L91 A;  4LWE A;  4YKU A;  1I5C A;  4KSH A;  4HYP A;  5D7C A;  3R91 A;  1YC3 A;  4EEH A;  1I5A A;  5FLX Q;  3WHA A;  1DAR A;  1H74 A;  2BRC A;  3TZ0 A;  4CWF A;  4DV7 E;  5BR8 I;  4DR4 E;  5BOD A;  4FW9 A;  4X66 E;  1QYE A;  4LFC I;  4X65 E;  4BIU A;  1FJG I;  4BQJ A;  2HHH I;  2F4V E;  4GKK E;  2YGA A;  4B3S I;  4FCQ A;  1AH8 A;  3EKR A;  4ASB A;  4DV1 I;  2HK3 A;  2YE5 A;  2WW4 A;  3K17 A;  4HXW A;  4YKX A;  4B3M E;  4O0B A;  4IZK A;  4USK A;  5LMU E;  4KHP I;  2GFD A;  1UYG A;  3B27 A;  4CWP A;  5BR8 E;  5GMD A;  4B7P A;  3VHC A;  5D6Q A;  1J5E I;  5D7D A;  3D36 A;  1Z0T A;  2IOQ A;  1K47 A;  1AM1 A;  2WI7 A;  4GCZ A;  2WI2 A;  1YER A;  4PRV A;  1Z5A A;  4EM7 A;  2YK2 A;  2OI2 A;  2YE8 A;  2XDS A;  2WEQ A;  2Q8H A;  5IT9 C;  5C93 A;  1S16 A;  4FN5 A;  4MP2 A;  3J80 Q;  1Z0C A;  5IWA I;  2Q8I A;  3ZZU A;  2CCT A;  5CTU A;  4K0K E;  4O07 A;  3R4M A;  4M1K A;  4URO A;  4U7N A;  5M4K A;  1WUU A;  4UTG A;  4BXI A;  1UY6 A;  4DR6 I;  3R92 A;  2VQF I;  2Z5B A;  4JI6 E;  3B82 A;  2Q2E B;  3TUH A;  1FWK A;  3CRL A;  3ZKB A;  1ZXM A;  4LF6 I;  4IZJ D;  1N36 I;  2E5L E;  3C11 A;  4U93 A;  3J81 C;  4XD8 A;  2WI1 A;  2BYH A;  1USV A;  4E01 A;  4I3H A;  2YK9 A;  4JV5 I;  1U2R A;  4Q20 A;  3D2R A;  2YE7 A;  1EA6 A;  2GQ0 A;  4PU9 A;  2YJW A;  3VHA A;  1NHH A;  2ZBK B;  4DV4 I;  4QPK A;  3PYG A;  2PNL A;  1TC0 A;  3WU6 A;  2IWX A;  4CE1 A;  5M4N A;  4DV5 E;  4LF4 E;  4JI8 E;  4FCR A;  2X7I A;  2CZ9 A;  1HNX E;  2CCU A;  4DV3 E;  2XX2 A;  4XKO A;  2BT0 A;  3PYD A;  2YGF A;  3VAD A;  2UXD E;  4FMT A;  3LPS A;  4DR2 I;  1UYE A;  4XKA A;  4BAE A;  4CWQ A;  3LTO A;  1XMQ I;  4DV2 I;  2QF6 A;  4URN A;  4ED4 A;  4JI0 E;  2CCS A;  4YHH E;  2BTZ A;  3T10 A;  3ZXQ A;  3TTZ A;  2VCI A;  4LP0 A;  2FYP A;  4DUY I;  4IZJ A;  1U2O A;  3WU5 A;  3HEK A;  1XNR I;  1PKP A;  3WU3 A;  1TIL A;  2Q8G A;  2PNM A;  4Z7Y A;  3Q1Q A;  2WI3 A;  4L93 A;  2E0A A;  2VQE I;  1H7S A;  2YI6 A;  1A6F A;  3T1H I;  1XMQ E;  3QT6 A;  4JAV A;  4X9L A;  3T2S A;  3O0I A;  3HUL A;  4B3R I;  1N33 E;  4EGI A;  3FT8 A;  3TZ2 A;  3EHH A;  4LF5 E;  3K1J A;  4CE2 A;  1IBK E;  3JAM C;  3Q6N A;  2A2C A;  4JYA I;  4KFG A;  1YSZ A;  2XX4 A;  2UUC E;  2XK2 A;  1B63 A;  4R3M A;  4P7A A;  3RLQ A;  2YEI A;  4LF8 E;  1N34 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...