1EA6A

N-terminal 40kda fragment of nhpms2 complexed with adp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
338
structure length
304
Chain Sequence
CSGQVVLSLSTAVKELVENSLDAGATNIDLKLKDYGVDLIEVSDNGCGVEEENFEGLTLEALSSLCALSDVTISTCHASAKVGTRLMFDHNGKIIQKTPYPRPRGTTVSVQQLFSTLPVRHKEFQRNIKKEYAKMVQVLHAYCIISAGIRVSCTNQLGQGKRQPVVCTGGSPSIKENIGSVFGQKQLQSLIPFVQLPPSDSVCEEYGLSCSDALHNLFYISGFISQCTHGVGRSSTDRQFFFINRRPCDPAKVCRLVNEVYHMYNRHQYPFVVLNISVDSECVLLQEEKLLLAVLKTSLIGMFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of the N-Terminal 40 kDa Fragment of Human Pms2: A Monomeric Ghl ATPase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna repair
molecule keywords PMS1 PROTEIN HOMOLOG 2
total genus 86
structure length 304
sequence length 338
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01119 DNA_mis_repair DNA mismatch repair protein, C-terminal domain
A PF13589 HATPase_c_3 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1ea6A02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1ea6A01
4I3HA 4GKKI 2XDUA 1BXDA 4BIUA 4RPFA 1J5EE 4LF7E 2VW5A 2FWZA 2YGFA 1FNMA 2BU8A 5GMEA 4LF6I 1XNRE 4CWNA 1TILA 4YY3E 4CWTA 2WEQA 2WI6A 4CWQA 2BRCA 1B63A 4DXLA 3GIGB 5CTXA 4B6CA 5IN9A 4YKXA 2J7KA 2IOPA 2A2CA 5LMNI 4JI1E 3GIFA 1FI4A 5IDMA 4K0KI 2YE7A 4DV1E 1ID0A 2BV3A 1NHIA 1IBLI 1MU5A 3ZZUA 4XC0A 4GKJE 5J6AA 4JI7E 2BU7A 3QTFA 1OSFA 1UY8A 4YHHE 3EKOA 4JI2I 5A2QC 2PNRA 1Y4SA 5A2QQ 2WI3A 5BR8E 1N0UA 4URLA 4DPTA 3VHCA 1N33I 3LNUA 1UYDA 3D2RA 4DR2E 4LFAE 4LFBE 5J71A 2WI1A 3HEKA 3PEHA 4LF5E 1HNXE 4PRXA 1QY8A 4XIQA 4CE2A 3HYZA 4X66E 4B3TI 4NXNI 1PKPA 4LF4E 3ZXOA 1YT0A 4MB9A 5M4MA 2WI7A 4FW9A 4EGHA 2YEBA 2BU2A 1HNWI 3VHAA 4XDMA 4DV4I 2H55A 5CF0A 4GKKE 4DV3I 1YT1A 2E0AA 4MPCA 4P7AA 4L90A 4CWPA 4AWOA 1XNRI 1I5CA 4GEEA 4YY3I 4XIRA 2V34A 1KIJA 3O2FA 1Z0GA 4JYAI 4KSHA 5LL6R 1I5BA 3G7BA 4USKA 3B27A 1N32I 4UROA 5IT9Q 4K0KE 5F5RA 2E5LI 4KHPE 4DV0I 4LF9E 4DUYE 4DV1I 1Z0CA 3PYDA 2YE5A 4LWFA 4K4OA 4LPBA 1IBLE 3U67A 4JI3E 3WU5A 1Z59A 4JI7I 3O0IA 5IWAE 4DR7E 3OWBA 2YEGA 4MP7A 2UUAI 2UXDE 4YHHI 2UXBE 5M4HA 4JI2E 3EHHA 3OW6A 2HK3A 4ASGA 4FCPA 1IBKI 1HNZI 2YECA 2JKIA 5CTWA 4L94A 4L91A 2BU5A 1BYQA 1FWLA 2BTZA 2BU6A 4DR2I 5F3KA 2HG1A 1TBWA 1S16A 4EMDA 2FXSA 4YKWA 2YE8A 3ZZTA 4HYMA 3TZ0A 3WU4A 1R62A 4XITA 2CH4A 4ZVIA 1B3QA 2XHRA 4X64I 4B3TE 4MYTA 4DV5I 4YKQA 2Q8FA 3B82A 3GONA 2YKCA 4EM7A 1ZM4A 4DU8A 1XMQE 4DV6I 4CE1A 2YGEA 4B3SI 3TTZA 1BGQA 2X36A 4B3RI 2HK2A 4DV3E 2QF6A 2YEDA 3R91A 2BREA 1I5AA 3A0RA 4DU7A 4NH8A 2Q8GA 1N36E 4U7OA 1I94E 3F0NA 3A0TA 2YEHA 4W7TA 2JJCA 1UYFA 2F4VE 2VQEE 1K47A 1XMOI 4LF8E 4O07A 4YKTA 2BZ5A 5D7RA 4GCZA 1N32E 4EGKA 4Z7YA 1TIDA 4BXIA 1YETA 4URMA 2E5LE 4KHPI 2WW4A 4FPPA 4LF9I 1NHHA 1S4EA 1Y8OA 4R1FA 4XKKA 1ZM2A 2R3VA 3HHUA 3JAMQ 4XCJA 1US7A 3OMUA 4GT8A 5GMDA 1A4HA 4JI8I 4EMVA 4DR5E 2FYPA 2YE2A 3V2UC 4NXME 3WU6A 2CG9A 4FWDA 2CCUA 2IWSA 2XDKA 4L8ZA 2XCMA 2GFDA 3CRLA 4DR3I 1PIEA 2YEJA 3OTOI 1MG7A 1RR9A 3QT8A 4B3ME 2VWCA 2YKJA 3KE6A 2GQPA 4DZYA 4MYUA 4X62I 4MPEA 2WI4A 3VADA 4DV6E 4FWGA 2BT0A 4KSGA 4JV5I 4B3SE 2UXCE 4JI0E 1S14A 1YSZA 1UYGA 2HFUA 4YKYA 1AJ6A 4E02A 2UUBI 1Z0VA 4BQGA 2VQFE 2HKJA 2YI6A 1ZW9A 1QYEA 1I94I 5GGZA 3INXA 1Y4UA 1QZRA 3INWA 4URNA 1Z0TA 4BAEA 2V8PA 4FN5A 4XIPA 3HZ5A 2UWDA 1ELOA 4DR6E 3T1YE 4DPXA 4DUZE 1GJVA 3GIGA 1Z5BA 2K5BA 1THNA 4DPWA 4XD8A 5FNDA 4X9LA 4BIZA 4L93A 1I58A 2ZKJA 1ZXNA 5CTYA 4AQYE 4OX9E 1AMWA 1PVGA 2QFOA 3WU3A 5C93A 5FNFA 4CWRA 4DR1I 1GKZA 1UYHA 2YK2A 2V2ZA 2XJXA 5LMUI 2YI7A 4NXMI 3NMQA 1H7SA 4LF6E 3Q5KA 3BM9A 3B26A 3A0ZA 1U0ZA 4H81A 4YKUA 2NPFA 3LPSA 1UY9A 2XK2A 4LWEA 5D7DA 2A2DA 3T10A 1XNQE 2HCHA 4O09A 4QPKA 2YEIA 1HR0I 2WI2A 3R4OA 2YGAA 4PRVA 4B3MI 4HACA 3J7AG 4EFUA 1MX0A 3EHFA 3A0YA 3JZ3A 1YESA 3R4NA 4GKJI 3T2SA 2UXCI 4JI0I 4QPJA 3T1KA 5FLXC 2UUBE 4P8OA 1ZXMA 1Y8PA 4WUBA 4CWFA 1EA6A 2ZDXA 1OJ4A 4FCQA 4JAVA 4USMA 5L3JA 2ESAA 4O0BA 3U2KA 2UU9E 2YI5A 4LFAI 2IOQA 4DR6I 3B8HA 4DUZI 4JI5E 4Z7CA 2O1WA 4WUDA 1N0VC 3ZM7A 4CWOA 5M4KA 1TC0A 2EFGA 3K99A 4OX9I 1UYMA 5CTUA 3R4PA 5IT9C 3D36A 3K60A 1AM1A 1BKNA 2DEJA 1Z5CA 4NH7A 4JG4A 3ZXQA 1AH8A 3LTOA 4LWHA 4HXZA 1TC6A 2XX4A 4JI4E 4JYAE 2FWYA 2HHHE 3ZKDA 1TH8A 4GGLA 2XDLA 3B25A 1J5EI 1Z0EA 2IWUA 1H74A 4LF7I 3MNRP 2QG0A 2YE6A 3G75A 4DV0E 2HFSA 4DUYI 3T1HE 2XX2A 2HKEA 4XKOA 4HY6A 1FJGE 3HZ1A 4JI3I 1KTVA 4ASAA 2XJGA 5IWAI 4DR7I 3QT5A 3A0XA 2XD6A 2UXDI 4EFTA 3O6OA 2ZBKB 3QT6A 1HNZE 2O1VA 5IDJA 2CCTA 3B24A 4E00A 2UU9I 3V5RA 4JI6I 1H73A 3HYYA 4DV7E 2YEAA 4V25A 1UYCA 4CE3A 5BODA 4JI5I 1N34E 4GQTA 4AWPA 3CGYA 5FLXQ 1UYIA 4LWGA 4PL9A 4UTGA 5BR8I 3PYEA 1NHJA 1YS3A 4GFNA 4CWSA 1A6FA 4X64E 2AJ4A 4ASBA 4KTNA 4O05A 1I5DA 4M1KA 4LF5I 4BQJA 3OWDA 3J7AM 4UT4A 2H8MA 4YKRA 2DEIA 1VISA 3K98A 1FKAE 4X66I 3JAMC 3T0ZA 3EHGA 4R3AA 2IORA 2YEEA 3QDDA 2YJWA 3T0HA 4JI4I 3IEDA 5M4EA 2F4VI 3B78A 2C2AA 2HHHI 4LF8I 1XMOE 3TZ4A 2YE4A 3PEJA 4XE2A 1L0OA 2Q2EB 4EGIA 3J81Q 2ZITA 1U2OA 3T1HI 1ZWHA 2CZ9A 1YSRA 4E01A 3Q1QA 3H4LA 1FJGI 3OPDA 4FMTA 4DUHA 2UUCI 4EEHA 3RLPA 3HULA 2YE9A 4H85A 2O1UA 4O04A 3K17A 3FT5A 1Z0BA 3C11A 1Z0WA 4HXWA 2BYHA 2CGFA 2YI0A 3D4JA 2Q8IA 3K1JA 4R3MA 4JI6E 2YJXA 2XX5A 2V2VA 4DV7I 2ZDYA 4AS9A 2XHTA 2UUAE 2XJJA 2UXBI 1FWKA 1UYLA 5D7CA 1N34I 3U2DA 5CPHA 4DR3E 1IBKE 2YE3A 2GS8A 1H72C 4PU9A 4MPNA 4H7QA 4X65E 3TZ2A 2V2QA 1KVKA 2VF3A 3DGEA 3BMYA 2Q8HA 4XCLA 3M6AA 2CCSA 2X7IA 4X62E 4JASA 1I59A 3CRKA 1UY6A 1XHKA 4MP2A 3H80A 4DPYA 1AH6A 4JV5E 4KFGA 4U93A 4YKZA 1EI1A 1KKHA 3PYFA 4KQVA 3TZ5A 1Z5AA 1YT2A 1UYKA 2WERA 2WI5A 3EKRA 2VQFI 2ZM6E 4DV5E 4ZKIA 4Q20A 4AWQA 3J80C 2QG2A 1XMQI 3RLQA 4WUCA 1Y8NA 1IBMI 2YK9A 2XDXA 4B3RE 3RKZA 3K97A 3T1YI 1KZNA 2YEFA 4DV2E 1N36I 4DR4E 3TUHA 1DARA 4HACB 1JM6A 2IWXA 2UUCE 2VCIA 5M4PA 4HYPA 1NZ0A 2VQEI 5BOCA 4JQLA 3Q5JA 4ED4A 1UEKA 2VCJA 2BSMA 2R42A 3PYGA 2YKBA 5LMUE 3R92A 4B7PA 5D6QA 4LFCE 1WUUA 2XDSA 2BM0A 2XEXA 4HZ5A 1XNQI 2EXLA 4JI8E 1HR0E 4DR5I 3D0BA 4I5SA 3WQ9A 5FNCA 4X65I 3FV5A 4ASFA 3QT7A 4MBCA 4KP4A 4MOTA 4FCRA 3VHDA 2AKPA 2WEPA 1UY7A 2LJPA 2E1RA 3RLRA 3B28A 4JI1I 5LMNE 3ZZ0A 1D6TA 1YC4A 3C0EA 3OTOE 3SL2A 5FWKA 4HZ0A 4HY1A 3CGZA 2ZM6I 3A0WA 4JAUA 3G7EA 3ZKBA 5D6PA 3GIEA 2BM1A 4V26A 5M4NA 3CWVA 4FWHA 1IBME 1GKXA 1ZM9A 1YC1A 3J80Q 4LP0A 2OI2A 3FT8A 4XTJA 1B62A 4DV2I 4DR4I 1UYEA 3Q5LA 3J81C 4P52A 4U7NA 1N33E 1RREA 4LWIA 1ZM3A 1YERA 4LFBI 3R4MA 1H7UA 1HNXI 2YKIA 3EHJA 4NH9A 4LFCI 4DPUA 1U2RA 2BYIA 2XABA 4LF4I 4NXNE 4XKAA 4AQYI 2XHXA 2YKEA 3WHAA 1YC3A 1HNWE 4DV4E 4DR1E
chains in the Genus database with same CATH superfamily
4I3HA 4GKKI 2XDUA 1BXDA 4BIUA 4RPFA 1J5EE 5C0XF 4LF7E 2VW5A 2FWZA 2YGFA 1FNMA 5DROA 2BU8A 5GMEA 4LF6I 1XNRE 4CWNA 1TILA 4NBQA 4YY3E 4CWTA 2WEQA 3PS2A 2WI6A 4MDTA 4CWQA 2BRCA 1B63A 4DXLA 3GIGB 5CTXA 4B6CA 5IN9A 4YKXA 2IOPA 2J7KA 2F1DA 2A2CA 4LPFA 5LMNI 4JI1E 3GIFA 1FI4A 5IDMA 4K0KI 2WP8B 5K36D 4DV1E 2YE7A 1ID0A 2BV3A 5ELWA 1NHIA 1IBLI 1MU5A 3ZZUA 4XC0A 4GKJE 5J6AA 4JI7E 2BU7A 5C0XE 3QTFA 3Q6MA 1OSFA 1UY8A 3UHMA 4IFDC 4YHHE 3EKOA 4IS9A 4JI2I 5A2QC 2PNRA 4FW4A 1Y4SA 5A2QQ 2WI3A 3R91A 5BR8E 1N0UA 4URLA 4DPTA 3VHCA 3GLLA 1N33I 3LNUA 1UYDA 3D2RA 4DR2E 4LFAE 4LFBE 5J71A 2WI1A 3HEKA 3PEHA 4LF5E 1HNXE 3PS1A 4PRXA 5K36A 1QY8A 1R6LA 4XIQA 4CE2A 2PNZA 3HYZA 4X66E 4B3TI 4NXNI 1PKPA 1UDSA 4LF4E 3ZXOA 1YT0A 4FW5A 1OYPA 4MB9A 5M4MA 2WI7A 4FW9A 4EGHA 2YEBA 2BU2A 1HNWI 5K36C 3VHAA 4XDMA 4DV4I 2H55A 5CF0A 4GKKE 2JEAB 4DV3I 1YT1A 2E0AA 4MPCA 4P7AA 4OO1C 4L90A 4CWPA 4AWOA 2CVEA 1XNRI 1I5CA 4GEEA 4YY3I 4XIRA 3DD6A 2V34A 1KIJA 3O2FA 1Z0GA 2NN6E 4JYAI 4KSHA 5LL6R 1I5BA 3G7BA 4USKA 2BA0G 3B27A 1N32I 4UROA 1VI7A 4BA2B 5IT9Q 4K0KE 5F5RA 2E5LI 1RHYA 4DV0I 4KHPE 4LF9E 4DUYE 5DNLA 4DV1I 2GO4A 1Z0CA 3PYDA 2YE5A 4LWFA 4K4OA 2PO2A 4LPBA 5JENA 1IBLE 3U67A 4JI3E 3WU5A 1Z59A 4JI7I 3O0IA 5IWAE 4DR7E 3OWBA 2YEGA 4MP7A 2UUAI 2UXDE 4YHHI 2UXBE 5M4HA 4JI2E 3EHHA 3OW6A 2HK3A 1UDNA 4ASGA 4FCPA 1IBKI 1HNZI 2YECA 2JKIA 5CTWA 4L94A 2Z5BA 4L91A 2BU5A 1BYQA 1FWLA 2BTZA 2BU6A 4DR2I 5F3KA 2HG1A 1TBWA 1HK7A 1S16A 4EMDA 2VESA 4AIDA 2FXSA 4YKWA 4LOMA 3ZZTA 4HYMA 2YE8A 3TZ0A 3WU4A 1R62A 4XITA 2CH4A 4ZVIA 2PNZB 1B3QA 2XHRA 4X64I 4B3TE 4MYTA 4DV5I 4YKQA 2Q8FA 3B82A 3GONA 2HHIA 2YKCA 4EM7A 1ZM4A 4DU8A 1XMQE 4DV6I 4CE1A 2YGEA 4B3SI 3TTZA 1BGQA 2X36A 4B3RI 2HK2A 4DV3E 3M85G 2QF6A 2YEDA 2BREA 1I5AA 3A0RA 4DU7A 4NH8A 2Q8GA 1N36E 4U7OA 1I94E 3F0NA 3A0TA 2Z5BB 2YEHA 4W7TA 2JJCA 1UYFA 3P3EA 3L7ZA 2F4VE 2VQEE 1K47A 4MU0A 1XMOI 4LF8E 4O07A 2BZ5A 4YKTA 4GCZA 1N32E 2JE6B 5D7RA 3Q6NA 4Z7YA 1TIDA 4EGKA 4BXIA 1YETA 4URMA 2E5LE 4KHPI 2WW4A 4FPPA 4LF9I 1NHHA 1S4EA 3KRNA 1Y8OA 4IFDD 4R1FA 4XKKA 1ZM2A 2R3VA 4OO1F 3HHUA 3JAMQ 4XCJA 4QNKA 1US7A 3OMUA 4GT8A 5GMDA 2PNMA 1A4HA 4MQYA 4JI8I 2JEAA 4DR5E 2Z5EA 4EMVA 2FYPA 2YE2A 2NN6B 3V2UC 4NXME 3WU6A 2CG9A 4FWDA 2CCUA 2GQ0A 2IWSA 2XDKA 4L8ZA 2XCMA 2GFDA 3CRLA 4LCHA 4DR3I 2C37A 1PIEA 2YEJA 4BA2A 3OTOI 1MG7A 1RR9A 3QT8A 4B3ME 2VWCA 5K36F 5JEAF 2GQPA 2YKJA 2Z5CA 4DZYA 4MYUA 4MU4A 4X62I 4MPEA 2WI4A 3VADA 4DV6E 4FWGA 2C39B 2BT0A 4KSGA 4JV5I 4B3SE 2UXCE 4JI0E 1S14A 1YSZA 1UYGA 2HFUA 4IFDF 1AJ6A 4YKYA 4E02A 4U3BA 1Z0VA 2UUBI 4BQGA 2VQFE 2YI6A 1ZW9A 1QYEA 1I94I 5GGZA 4AIMA 1Y4UA 1QZRA 3INXA 3INWA 4URNA 1Z0TA 4BAEA 1USUA 2V8PA 4FN5A 5DNXA 3HZ5A 2UWDA 4BA1B 2GO3A 4XIPA 1ELOA 4DR6E 3T1YE 2JE6A 4DPXA 4DUZE 1GJVA 3GIGA 1Z5BA 2K5BA 1THNA 2WNRB 4DPWA 4XD8A 5FNDA 4X9LA 4IZJA 4BIZA 4N3OA 4L93A 1I58A 2ZKJA 1ZXNA 5CTYA 4AQYE 4OX9E 1AMWA 5JEAD 1PVGA 2QFOA 3WU3A 5C93A 5FNFA 3PRYA 4CWRA 4DR1I 1YH8A 1GKZA 1UYHA 2YK2A 2V2ZA 2XJXA 5LMUI 2YI7A 2NN6A 4NXMI 3NMQA 1H7SA 4LF6E 3Q5KA 3BM9A 3B26A 3A0ZA 1U0ZA 4H81A 4YKUA 2NPFA 3LPSA 5C0XA 1UY9A 2XK2A 4LWEA 2A2DA 5D7DA 1XNQE 3T10A 2HCHA 4O09A 4QPKA 2YEIA 1HR0I 2WI2A 3R4OA 2O3ZA 2PO1A 2YGAA 2JT2A 4PRVA 4B3MI 4HACA 3J7AG 2J65A 4EFUA 1MX0A 3EHFA 3A0YA 4IZJB 1YESA 3JZ3A 3R4NA 2C39A 4GKJI 2UXCI 4JI0I 4QPJA 3T2SA 3T1KA 5FLXC 3M7NG 2UUBE 3S5TA 4P8OA 1ZXMA 2PO0A 1Y8PA 4WUBA 4CWFA 3H1CA 1EA6A 2ZDXA 1OJ4A 4FCQA 4JAVA 4USMA 5L3JA 2ESAA 4O0BA 3U2KA 4OZEA 2UU9E 2YI5A 5C0XC 4LFAI 2IOQA 4BA1A 4DR6I 1R6MA 2IESA 3B8HA 4DUZI 4JI5E 2FTKA 2O1WA 4Z7CA 4J3DA 4WUDA 1IXMA 1N0VC 3ZM7A 3CDIA 4CWOA 5M4KA 2Z5CB 1TC0A 2EFGA 4FW6A 5JEAC 3K99A 1USVA 4OX9I 1UYMA 5CTUA 2PO2B 5IT9C 3D36A 3U1YA 3R4PA 3K60A 4OO1A 3U1KA 1BKNA 1AM1A 2O1TA 2DEJA 1Z5CA 4NH7A 4JG4A 3ZXQA 1AH8A 3LTOA 4LWHA 4HXZA 1TC6A 2XX4A 4JI4E 4JYAE 2FWYA 2HHHE 3ZKDA 1TH8A 4GGLA 2XDLA 4MU3A 4GQUA 3B25A 1J5EI 1Z0EA 2IWUA 1H74A 4LF7I 4LCGA 3MNRP 4OO1E 2QG0A 2YE6A 4DV0E 2HFSA 3G75A 4DUYI 3T1HE 2XX2A 2HKEA 4OO1D 4XKOA 4HY6A 4IZKA 1FJGE 3HZ1A 4JI3I 1KTVA 4ASAA 2XJGA 5IWAI 4DR7I 4E72A 3QT5A 3A0XA 2XD6A 2UXDI 4EFTA 4IFDA 2ZBKB 3O6OA 3QT6A 2O1VA 1HNZE 5IDJA 2CCTA 3B24A 4E00A 2UU9I 3V5RA 4JI6I 1H73A 3HYYA 4DV7E 2YEAA 3GCMA 4V25A 5C0XB 1UYCA 4CE3A 3L7ZB 5BODA 4JI5I 1N34E 4GQTA 4AWPA 3CGYA 5FLXQ 1UYIA 4LWGA 3B4TA 4PL9A 4UTGA 5BR8I 3PYEA 1NHJA 1YS3A 4GFNA 4CWSA 1A6FA 4X64E 2AJ4A 4ASBA 4KTNA 4O05A 1I5DA 4M1KA 3P06A 4LF5I 4BQJA 3OWDA 5K36E 3J7AM 4UT4A 2H8MA 3CDJA 4YKRA 2DEIA 1VISA 1Y6ZA 3K98A 1FKAE 4X66I 2PO0B 4LCFA 3JAMC 3T0ZA 3EHGA 4R3AA 2IORA 2YEEA 3QDDA 2YJWA 3T0HA 4JI4I 3IEDA 2NN6F 5M4EA 2F4VI 3B78A 2C2AA 2HHHI 4LF8I 1XMOE 3TZ4A 2YE4A 3PEJA 4XE2A 1L0OA 2Q2EB 4EGIA 3J81Q 3HJCA 4ISAA 2ZITA 1U2OA 3T1HI 1ZWHA 2CZ9A 1YSRA 3M85D 4E01A 3Q1QA 3H4LA 1FJGI 3OPDA 4FMTA 4DUHA 5K36B 2UUCI 4EEHA 3RLPA 3HULA 2YE9A 4H85A 2O1UA 4O04A 3K17A 1UDOA 3FT5A 1Z0BA 3C11A 5DRQA 1Z0WA 4HXWA 2BYHA 2CGFA 2YI0A 3D4JA 2Q8IA 3K1JA 4R3MA 4JI6E 2YJXA 2BA1D 2XX5A 3K85A 2V2VA 4DV7I 2ZDYA 1YHCA 2XHTA 4AS9A 2UUAE 2XJJA 2UXBI 1FWKA 1UYLA 5D7CA 1N34I 3P3GA 3U2DA 5CPHA 4DR3E 1IBKE 2YE3A 2GS8A 1H72C 2NN6D 4PU9A 4MPNA 4H7QA 4X65E 3TZ2A 2V2QA 1KVKA 2VF3A 3DGEA 3BMYA 2Q8HA 4XCLA 2WNRA 3M6AA 4IZJD 4FW3A 2X7IA 4X62E 2CGEA 1I59A 2CCSA 3CRKA 2BA0D 4JASA 1UY6A 1XHKA 4MP2A 3H80A 4DPYA 5JEAA 1AH6A 4JV5E 4KFGA 4U93A 4YKZA 1EI1A 1F51A 1KKHA 3PYFA 3GMEA 4KQVA 3TZ5A 1Z5AA 1YT2A 1UYKA 2WERA 2WI5A 3EKRA 2VQFI 5JEAE 2ZM6E 4DV5E 4ZKIA 4Q20A 4AWQA 3J80C 2QG2A 1XMQI 4FW7A 3RLQA 4WUCA 1Y8NA 1IBMI 2YK9A 2XDXA 2BR2A 4B3RE 3RKZA 2C1IA 3K97A 3T1YI 1KZNA 2JEBA 2YEFA 4DV2E 1N36I 2C38A 5DRPA 4DR4E 2PO1B 3TUHA 1DARA 4HACB 4OKGA 1JM6A 2IWXA 2UUCE 2VCIA 5M4PA 4HYPA 1NZ0A 2AE8A 2VQEI 1OYSA 5BOCA 4JQLA 3Q5JA 4ED4A 3NZKA 1UEKA 2VCJA 2BSMA 2R42A 3PYGA 2YKBA 5LMUE 3R92A 4B7PA 3M7ND 5D6QA 4LFCE 3P3CA 5EKWA 1WUUA 1E3PA 3HKMA 2XDSA 2BM0A 4DV4E 1P42A 2XEXA 2IERA 2NN6C 1XNQI 4HZ5A 1Y60A 2EXLA 4JI8E 1HR0E 4DR5I 4MU1A 3D0BA 4I5SA 3WQ9A 5FNCA 4U3DA 4X65I 4IFDE 3FV5A 4ASFA 2C38B 3QT7A 4MBCA 4KP4A 4MOTA 4FCRA 3VHDA 2AKPA 2WEPA 3LMMA 1UY7A 2LJPA 2E1RA 3RLRA 3CYGA 3B28A 4JI1I 5LMNE 3ZZ0A 1D6TA 5FWKA 1YC4A 3OTOE 3C0EA 3SL2A 2WP8A 4QNJA 4OO1B 4HZ0A 4HY1A 3CGZA 2ZM6I 3A0WA 4JAUA 3G7EA 3ZKBA 5D6PA 3GIEA 2BM1A 4V26A 5M4NA 3CWVA 4FWHA 1IBME 1GKXA 5DRRA 5C0XD 1ZM9A 1OYRA 2BR2B 1YC1A 3J80Q 4LP0A 2OI2A 3FT8A 4XTJA 2JEBB 3P76A 1B62A 4DV2I 2C1GA 4DR4I 1UYEA 3Q5LA 3J81C 4P52A 4U7NA 1N33E 1RREA 5EL9A 1E3HA 4LWIA 1ZM3A 1YERA 4LFBI 2C37B 3KE6A 3R4MA 1H7UA 4IZKB 1HNXI 5JEAB 2PNLA 2YKIA 1Y5YA 3PS3A 3EHJA 4NH9A 1UDQA 4LFCI 4DPUA 4AM3A 1U2RA 2BYIA 2XABA 1XXEA 4LF4I 4NXNE 4IFDB 4XKAA 2BA1G 4AQYI 2XHXA 2YKEA 3WHAA 1YC3A 1HNWE 2HKJA 4DR1E
chains in the Genus database with same CATH topology
4I3HA 4GKKI 2XDUA 1BXDA 4BIUA 4RPFA 1J5EE 4LF7E 2VW5A 2FWZA 2YGFA 1FNMA 2BU8A 5GMEA 4LF6I 1XNRE 4CWNA 1TILA 4YY3E 4CWTA 2WEQA 2WI6A 4CWQA 2BRCA 1B63A 4DXLA 3GIGB 5CTXA 4B6CA 5IN9A 4YKXA 2IOPA 2J7KA 2A2CA 5LMNI 4JI1E 3GIFA 1FI4A 5IDMA 4K0KI 2YE7A 4DV1E 1ID0A 2BV3A 1NHIA 1IBLI 1MU5A 3ZZUA 4XC0A 4GKJE 5J6AA 4JI7E 2BU7A 3QTFA 3Q6MA 1OSFA 1UY8A 4YHHE 3EKOA 4JI2I 5A2QC 2PNRA 1Y4SA 5A2QQ 2WI3A 5BR8E 1N0UA 4URLA 4DPTA 3VHCA 1N33I 3LNUA 1UYDA 3D2RA 4DR2E 4LFAE 4LFBE 5J71A 2WI1A 3HEKA 3PEHA 4LF5E 1HNXE 4PRXA 1QY8A 4XIQA 4CE2A 3HYZA 4X66E 4B3TI 4NXNI 1PKPA 4LF4E 3ZXOA 1YT0A 4MB9A 5M4MA 2WI7A 4FW9A 4EGHA 2YEBA 2BU2A 1HNWI 3VHAA 4XDMA 4DV4I 2H55A 5CF0A 4GKKE 4DV3I 1YT1A 2E0AA 4MPCA 4P7AA 4L90A 4CWPA 4AWOA 1XNRI 1I5CA 4GEEA 4YY3I 4XIRA 2V34A 1KIJA 3O2FA 1Z0GA 4JYAI 4KSHA 5LL6R 1I5BA 3G7BA 4USKA 3B27A 1N32I 4UROA 5IT9Q 4K0KE 5F5RA 2E5LI 4KHPE 4DV0I 4LF9E 4DUYE 4DV1I 1Z0CA 3PYDA 2YE5A 4LWFA 4K4OA 4LPBA 1IBLE 3U67A 4JI3E 3WU5A 1Z59A 4JI7I 3O0IA 5IWAE 4DR7E 3OWBA 2YEGA 4MP7A 2UUAI 2UXDE 4YHHI 2UXBE 5M4HA 4JI2E 3EHHA 3OW6A 2HK3A 4ASGA 4FCPA 1IBKI 1HNZI 2YECA 2JKIA 5CTWA 4L94A 2Z5BA 4L91A 2BU5A 1BYQA 1FWLA 2BTZA 2BU6A 4DR2I 5F3KA 2HG1A 1TBWA 1HK7A 1S16A 4EMDA 2FXSA 4YKWA 2YE8A 3ZZTA 4HYMA 3TZ0A 3WU4A 1R62A 4XITA 2CH4A 4ZVIA 1B3QA 2XHRA 4X64I 4B3TE 4MYTA 4DV5I 4YKQA 2Q8FA 3B82A 3GONA 2YKCA 4EM7A 1ZM4A 4DU8A 1XMQE 4DV6I 4CE1A 2YGEA 4B3SI 3TTZA 1BGQA 2X36A 4B3RI 2HK2A 4DV3E 2QF6A 2YEDA 3R91A 2BREA 1I5AA 3A0RA 4DU7A 4NH8A 2Q8GA 1N36E 4U7OA 1I94E 3F0NA 3A0TA 2Z5BB 2YEHA 4W7TA 2JJCA 1UYFA 2F4VE 2VQEE 1K47A 1XMOI 4LF8E 4O07A 4YKTA 2BZ5A 5D7RA 4GCZA 1N32E 4EGKA 3Q6NA 4Z7YA 1TIDA 4BXIA 1YETA 4URMA 2E5LE 4KHPI 2WW4A 4FPPA 4LF9I 1NHHA 1S4EA 1Y8OA 4R1FA 4XKKA 1ZM2A 2R3VA 3HHUA 3JAMQ 4XCJA 1US7A 3OMUA 4GT8A 5GMDA 2PNMA 1A4HA 4JI8I 4EMVA 4DR5E 2Z5EA 2FYPA 2YE2A 3V2UC 4NXME 3WU6A 2CG9A 4FWDA 2CCUA 2GQ0A 2IWSA 2XDKA 4L8ZA 2XCMA 2GFDA 3CRLA 4DR3I 1PIEA 2YEJA 3OTOI 1MG7A 1RR9A 3QT8A 4B3ME 2VWCA 2YKJA 3KE6A 2GQPA 2Z5CA 4DZYA 4MYUA 4X62I 4MPEA 2WI4A 3VADA 4DV6E 4FWGA 2BT0A 4KSGA 4JV5I 4B3SE 2UXCE 4JI0E 1S14A 1YSZA 1UYGA 2HFUA 4YKYA 1AJ6A 4E02A 2UUBI 1Z0VA 4BQGA 2VQFE 2HKJA 2YI6A 1ZW9A 1QYEA 1I94I 5GGZA 3INXA 1Y4UA 1QZRA 3INWA 4URNA 1Z0TA 4BAEA 1USUA 2V8PA 4FN5A 4XIPA 3HZ5A 2UWDA 1ELOA 4DR6E 3T1YE 4DPXA 4DUZE 1GJVA 3GIGA 1Z5BA 2K5BA 1THNA 4DPWA 4XD8A 5FNDA 4X9LA 4IZJA 4BIZA 4N3OA 4L93A 1I58A 2ZKJA 1ZXNA 5CTYA 4AQYE 4OX9E 1AMWA 1PVGA 2QFOA 3WU3A 5C93A 5FNFA 3PRYA 4CWRA 4DR1I 1GKZA 1UYHA 2YK2A 2V2ZA 2XJXA 5LMUI 2YI7A 4NXMI 3NMQA 1H7SA 4LF6E 3Q5KA 3BM9A 3B26A 3A0ZA 1U0ZA 4H81A 4YKUA 2NPFA 3LPSA 1UY9A 2XK2A 4LWEA 5D7DA 2A2DA 3T10A 1XNQE 2HCHA 4O09A 4QPKA 2YEIA 1HR0I 2WI2A 3R4OA 2YGAA 4PRVA 4B3MI 4HACA 3J7AG 4EFUA 1MX0A 3EHFA 3A0YA 4IZJB 1YESA 3JZ3A 3R4NA 4GKJI 3T2SA 2UXCI 4JI0I 4QPJA 3T1KA 5FLXC 2UUBE 4P8OA 1ZXMA 1Y8PA 4WUBA 4CWFA 1EA6A 2ZDXA 1OJ4A 4FCQA 4JAVA 4USMA 5L3JA 2ESAA 4O0BA 3U2KA 2UU9E 2YI5A 4LFAI 2IOQA 4DR6I 3B8HA 4DUZI 4JI5E 2O1WA 4Z7CA 4WUDA 1N0VC 3ZM7A 4CWOA 5M4KA 2Z5CB 1TC0A 2EFGA 3K99A 1USVA 4OX9I 1UYMA 5CTUA 3R4PA 5IT9C 3D36A 3K60A 1AM1A 1BKNA 2O1TA 2DEJA 1Z5CA 4NH7A 4JG4A 3ZXQA 1AH8A 3LTOA 4LWHA 4HXZA 1TC6A 2XX4A 4JI4E 4JYAE 2FWYA 2HHHE 3ZKDA 1TH8A 4GGLA 2XDLA 3B25A 1J5EI 1Z0EA 2IWUA 1H74A 4LF7I 3MNRP 2QG0A 2YE6A 3G75A 4DV0E 2HFSA 4DUYI 3T1HE 2XX2A 2HKEA 4XKOA 4HY6A 4IZKA 1FJGE 3HZ1A 4JI3I 1KTVA 4ASAA 2XJGA 5IWAI 4DR7I 3QT5A 3A0XA 2XD6A 2UXDI 4EFTA 3O6OA 2ZBKB 3QT6A 2O1VA 1HNZE 5IDJA 2CCTA 3B24A 4E00A 2UU9I 3V5RA 4JI6I 1H73A 3HYYA 4DV7E 2YEAA 4V25A 1UYCA 4CE3A 5BODA 4JI5I 1N34E 4GQTA 4AWPA 3CGYA 5FLXQ 1UYIA 4LWGA 4PL9A 4UTGA 5BR8I 3PYEA 1NHJA 1YS3A 4GFNA 4CWSA 1A6FA 4X64E 2AJ4A 4ASBA 4KTNA 4O05A 1I5DA 4M1KA 3P06A 4LF5I 4BQJA 3OWDA 3J7AM 4UT4A 2H8MA 4YKRA 2DEIA 1VISA 1Y6ZA 3K98A 1FKAE 4X66I 3JAMC 3T0ZA 3EHGA 4R3AA 2IORA 2YEEA 3QDDA 2YJWA 3T0HA 4JI4I 3IEDA 5M4EA 2F4VI 3B78A 2C2AA 2HHHI 4LF8I 1XMOE 3TZ4A 2YE4A 3PEJA 4XE2A 1L0OA 2Q2EB 4EGIA 3J81Q 3HJCA 2ZITA 1U2OA 3T1HI 1ZWHA 2CZ9A 1YSRA 4E01A 3Q1QA 3H4LA 1FJGI 3OPDA 4FMTA 4DUHA 2UUCI 4EEHA 3RLPA 3HULA 2YE9A 4H85A 2O1UA 4O04A 3K17A 3FT5A 1Z0BA 3C11A 1Z0WA 4HXWA 2BYHA 2CGFA 2YI0A 3D4JA 2Q8IA 3K1JA 4R3MA 4JI6E 2YJXA 2XX5A 3K85A 4DV7I 2V2VA 2ZDYA 2XHTA 4AS9A 2UUAE 2XJJA 2UXBI 1FWKA 1UYLA 5D7CA 1N34I 3U2DA 5CPHA 4DR3E 1IBKE 2YE3A 2GS8A 1H72C 4PU9A 4MPNA 4H7QA 4X65E 3TZ2A 2V2QA 1KVKA 2VF3A 3DGEA 3BMYA 2Q8HA 4XCLA 3M6AA 4IZJD 2CCSA 2X7IA 4X62E 2CGEA 1I59A 3CRKA 4JASA 1UY6A 1XHKA 4MP2A 3H80A 4DPYA 1AH6A 4JV5E 4KFGA 4U93A 4YKZA 1EI1A 1KKHA 3PYFA 4KQVA 3TZ5A 1Z5AA 1YT2A 1UYKA 2WERA 2WI5A 3EKRA 2VQFI 2ZM6E 4DV5E 4ZKIA 4Q20A 4AWQA 3J80C 2QG2A 1XMQI 3RLQA 4WUCA 1Y8NA 1IBMI 2YK9A 2XDXA 4B3RE 3RKZA 3K97A 3T1YI 1KZNA 2YEFA 4DV2E 1N36I 4DR4E 3TUHA 1DARA 4HACB 1JM6A 2IWXA 2UUCE 2VCIA 5M4PA 4HYPA 1NZ0A 2VQEI 5BOCA 4JQLA 3Q5JA 4ED4A 1UEKA 2VCJA 2BSMA 2R42A 3PYGA 2YKBA 5LMUE 3R92A 4B7PA 5D6QA 4LFCE 1WUUA 2XDSA 2BM0A 2XEXA 4HZ5A 1XNQI 2EXLA 4JI8E 1HR0E 4DR5I 3D0BA 4I5SA 3WQ9A 5FNCA 4X65I 3FV5A 4ASFA 3QT7A 4MBCA 4KP4A 4MOTA 4FCRA 3VHDA 2AKPA 2WEPA 1UY7A 2LJPA 2E1RA 3RLRA 3B28A 4JI1I 5LMNE 3ZZ0A 1D6TA 5FWKA 1YC4A 3OTOE 3C0EA 3SL2A 4HZ0A 4HY1A 3CGZA 2ZM6I 3A0WA 4JAUA 3G7EA 3ZKBA 5D6PA 3GIEA 2BM1A 4V26A 5M4NA 3CWVA 4FWHA 1IBME 1GKXA 1ZM9A 1YC1A 3J80Q 4LP0A 2OI2A 3FT8A 4XTJA 1B62A 4DV2I 4DR4I 1UYEA 3Q5LA 3J81C 4P52A 4U7NA 1N33E 1RREA 4LWIA 1ZM3A 1YERA 4LFBI 3R4MA 1H7UA 4IZKB 1HNXI 2PNLA 2YKIA 3EHJA 4NH9A 4LFCI 4DPUA 1U2RA 2BYIA 2XABA 4LF4I 4NXNE 4XKAA 4AQYI 2XHXA 2YKEA 3WHAA 1YC3A 1HNWE 4DV4E 4DR1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I3H A;  4GKK I;  2XDU A;  1BXD A;  4BIU A;  4RPF A;  1J5E E;  4LF7 E;  2VW5 A;  2FWZ A;  2YGF A;  1FNM A;  2BU8 A;  5GME A;  4LF6 I;  1XNR E;  4CWN A;  1TIL A;  4YY3 E;  4CWT A;  2WEQ A;  2WI6 A;  4CWQ A;  2BRC A;  1B63 A;  4DXL A;  3GIG B;  5CTX A;  4B6C A;  5IN9 A;  4YKX A;  2J7K A;  2IOP A;  2A2C A;  5LMN I;  4JI1 E;  3GIF A;  1FI4 A;  5IDM A;  4K0K I;  2YE7 A;  4DV1 E;  1ID0 A;  2BV3 A;  1NHI A;  1IBL I;  1MU5 A;  3ZZU A;  4XC0 A;  4GKJ E;  5J6A A;  4JI7 E;  2BU7 A;  3QTF A;  1OSF A;  1UY8 A;  4YHH E;  3EKO A;  4JI2 I;  5A2Q C;  2PNR A;  1Y4S A;  5A2Q Q;  2WI3 A;  5BR8 E;  1N0U A;  4URL A;  4DPT A;  3VHC A;  1N33 I;  3LNU A;  1UYD A;  3D2R A;  4DR2 E;  4LFA E;  4LFB E;  5J71 A;  2WI1 A;  3HEK A;  3PEH A;  4LF5 E;  1HNX E;  4PRX A;  1QY8 A;  4XIQ A;  4CE2 A;  3HYZ A;  4X66 E;  4B3T I;  4NXN I;  1PKP A;  4LF4 E;  3ZXO A;  1YT0 A;  4MB9 A;  5M4M A;  2WI7 A;  4FW9 A;  4EGH A;  2YEB A;  2BU2 A;  1HNW I;  3VHA A;  4XDM A;  4DV4 I;  2H55 A;  5CF0 A;  4GKK E;  4DV3 I;  1YT1 A;  2E0A A;  4MPC A;  4P7A A;  4L90 A;  4CWP A;  4AWO A;  1XNR I;  1I5C A;  4GEE A;  4YY3 I;  4XIR A;  2V34 A;  1KIJ A;  3O2F A;  1Z0G A;  4JYA I;  4KSH A;  5LL6 R;  1I5B A;  3G7B A;  4USK A;  3B27 A;  1N32 I;  4URO A;  5IT9 Q;  4K0K E;  5F5R A;  2E5L I;  4KHP E;  4DV0 I;  4LF9 E;  4DUY E;  4DV1 I;  1Z0C A;  3PYD A;  2YE5 A;  4LWF A;  4K4O A;  4LPB A;  1IBL E;  3U67 A;  4JI3 E;  3WU5 A;  1Z59 A;  4JI7 I;  3O0I A;  5IWA E;  4DR7 E;  3OWB A;  2YEG A;  4MP7 A;  2UUA I;  2UXD E;  4YHH I;  2UXB E;  5M4H A;  4JI2 E;  3EHH A;  3OW6 A;  2HK3 A;  4ASG A;  4FCP A;  1IBK I;  1HNZ I;  2YEC A;  2JKI A;  5CTW A;  4L94 A;  4L91 A;  2BU5 A;  1BYQ A;  1FWL A;  2BTZ A;  2BU6 A;  4DR2 I;  5F3K A;  2HG1 A;  1TBW A;  1S16 A;  4EMD A;  2FXS A;  4YKW A;  2YE8 A;  3ZZT A;  4HYM A;  3TZ0 A;  3WU4 A;  1R62 A;  4XIT A;  2CH4 A;  4ZVI A;  1B3Q A;  2XHR A;  4X64 I;  4B3T E;  4MYT A;  4DV5 I;  4YKQ A;  2Q8F A;  3B82 A;  3GON A;  2YKC A;  4EM7 A;  1ZM4 A;  4DU8 A;  1XMQ E;  4DV6 I;  4CE1 A;  2YGE A;  4B3S I;  3TTZ A;  1BGQ A;  2X36 A;  4B3R I;  2HK2 A;  4DV3 E;  2QF6 A;  2YED A;  3R91 A;  2BRE A;  1I5A A;  3A0R A;  4DU7 A;  4NH8 A;  2Q8G A;  1N36 E;  4U7O A;  1I94 E;  3F0N A;  3A0T A;  2YEH A;  4W7T A;  2JJC A;  1UYF A;  2F4V E;  2VQE E;  1K47 A;  1XMO I;  4LF8 E;  4O07 A;  4YKT A;  2BZ5 A;  5D7R A;  4GCZ A;  1N32 E;  4EGK A;  4Z7Y A;  1TID A;  4BXI A;  1YET A;  4URM A;  2E5L E;  4KHP I;  2WW4 A;  4FPP A;  4LF9 I;  1NHH A;  1S4E A;  1Y8O A;  4R1F A;  4XKK A;  1ZM2 A;  2R3V A;  3HHU A;  3JAM Q;  4XCJ A;  1US7 A;  3OMU A;  4GT8 A;  5GMD A;  1A4H A;  4JI8 I;  4EMV A;  4DR5 E;  2FYP A;  2YE2 A;  3V2U C;  4NXM E;  3WU6 A;  2CG9 A;  4FWD A;  2CCU A;  2IWS A;  2XDK A;  4L8Z A;  2XCM A;  2GFD A;  3CRL A;  4DR3 I;  1PIE A;  2YEJ A;  3OTO I;  1MG7 A;  1RR9 A;  3QT8 A;  4B3M E;  2VWC A;  2YKJ A;  3KE6 A;  2GQP A;  4DZY A;  4MYU A;  4X62 I;  4MPE A;  2WI4 A;  3VAD A;  4DV6 E;  4FWG A;  2BT0 A;  4KSG A;  4JV5 I;  4B3S E;  2UXC E;  4JI0 E;  1S14 A;  1YSZ A;  1UYG A;  2HFU A;  4YKY A;  1AJ6 A;  4E02 A;  2UUB I;  1Z0V A;  4BQG A;  2VQF E;  2HKJ A;  2YI6 A;  1ZW9 A;  1QYE A;  1I94 I;  5GGZ A;  3INX A;  1Y4U A;  1QZR A;  3INW A;  4URN A;  1Z0T A;  4BAE A;  2V8P A;  4FN5 A;  4XIP A;  3HZ5 A;  2UWD A;  1ELO A;  4DR6 E;  3T1Y E;  4DPX A;  4DUZ E;  1GJV A;  3GIG A;  1Z5B A;  2K5B A;  1THN A;  4DPW A;  4XD8 A;  5FND A;  4X9L A;  4BIZ A;  4L93 A;  1I58 A;  2ZKJ A;  1ZXN A;  5CTY A;  4AQY E;  4OX9 E;  1AMW A;  1PVG A;  2QFO A;  3WU3 A;  5C93 A;  5FNF A;  4CWR A;  4DR1 I;  1GKZ A;  1UYH A;  2YK2 A;  2V2Z A;  2XJX A;  5LMU I;  2YI7 A;  4NXM I;  3NMQ A;  1H7S A;  4LF6 E;  3Q5K A;  3BM9 A;  3B26 A;  3A0Z A;  1U0Z A;  4H81 A;  4YKU A;  2NPF A;  3LPS A;  1UY9 A;  2XK2 A;  4LWE A;  5D7D A;  2A2D A;  3T10 A;  1XNQ E;  2HCH A;  4O09 A;  4QPK A;  2YEI A;  1HR0 I;  2WI2 A;  3R4O A;  2YGA A;  4PRV A;  4B3M I;  4HAC A;  3J7A G;  4EFU A;  1MX0 A;  3EHF A;  3A0Y A;  3JZ3 A;  1YES A;  3R4N A;  4GKJ I;  3T2S A;  2UXC I;  4JI0 I;  4QPJ A;  3T1K A;  5FLX C;  2UUB E;  4P8O A;  1ZXM A;  1Y8P A;  4WUB A;  4CWF A;  1EA6 A;  2ZDX A;  1OJ4 A;  4FCQ A;  4JAV A;  4USM A;  5L3J A;  2ESA A;  4O0B A;  3U2K A;  2UU9 E;  2YI5 A;  4LFA I;  2IOQ A;  4DR6 I;  3B8H A;  4DUZ I;  4JI5 E;  4Z7C A;  2O1W A;  4WUD A;  1N0V C;  3ZM7 A;  4CWO A;  5M4K A;  1TC0 A;  2EFG A;  3K99 A;  4OX9 I;  1UYM A;  5CTU A;  3R4P A;  5IT9 C;  3D36 A;  3K60 A;  1AM1 A;  1BKN A;  2DEJ A;  1Z5C A;  4NH7 A;  4JG4 A;  3ZXQ A;  1AH8 A;  3LTO A;  4LWH A;  4HXZ A;  1TC6 A;  2XX4 A;  4JI4 E;  4JYA E;  2FWY A;  2HHH E;  3ZKD A;  1TH8 A;  4GGL A;  2XDL A;  3B25 A;  1J5E I;  1Z0E A;  2IWU A;  1H74 A;  4LF7 I;  3MNR P;  2QG0 A;  2YE6 A;  3G75 A;  4DV0 E;  2HFS A;  4DUY I;  3T1H E;  2XX2 A;  2HKE A;  4XKO A;  4HY6 A;  1FJG E;  3HZ1 A;  4JI3 I;  1KTV A;  4ASA A;  2XJG A;  5IWA I;  4DR7 I;  3QT5 A;  3A0X A;  2XD6 A;  2UXD I;  4EFT A;  3O6O A;  2ZBK B;  3QT6 A;  1HNZ E;  2O1V A;  5IDJ A;  2CCT A;  3B24 A;  4E00 A;  2UU9 I;  3V5R A;  4JI6 I;  1H73 A;  3HYY A;  4DV7 E;  2YEA A;  4V25 A;  1UYC A;  4CE3 A;  5BOD A;  4JI5 I;  1N34 E;  4GQT A;  4AWP A;  3CGY A;  5FLX Q;  1UYI A;  4LWG A;  4PL9 A;  4UTG A;  5BR8 I;  3PYE A;  1NHJ A;  1YS3 A;  4GFN A;  4CWS A;  1A6F A;  4X64 E;  2AJ4 A;  4ASB A;  4KTN A;  4O05 A;  1I5D A;  4M1K A;  4LF5 I;  4BQJ A;  3OWD A;  3J7A M;  4UT4 A;  2H8M A;  4YKR A;  2DEI A;  1VIS A;  3K98 A;  1FKA E;  4X66 I;  3JAM C;  3T0Z A;  3EHG A;  4R3A A;  2IOR A;  2YEE A;  3QDD A;  2YJW A;  3T0H A;  4JI4 I;  3IED A;  5M4E A;  2F4V I;  3B78 A;  2C2A A;  2HHH I;  4LF8 I;  1XMO E;  3TZ4 A;  2YE4 A;  3PEJ A;  4XE2 A;  1L0O A;  2Q2E B;  4EGI A;  3J81 Q;  2ZIT A;  1U2O A;  3T1H I;  1ZWH A;  2CZ9 A;  1YSR A;  4E01 A;  3Q1Q A;  3H4L A;  1FJG I;  3OPD A;  4FMT A;  4DUH A;  2UUC I;  4EEH A;  3RLP A;  3HUL A;  2YE9 A;  4H85 A;  2O1U A;  4O04 A;  3K17 A;  3FT5 A;  1Z0B A;  3C11 A;  1Z0W A;  4HXW A;  2BYH A;  2CGF A;  2YI0 A;  3D4J A;  2Q8I A;  3K1J A;  4R3M A;  4JI6 E;  2YJX A;  2XX5 A;  2V2V A;  4DV7 I;  2ZDY A;  4AS9 A;  2XHT A;  2UUA E;  2XJJ A;  2UXB I;  1FWK A;  1UYL A;  5D7C A;  1N34 I;  3U2D A;  5CPH A;  4DR3 E;  1IBK E;  2YE3 A;  2GS8 A;  1H72 C;  4PU9 A;  4MPN A;  4H7Q A;  4X65 E;  3TZ2 A;  2V2Q A;  1KVK A;  2VF3 A;  3DGE A;  3BMY A;  2Q8H A;  4XCL A;  3M6A A;  2CCS A;  2X7I A;  4X62 E;  4JAS A;  1I59 A;  3CRK A;  1UY6 A;  1XHK A;  4MP2 A;  3H80 A;  4DPY A;  1AH6 A;  4JV5 E;  4KFG A;  4U93 A;  4YKZ A;  1EI1 A;  1KKH A;  3PYF A;  4KQV A;  3TZ5 A;  1Z5A A;  1YT2 A;  1UYK A;  2WER A;  2WI5 A;  3EKR A;  2VQF I;  2ZM6 E;  4DV5 E;  4ZKI A;  4Q20 A;  4AWQ A;  3J80 C;  2QG2 A;  1XMQ I;  3RLQ A;  4WUC A;  1Y8N A;  1IBM I;  2YK9 A;  2XDX A;  4B3R E;  3RKZ A;  3K97 A;  3T1Y I;  1KZN A;  2YEF A;  4DV2 E;  1N36 I;  4DR4 E;  3TUH A;  1DAR A;  4HAC B;  1JM6 A;  2IWX A;  2UUC E;  2VCI A;  5M4P A;  4HYP A;  1NZ0 A;  2VQE I;  5BOC A;  4JQL A;  3Q5J A;  4ED4 A;  1UEK A;  2VCJ A;  2BSM A;  2R42 A;  3PYG A;  2YKB A;  5LMU E;  3R92 A;  4B7P A;  5D6Q A;  4LFC E;  1WUU A;  2XDS A;  2BM0 A;  2XEX A;  4HZ5 A;  1XNQ I;  2EXL A;  4JI8 E;  1HR0 E;  4DR5 I;  3D0B A;  4I5S A;  3WQ9 A;  5FNC A;  4X65 I;  3FV5 A;  4ASF A;  3QT7 A;  4MBC A;  4KP4 A;  4MOT A;  4FCR A;  3VHD A;  2AKP A;  2WEP A;  1UY7 A;  2LJP A;  2E1R A;  3RLR A;  3B28 A;  4JI1 I;  5LMN E;  3ZZ0 A;  1D6T A;  1YC4 A;  3C0E A;  3OTO E;  3SL2 A;  5FWK A;  4HZ0 A;  4HY1 A;  3CGZ A;  2ZM6 I;  3A0W A;  4JAU A;  3G7E A;  3ZKB A;  5D6P A;  3GIE A;  2BM1 A;  4V26 A;  5M4N A;  3CWV A;  4FWH A;  1IBM E;  1GKX A;  1ZM9 A;  1YC1 A;  3J80 Q;  4LP0 A;  2OI2 A;  3FT8 A;  4XTJ A;  1B62 A;  4DV2 I;  4DR4 I;  1UYE A;  3Q5L A;  3J81 C;  4P52 A;  4U7N A;  1N33 E;  1RRE A;  4LWI A;  1ZM3 A;  1YER A;  4LFB I;  3R4M A;  1H7U A;  1HNX I;  2YKI A;  3EHJ A;  4NH9 A;  4LFC I;  4DPU A;  1U2R A;  2BYI A;  2XAB A;  4LF4 I;  4NXN E;  4XKA A;  4AQY I;  2XHX A;  2YKE A;  3WHA A;  1YC3 A;  1HNW E;  4DV4 E;  4DR1 E; 
#chains in the Genus database with same CATH topology
 4I3H A;  4GKK I;  2XDU A;  1BXD A;  4BIU A;  4RPF A;  1J5E E;  5C0X F;  4LF7 E;  2VW5 A;  2FWZ A;  2YGF A;  1FNM A;  5DRO A;  2BU8 A;  5GME A;  4LF6 I;  1XNR E;  4CWN A;  1TIL A;  4NBQ A;  4YY3 E;  4CWT A;  2WEQ A;  3PS2 A;  2WI6 A;  4MDT A;  4CWQ A;  2BRC A;  1B63 A;  4DXL A;  3GIG B;  5CTX A;  4B6C A;  5IN9 A;  4YKX A;  2IOP A;  2J7K A;  2F1D A;  2A2C A;  4LPF A;  5LMN I;  4JI1 E;  3GIF A;  1FI4 A;  5IDM A;  4K0K I;  2WP8 B;  5K36 D;  4DV1 E;  2YE7 A;  1ID0 A;  2BV3 A;  5ELW A;  1NHI A;  1IBL I;  1MU5 A;  3ZZU A;  4XC0 A;  4GKJ E;  5J6A A;  4JI7 E;  2BU7 A;  5C0X E;  3QTF A;  3Q6M A;  1OSF A;  1UY8 A;  3UHM A;  4IFD C;  4YHH E;  3EKO A;  4IS9 A;  4JI2 I;  5A2Q C;  2PNR A;  4FW4 A;  1Y4S A;  5A2Q Q;  2WI3 A;  3R91 A;  5BR8 E;  1N0U A;  4URL A;  4DPT A;  3VHC A;  3GLL A;  1N33 I;  3LNU A;  1UYD A;  3D2R A;  4DR2 E;  4LFA E;  4LFB E;  5J71 A;  2WI1 A;  3HEK A;  3PEH A;  4LF5 E;  1HNX E;  3PS1 A;  4PRX A;  5K36 A;  1QY8 A;  1R6L A;  4XIQ A;  4CE2 A;  2PNZ A;  3HYZ A;  4X66 E;  4B3T I;  4NXN I;  1PKP A;  1UDS A;  4LF4 E;  3ZXO A;  1YT0 A;  4FW5 A;  1OYP A;  4MB9 A;  5M4M A;  2WI7 A;  4FW9 A;  4EGH A;  2YEB A;  2BU2 A;  1HNW I;  5K36 C;  3VHA A;  4XDM A;  4DV4 I;  2H55 A;  5CF0 A;  4GKK E;  2JEA B;  4DV3 I;  1YT1 A;  2E0A A;  4MPC A;  4P7A A;  4OO1 C;  4L90 A;  4CWP A;  4AWO A;  2CVE A;  1XNR I;  1I5C A;  4GEE A;  4YY3 I;  4XIR A;  3DD6 A;  2V34 A;  1KIJ A;  3O2F A;  1Z0G A;  2NN6 E;  4JYA I;  4KSH A;  5LL6 R;  1I5B A;  3G7B A;  4USK A;  2BA0 G;  3B27 A;  1N32 I;  4URO A;  1VI7 A;  4BA2 B;  5IT9 Q;  4K0K E;  5F5R A;  2E5L I;  1RHY A;  4DV0 I;  4KHP E;  4LF9 E;  4DUY E;  5DNL A;  4DV1 I;  2GO4 A;  1Z0C A;  3PYD A;  2YE5 A;  4LWF A;  4K4O A;  2PO2 A;  4LPB A;  5JEN A;  1IBL E;  3U67 A;  4JI3 E;  3WU5 A;  1Z59 A;  4JI7 I;  3O0I A;  5IWA E;  4DR7 E;  3OWB A;  2YEG A;  4MP7 A;  2UUA I;  2UXD E;  4YHH I;  2UXB E;  5M4H A;  4JI2 E;  3EHH A;  3OW6 A;  2HK3 A;  1UDN A;  4ASG A;  4FCP A;  1IBK I;  1HNZ I;  2YEC A;  2JKI A;  5CTW A;  4L94 A;  2Z5B A;  4L91 A;  2BU5 A;  1BYQ A;  1FWL A;  2BTZ A;  2BU6 A;  4DR2 I;  5F3K A;  2HG1 A;  1TBW A;  1HK7 A;  1S16 A;  4EMD A;  2VES A;  4AID A;  2FXS A;  4YKW A;  4LOM A;  3ZZT A;  4HYM A;  2YE8 A;  3TZ0 A;  3WU4 A;  1R62 A;  4XIT A;  2CH4 A;  4ZVI A;  2PNZ B;  1B3Q A;  2XHR A;  4X64 I;  4B3T E;  4MYT A;  4DV5 I;  4YKQ A;  2Q8F A;  3B82 A;  3GON A;  2HHI A;  2YKC A;  4EM7 A;  1ZM4 A;  4DU8 A;  1XMQ E;  4DV6 I;  4CE1 A;  2YGE A;  4B3S I;  3TTZ A;  1BGQ A;  2X36 A;  4B3R I;  2HK2 A;  4DV3 E;  3M85 G;  2QF6 A;  2YED A;  2BRE A;  1I5A A;  3A0R A;  4DU7 A;  4NH8 A;  2Q8G A;  1N36 E;  4U7O A;  1I94 E;  3F0N A;  3A0T A;  2Z5B B;  2YEH A;  4W7T A;  2JJC A;  1UYF A;  3P3E A;  3L7Z A;  2F4V E;  2VQE E;  1K47 A;  4MU0 A;  1XMO I;  4LF8 E;  4O07 A;  2BZ5 A;  4YKT A;  4GCZ A;  1N32 E;  2JE6 B;  5D7R A;  3Q6N A;  4Z7Y A;  1TID A;  4EGK A;  4BXI A;  1YET A;  4URM A;  2E5L E;  4KHP I;  2WW4 A;  4FPP A;  4LF9 I;  1NHH A;  1S4E A;  3KRN A;  1Y8O A;  4IFD D;  4R1F A;  4XKK A;  1ZM2 A;  2R3V A;  4OO1 F;  3HHU A;  3JAM Q;  4XCJ A;  4QNK A;  1US7 A;  3OMU A;  4GT8 A;  5GMD A;  2PNM A;  1A4H A;  4MQY A;  4JI8 I;  2JEA A;  4DR5 E;  2Z5E A;  4EMV A;  2FYP A;  2YE2 A;  2NN6 B;  3V2U C;  4NXM E;  3WU6 A;  2CG9 A;  4FWD A;  2CCU A;  2GQ0 A;  2IWS A;  2XDK A;  4L8Z A;  2XCM A;  2GFD A;  3CRL A;  4LCH A;  4DR3 I;  2C37 A;  1PIE A;  2YEJ A;  4BA2 A;  3OTO I;  1MG7 A;  1RR9 A;  3QT8 A;  4B3M E;  2VWC A;  5K36 F;  5JEA F;  2GQP A;  2YKJ A;  2Z5C A;  4DZY A;  4MYU A;  4MU4 A;  4X62 I;  4MPE A;  2WI4 A;  3VAD A;  4DV6 E;  4FWG A;  2C39 B;  2BT0 A;  4KSG A;  4JV5 I;  4B3S E;  2UXC E;  4JI0 E;  1S14 A;  1YSZ A;  1UYG A;  2HFU A;  4IFD F;  1AJ6 A;  4YKY A;  4E02 A;  4U3B A;  1Z0V A;  2UUB I;  4BQG A;  2VQF E;  2YI6 A;  1ZW9 A;  1QYE A;  1I94 I;  5GGZ A;  4AIM A;  1Y4U A;  1QZR A;  3INX A;  3INW A;  4URN A;  1Z0T A;  4BAE A;  1USU A;  2V8P A;  4FN5 A;  5DNX A;  3HZ5 A;  2UWD A;  4BA1 B;  2GO3 A;  4XIP A;  1ELO A;  4DR6 E;  3T1Y E;  2JE6 A;  4DPX A;  4DUZ E;  1GJV A;  3GIG A;  1Z5B A;  2K5B A;  1THN A;  2WNR B;  4DPW A;  4XD8 A;  5FND A;  4X9L A;  4IZJ A;  4BIZ A;  4N3O A;  4L93 A;  1I58 A;  2ZKJ A;  1ZXN A;  5CTY A;  4AQY E;  4OX9 E;  1AMW A;  5JEA D;  1PVG A;  2QFO A;  3WU3 A;  5C93 A;  5FNF A;  3PRY A;  4CWR A;  4DR1 I;  1YH8 A;  1GKZ A;  1UYH A;  2YK2 A;  2V2Z A;  2XJX A;  5LMU I;  2YI7 A;  2NN6 A;  4NXM I;  3NMQ A;  1H7S A;  4LF6 E;  3Q5K A;  3BM9 A;  3B26 A;  3A0Z A;  1U0Z A;  4H81 A;  4YKU A;  2NPF A;  3LPS A;  5C0X A;  1UY9 A;  2XK2 A;  4LWE A;  2A2D A;  5D7D A;  1XNQ E;  3T10 A;  2HCH A;  4O09 A;  4QPK A;  2YEI A;  1HR0 I;  2WI2 A;  3R4O A;  2O3Z A;  2PO1 A;  2YGA A;  2JT2 A;  4PRV A;  4B3M I;  4HAC A;  3J7A G;  2J65 A;  4EFU A;  1MX0 A;  3EHF A;  3A0Y A;  4IZJ B;  1YES A;  3JZ3 A;  3R4N A;  2C39 A;  4GKJ I;  2UXC I;  4JI0 I;  4QPJ A;  3T2S A;  3T1K A;  5FLX C;  3M7N G;  2UUB E;  3S5T A;  4P8O A;  1ZXM A;  2PO0 A;  1Y8P A;  4WUB A;  4CWF A;  3H1C A;  1EA6 A;  2ZDX A;  1OJ4 A;  4FCQ A;  4JAV A;  4USM A;  5L3J A;  2ESA A;  4O0B A;  3U2K A;  4OZE A;  2UU9 E;  2YI5 A;  5C0X C;  4LFA I;  2IOQ A;  4BA1 A;  4DR6 I;  1R6M A;  2IES A;  3B8H A;  4DUZ I;  4JI5 E;  2FTK A;  2O1W A;  4Z7C A;  4J3D A;  4WUD A;  1IXM A;  1N0V C;  3ZM7 A;  3CDI A;  4CWO A;  5M4K A;  2Z5C B;  1TC0 A;  2EFG A;  4FW6 A;  5JEA C;  3K99 A;  1USV A;  4OX9 I;  1UYM A;  5CTU A;  2PO2 B;  5IT9 C;  3D36 A;  3U1Y A;  3R4P A;  3K60 A;  4OO1 A;  3U1K A;  1BKN A;  1AM1 A;  2O1T A;  2DEJ A;  1Z5C A;  4NH7 A;  4JG4 A;  3ZXQ A;  1AH8 A;  3LTO A;  4LWH A;  4HXZ A;  1TC6 A;  2XX4 A;  4JI4 E;  4JYA E;  2FWY A;  2HHH E;  3ZKD A;  1TH8 A;  4GGL A;  2XDL A;  4MU3 A;  4GQU A;  3B25 A;  1J5E I;  1Z0E A;  2IWU A;  1H74 A;  4LF7 I;  4LCG A;  3MNR P;  4OO1 E;  2QG0 A;  2YE6 A;  4DV0 E;  2HFS A;  3G75 A;  4DUY I;  3T1H E;  2XX2 A;  2HKE A;  4OO1 D;  4XKO A;  4HY6 A;  4IZK A;  1FJG E;  3HZ1 A;  4JI3 I;  1KTV A;  4ASA A;  2XJG A;  5IWA I;  4DR7 I;  4E72 A;  3QT5 A;  3A0X A;  2XD6 A;  2UXD I;  4EFT A;  4IFD A;  2ZBK B;  3O6O A;  3QT6 A;  2O1V A;  1HNZ E;  5IDJ A;  2CCT A;  3B24 A;  4E00 A;  2UU9 I;  3V5R A;  4JI6 I;  1H73 A;  3HYY A;  4DV7 E;  2YEA A;  3GCM A;  4V25 A;  5C0X B;  1UYC A;  4CE3 A;  3L7Z B;  5BOD A;  4JI5 I;  1N34 E;  4GQT A;  4AWP A;  3CGY A;  5FLX Q;  1UYI A;  4LWG A;  3B4T A;  4PL9 A;  4UTG A;  5BR8 I;  3PYE A;  1NHJ A;  1YS3 A;  4GFN A;  4CWS A;  1A6F A;  4X64 E;  2AJ4 A;  4ASB A;  4KTN A;  4O05 A;  1I5D A;  4M1K A;  3P06 A;  4LF5 I;  4BQJ A;  3OWD A;  5K36 E;  3J7A M;  4UT4 A;  2H8M A;  3CDJ A;  4YKR A;  2DEI A;  1VIS A;  1Y6Z A;  3K98 A;  1FKA E;  4X66 I;  2PO0 B;  4LCF A;  3JAM C;  3T0Z A;  3EHG A;  4R3A A;  2IOR A;  2YEE A;  3QDD A;  2YJW A;  3T0H A;  4JI4 I;  3IED A;  2NN6 F;  5M4E A;  2F4V I;  3B78 A;  2C2A A;  2HHH I;  4LF8 I;  1XMO E;  3TZ4 A;  2YE4 A;  3PEJ A;  4XE2 A;  1L0O A;  2Q2E B;  4EGI A;  3J81 Q;  3HJC A;  4ISA A;  2ZIT A;  1U2O A;  3T1H I;  1ZWH A;  2CZ9 A;  1YSR A;  3M85 D;  4E01 A;  3Q1Q A;  3H4L A;  1FJG I;  3OPD A;  4FMT A;  4DUH A;  5K36 B;  2UUC I;  4EEH A;  3RLP A;  3HUL A;  2YE9 A;  4H85 A;  2O1U A;  4O04 A;  3K17 A;  1UDO A;  3FT5 A;  1Z0B A;  3C11 A;  5DRQ A;  1Z0W A;  4HXW A;  2BYH A;  2CGF A;  2YI0 A;  3D4J A;  2Q8I A;  3K1J A;  4R3M A;  4JI6 E;  2YJX A;  2BA1 D;  2XX5 A;  3K85 A;  2V2V A;  4DV7 I;  2ZDY A;  1YHC A;  2XHT A;  4AS9 A;  2UUA E;  2XJJ A;  2UXB I;  1FWK A;  1UYL A;  5D7C A;  1N34 I;  3P3G A;  3U2D A;  5CPH A;  4DR3 E;  1IBK E;  2YE3 A;  2GS8 A;  1H72 C;  2NN6 D;  4PU9 A;  4MPN A;  4H7Q A;  4X65 E;  3TZ2 A;  2V2Q A;  1KVK A;  2VF3 A;  3DGE A;  3BMY A;  2Q8H A;  4XCL A;  2WNR A;  3M6A A;  4IZJ D;  4FW3 A;  2X7I A;  4X62 E;  2CGE A;  1I59 A;  2CCS A;  3CRK A;  2BA0 D;  4JAS A;  1UY6 A;  1XHK A;  4MP2 A;  3H80 A;  4DPY A;  5JEA A;  1AH6 A;  4JV5 E;  4KFG A;  4U93 A;  4YKZ A;  1EI1 A;  1F51 A;  1KKH A;  3PYF A;  3GME A;  4KQV A;  3TZ5 A;  1Z5A A;  1YT2 A;  1UYK A;  2WER A;  2WI5 A;  3EKR A;  2VQF I;  5JEA E;  2ZM6 E;  4DV5 E;  4ZKI A;  4Q20 A;  4AWQ A;  3J80 C;  2QG2 A;  1XMQ I;  4FW7 A;  3RLQ A;  4WUC A;  1Y8N A;  1IBM I;  2YK9 A;  2XDX A;  2BR2 A;  4B3R E;  3RKZ A;  2C1I A;  3K97 A;  3T1Y I;  1KZN A;  2JEB A;  2YEF A;  4DV2 E;  1N36 I;  2C38 A;  5DRP A;  4DR4 E;  2PO1 B;  3TUH A;  1DAR A;  4HAC B;  4OKG A;  1JM6 A;  2IWX A;  2UUC E;  2VCI A;  5M4P A;  4HYP A;  1NZ0 A;  2AE8 A;  2VQE I;  1OYS A;  5BOC A;  4JQL A;  3Q5J A;  4ED4 A;  3NZK A;  1UEK A;  2VCJ A;  2BSM A;  2R42 A;  3PYG A;  2YKB A;  5LMU E;  3R92 A;  4B7P A;  3M7N D;  5D6Q A;  4LFC E;  3P3C A;  5EKW A;  1WUU A;  1E3P A;  3HKM A;  2XDS A;  2BM0 A;  4DV4 E;  1P42 A;  2XEX A;  2IER A;  2NN6 C;  1XNQ I;  4HZ5 A;  1Y60 A;  2EXL A;  4JI8 E;  1HR0 E;  4DR5 I;  4MU1 A;  3D0B A;  4I5S A;  3WQ9 A;  5FNC A;  4U3D A;  4X65 I;  4IFD E;  3FV5 A;  4ASF A;  2C38 B;  3QT7 A;  4MBC A;  4KP4 A;  4MOT A;  4FCR A;  3VHD A;  2AKP A;  2WEP A;  3LMM A;  1UY7 A;  2LJP A;  2E1R A;  3RLR A;  3CYG A;  3B28 A;  4JI1 I;  5LMN E;  3ZZ0 A;  1D6T A;  5FWK A;  1YC4 A;  3OTO E;  3C0E A;  3SL2 A;  2WP8 A;  4QNJ A;  4OO1 B;  4HZ0 A;  4HY1 A;  3CGZ A;  2ZM6 I;  3A0W A;  4JAU A;  3G7E A;  3ZKB A;  5D6P A;  3GIE A;  2BM1 A;  4V26 A;  5M4N A;  3CWV A;  4FWH A;  1IBM E;  1GKX A;  5DRR A;  5C0X D;  1ZM9 A;  1OYR A;  2BR2 B;  1YC1 A;  3J80 Q;  4LP0 A;  2OI2 A;  3FT8 A;  4XTJ A;  2JEB B;  3P76 A;  1B62 A;  4DV2 I;  2C1G A;  4DR4 I;  1UYE A;  3Q5L A;  3J81 C;  4P52 A;  4U7N A;  1N33 E;  1RRE A;  5EL9 A;  1E3H A;  4LWI A;  1ZM3 A;  1YER A;  4LFB I;  2C37 B;  3KE6 A;  3R4M A;  1H7U A;  4IZK B;  1HNX I;  5JEA B;  2PNL A;  2YKI A;  1Y5Y A;  3PS3 A;  3EHJ A;  4NH9 A;  1UDQ A;  4LFC I;  4DPU A;  4AM3 A;  1U2R A;  2BYI A;  2XAB A;  1XXE A;  4LF4 I;  4NXN E;  4IFD B;  4XKA A;  2BA1 G;  4AQY I;  2XHX A;  2YKE A;  3WHA A;  1YC3 A;  1HNW E;  2HKJ A;  4DR1 E; 
#chains in the Genus database with same CATH homology
 4I3H A;  4GKK I;  2XDU A;  1BXD A;  4BIU A;  4RPF A;  1J5E E;  4LF7 E;  2VW5 A;  2FWZ A;  2YGF A;  1FNM A;  2BU8 A;  5GME A;  4LF6 I;  1XNR E;  4CWN A;  1TIL A;  4YY3 E;  4CWT A;  2WEQ A;  2WI6 A;  4CWQ A;  2BRC A;  1B63 A;  4DXL A;  3GIG B;  5CTX A;  4B6C A;  5IN9 A;  4YKX A;  2IOP A;  2J7K A;  2A2C A;  5LMN I;  4JI1 E;  3GIF A;  1FI4 A;  5IDM A;  4K0K I;  2YE7 A;  4DV1 E;  1ID0 A;  2BV3 A;  1NHI A;  1IBL I;  1MU5 A;  3ZZU A;  4XC0 A;  4GKJ E;  5J6A A;  4JI7 E;  2BU7 A;  3QTF A;  3Q6M A;  1OSF A;  1UY8 A;  4YHH E;  3EKO A;  4JI2 I;  5A2Q C;  2PNR A;  1Y4S A;  5A2Q Q;  2WI3 A;  5BR8 E;  1N0U A;  4URL A;  4DPT A;  3VHC A;  1N33 I;  3LNU A;  1UYD A;  3D2R A;  4DR2 E;  4LFA E;  4LFB E;  5J71 A;  2WI1 A;  3HEK A;  3PEH A;  4LF5 E;  1HNX E;  4PRX A;  1QY8 A;  4XIQ A;  4CE2 A;  3HYZ A;  4X66 E;  4B3T I;  4NXN I;  1PKP A;  4LF4 E;  3ZXO A;  1YT0 A;  4MB9 A;  5M4M A;  2WI7 A;  4FW9 A;  4EGH A;  2YEB A;  2BU2 A;  1HNW I;  3VHA A;  4XDM A;  4DV4 I;  2H55 A;  5CF0 A;  4GKK E;  4DV3 I;  1YT1 A;  2E0A A;  4MPC A;  4P7A A;  4L90 A;  4CWP A;  4AWO A;  1XNR I;  1I5C A;  4GEE A;  4YY3 I;  4XIR A;  2V34 A;  1KIJ A;  3O2F A;  1Z0G A;  4JYA I;  4KSH A;  5LL6 R;  1I5B A;  3G7B A;  4USK A;  3B27 A;  1N32 I;  4URO A;  5IT9 Q;  4K0K E;  5F5R A;  2E5L I;  4KHP E;  4DV0 I;  4LF9 E;  4DUY E;  4DV1 I;  1Z0C A;  3PYD A;  2YE5 A;  4LWF A;  4K4O A;  4LPB A;  1IBL E;  3U67 A;  4JI3 E;  3WU5 A;  1Z59 A;  4JI7 I;  3O0I A;  5IWA E;  4DR7 E;  3OWB A;  2YEG A;  4MP7 A;  2UUA I;  2UXD E;  4YHH I;  2UXB E;  5M4H A;  4JI2 E;  3EHH A;  3OW6 A;  2HK3 A;  4ASG A;  4FCP A;  1IBK I;  1HNZ I;  2YEC A;  2JKI A;  5CTW A;  4L94 A;  2Z5B A;  4L91 A;  2BU5 A;  1BYQ A;  1FWL A;  2BTZ A;  2BU6 A;  4DR2 I;  5F3K A;  2HG1 A;  1TBW A;  1HK7 A;  1S16 A;  4EMD A;  2FXS A;  4YKW A;  2YE8 A;  3ZZT A;  4HYM A;  3TZ0 A;  3WU4 A;  1R62 A;  4XIT A;  2CH4 A;  4ZVI A;  1B3Q A;  2XHR A;  4X64 I;  4B3T E;  4MYT A;  4DV5 I;  4YKQ A;  2Q8F A;  3B82 A;  3GON A;  2YKC A;  4EM7 A;  1ZM4 A;  4DU8 A;  1XMQ E;  4DV6 I;  4CE1 A;  2YGE A;  4B3S I;  3TTZ A;  1BGQ A;  2X36 A;  4B3R I;  2HK2 A;  4DV3 E;  2QF6 A;  2YED A;  3R91 A;  2BRE A;  1I5A A;  3A0R A;  4DU7 A;  4NH8 A;  2Q8G A;  1N36 E;  4U7O A;  1I94 E;  3F0N A;  3A0T A;  2Z5B B;  2YEH A;  4W7T A;  2JJC A;  1UYF A;  2F4V E;  2VQE E;  1K47 A;  1XMO I;  4LF8 E;  4O07 A;  4YKT A;  2BZ5 A;  5D7R A;  4GCZ A;  1N32 E;  4EGK A;  3Q6N A;  4Z7Y A;  1TID A;  4BXI A;  1YET A;  4URM A;  2E5L E;  4KHP I;  2WW4 A;  4FPP A;  4LF9 I;  1NHH A;  1S4E A;  1Y8O A;  4R1F A;  4XKK A;  1ZM2 A;  2R3V A;  3HHU A;  3JAM Q;  4XCJ A;  1US7 A;  3OMU A;  4GT8 A;  5GMD A;  2PNM A;  1A4H A;  4JI8 I;  4EMV A;  4DR5 E;  2Z5E A;  2FYP A;  2YE2 A;  3V2U C;  4NXM E;  3WU6 A;  2CG9 A;  4FWD A;  2CCU A;  2GQ0 A;  2IWS A;  2XDK A;  4L8Z A;  2XCM A;  2GFD A;  3CRL A;  4DR3 I;  1PIE A;  2YEJ A;  3OTO I;  1MG7 A;  1RR9 A;  3QT8 A;  4B3M E;  2VWC A;  2YKJ A;  3KE6 A;  2GQP A;  2Z5C A;  4DZY A;  4MYU A;  4X62 I;  4MPE A;  2WI4 A;  3VAD A;  4DV6 E;  4FWG A;  2BT0 A;  4KSG A;  4JV5 I;  4B3S E;  2UXC E;  4JI0 E;  1S14 A;  1YSZ A;  1UYG A;  2HFU A;  4YKY A;  1AJ6 A;  4E02 A;  2UUB I;  1Z0V A;  4BQG A;  2VQF E;  2HKJ A;  2YI6 A;  1ZW9 A;  1QYE A;  1I94 I;  5GGZ A;  3INX A;  1Y4U A;  1QZR A;  3INW A;  4URN A;  1Z0T A;  4BAE A;  1USU A;  2V8P A;  4FN5 A;  4XIP A;  3HZ5 A;  2UWD A;  1ELO A;  4DR6 E;  3T1Y E;  4DPX A;  4DUZ E;  1GJV A;  3GIG A;  1Z5B A;  2K5B A;  1THN A;  4DPW A;  4XD8 A;  5FND A;  4X9L A;  4IZJ A;  4BIZ A;  4N3O A;  4L93 A;  1I58 A;  2ZKJ A;  1ZXN A;  5CTY A;  4AQY E;  4OX9 E;  1AMW A;  1PVG A;  2QFO A;  3WU3 A;  5C93 A;  5FNF A;  3PRY A;  4CWR A;  4DR1 I;  1GKZ A;  1UYH A;  2YK2 A;  2V2Z A;  2XJX A;  5LMU I;  2YI7 A;  4NXM I;  3NMQ A;  1H7S A;  4LF6 E;  3Q5K A;  3BM9 A;  3B26 A;  3A0Z A;  1U0Z A;  4H81 A;  4YKU A;  2NPF A;  3LPS A;  1UY9 A;  2XK2 A;  4LWE A;  5D7D A;  2A2D A;  3T10 A;  1XNQ E;  2HCH A;  4O09 A;  4QPK A;  2YEI A;  1HR0 I;  2WI2 A;  3R4O A;  2YGA A;  4PRV A;  4B3M I;  4HAC A;  3J7A G;  4EFU A;  1MX0 A;  3EHF A;  3A0Y A;  4IZJ B;  1YES A;  3JZ3 A;  3R4N A;  4GKJ I;  3T2S A;  2UXC I;  4JI0 I;  4QPJ A;  3T1K A;  5FLX C;  2UUB E;  4P8O A;  1ZXM A;  1Y8P A;  4WUB A;  4CWF A;  1EA6 A;  2ZDX A;  1OJ4 A;  4FCQ A;  4JAV A;  4USM A;  5L3J A;  2ESA A;  4O0B A;  3U2K A;  2UU9 E;  2YI5 A;  4LFA I;  2IOQ A;  4DR6 I;  3B8H A;  4DUZ I;  4JI5 E;  2O1W A;  4Z7C A;  4WUD A;  1N0V C;  3ZM7 A;  4CWO A;  5M4K A;  2Z5C B;  1TC0 A;  2EFG A;  3K99 A;  1USV A;  4OX9 I;  1UYM A;  5CTU A;  3R4P A;  5IT9 C;  3D36 A;  3K60 A;  1AM1 A;  1BKN A;  2O1T A;  2DEJ A;  1Z5C A;  4NH7 A;  4JG4 A;  3ZXQ A;  1AH8 A;  3LTO A;  4LWH A;  4HXZ A;  1TC6 A;  2XX4 A;  4JI4 E;  4JYA E;  2FWY A;  2HHH E;  3ZKD A;  1TH8 A;  4GGL A;  2XDL A;  3B25 A;  1J5E I;  1Z0E A;  2IWU A;  1H74 A;  4LF7 I;  3MNR P;  2QG0 A;  2YE6 A;  3G75 A;  4DV0 E;  2HFS A;  4DUY I;  3T1H E;  2XX2 A;  2HKE A;  4XKO A;  4HY6 A;  4IZK A;  1FJG E;  3HZ1 A;  4JI3 I;  1KTV A;  4ASA A;  2XJG A;  5IWA I;  4DR7 I;  3QT5 A;  3A0X A;  2XD6 A;  2UXD I;  4EFT A;  3O6O A;  2ZBK B;  3QT6 A;  2O1V A;  1HNZ E;  5IDJ A;  2CCT A;  3B24 A;  4E00 A;  2UU9 I;  3V5R A;  4JI6 I;  1H73 A;  3HYY A;  4DV7 E;  2YEA A;  4V25 A;  1UYC A;  4CE3 A;  5BOD A;  4JI5 I;  1N34 E;  4GQT A;  4AWP A;  3CGY A;  5FLX Q;  1UYI A;  4LWG A;  4PL9 A;  4UTG A;  5BR8 I;  3PYE A;  1NHJ A;  1YS3 A;  4GFN A;  4CWS A;  1A6F A;  4X64 E;  2AJ4 A;  4ASB A;  4KTN A;  4O05 A;  1I5D A;  4M1K A;  3P06 A;  4LF5 I;  4BQJ A;  3OWD A;  3J7A M;  4UT4 A;  2H8M A;  4YKR A;  2DEI A;  1VIS A;  1Y6Z A;  3K98 A;  1FKA E;  4X66 I;  3JAM C;  3T0Z A;  3EHG A;  4R3A A;  2IOR A;  2YEE A;  3QDD A;  2YJW A;  3T0H A;  4JI4 I;  3IED A;  5M4E A;  2F4V I;  3B78 A;  2C2A A;  2HHH I;  4LF8 I;  1XMO E;  3TZ4 A;  2YE4 A;  3PEJ A;  4XE2 A;  1L0O A;  2Q2E B;  4EGI A;  3J81 Q;  3HJC A;  2ZIT A;  1U2O A;  3T1H I;  1ZWH A;  2CZ9 A;  1YSR A;  4E01 A;  3Q1Q A;  3H4L A;  1FJG I;  3OPD A;  4FMT A;  4DUH A;  2UUC I;  4EEH A;  3RLP A;  3HUL A;  2YE9 A;  4H85 A;  2O1U A;  4O04 A;  3K17 A;  3FT5 A;  1Z0B A;  3C11 A;  1Z0W A;  4HXW A;  2BYH A;  2CGF A;  2YI0 A;  3D4J A;  2Q8I A;  3K1J A;  4R3M A;  4JI6 E;  2YJX A;  2XX5 A;  3K85 A;  4DV7 I;  2V2V A;  2ZDY A;  2XHT A;  4AS9 A;  2UUA E;  2XJJ A;  2UXB I;  1FWK A;  1UYL A;  5D7C A;  1N34 I;  3U2D A;  5CPH A;  4DR3 E;  1IBK E;  2YE3 A;  2GS8 A;  1H72 C;  4PU9 A;  4MPN A;  4H7Q A;  4X65 E;  3TZ2 A;  2V2Q A;  1KVK A;  2VF3 A;  3DGE A;  3BMY A;  2Q8H A;  4XCL A;  3M6A A;  4IZJ D;  2CCS A;  2X7I A;  4X62 E;  2CGE A;  1I59 A;  3CRK A;  4JAS A;  1UY6 A;  1XHK A;  4MP2 A;  3H80 A;  4DPY A;  1AH6 A;  4JV5 E;  4KFG A;  4U93 A;  4YKZ A;  1EI1 A;  1KKH A;  3PYF A;  4KQV A;  3TZ5 A;  1Z5A A;  1YT2 A;  1UYK A;  2WER A;  2WI5 A;  3EKR A;  2VQF I;  2ZM6 E;  4DV5 E;  4ZKI A;  4Q20 A;  4AWQ A;  3J80 C;  2QG2 A;  1XMQ I;  3RLQ A;  4WUC A;  1Y8N A;  1IBM I;  2YK9 A;  2XDX A;  4B3R E;  3RKZ A;  3K97 A;  3T1Y I;  1KZN A;  2YEF A;  4DV2 E;  1N36 I;  4DR4 E;  3TUH A;  1DAR A;  4HAC B;  1JM6 A;  2IWX A;  2UUC E;  2VCI A;  5M4P A;  4HYP A;  1NZ0 A;  2VQE I;  5BOC A;  4JQL A;  3Q5J A;  4ED4 A;  1UEK A;  2VCJ A;  2BSM A;  2R42 A;  3PYG A;  2YKB A;  5LMU E;  3R92 A;  4B7P A;  5D6Q A;  4LFC E;  1WUU A;  2XDS A;  2BM0 A;  2XEX A;  4HZ5 A;  1XNQ I;  2EXL A;  4JI8 E;  1HR0 E;  4DR5 I;  3D0B A;  4I5S A;  3WQ9 A;  5FNC A;  4X65 I;  3FV5 A;  4ASF A;  3QT7 A;  4MBC A;  4KP4 A;  4MOT A;  4FCR A;  3VHD A;  2AKP A;  2WEP A;  1UY7 A;  2LJP A;  2E1R A;  3RLR A;  3B28 A;  4JI1 I;  5LMN E;  3ZZ0 A;  1D6T A;  5FWK A;  1YC4 A;  3OTO E;  3C0E A;  3SL2 A;  4HZ0 A;  4HY1 A;  3CGZ A;  2ZM6 I;  3A0W A;  4JAU A;  3G7E A;  3ZKB A;  5D6P A;  3GIE A;  2BM1 A;  4V26 A;  5M4N A;  3CWV A;  4FWH A;  1IBM E;  1GKX A;  1ZM9 A;  1YC1 A;  3J80 Q;  4LP0 A;  2OI2 A;  3FT8 A;  4XTJ A;  1B62 A;  4DV2 I;  4DR4 I;  1UYE A;  3Q5L A;  3J81 C;  4P52 A;  4U7N A;  1N33 E;  1RRE A;  4LWI A;  1ZM3 A;  1YER A;  4LFB I;  3R4M A;  1H7U A;  4IZK B;  1HNX I;  2PNL A;  2YKI A;  3EHJ A;  4NH9 A;  4LFC I;  4DPU A;  1U2R A;  2BYI A;  2XAB A;  4LF4 I;  4NXN E;  4XKA A;  4AQY I;  2XHX A;  2YKE A;  3WHA A;  1YC3 A;  1HNW E;  4DV4 E;  4DR1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...