1EA6A

N-terminal 40kda fragment of nhpms2 complexed with adp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
338
structure length
304
Chain Sequence
b'CSGQVVLSLSTAVKELVENSLDAGATNIDLKLKDYGVDLIEVSDNGCGVEEENFEGLTLEALSSLCALSDVTISTCHASAKVGTRLMFDHNGKIIQKTPYPRPRGTTVSVQQLFSTLPVRHKEFQRNIKKEYAKMVQVLHAYCIISAGIRVSCTNQLGQGKRQPVVCTGGSPSIKENIGSVFGQKQLQSLIPFVQLPPSDSVCEEYGLSCSDALHNLFYISGFISQCTHGVGRSSTDRQFFFINRRPCDPAKVCRLVNEVYHMYNRHQYPFVVLNISVDSECVLLQEEKLLLAVLKTSLIGMFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PMS1 PROTEIN HOMOLOG 2
publication title Structure and Function of the N-Terminal 40 kDa Fragment of Human Pms2: A Monomeric Ghl ATPase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna repair
total genus 86
structure length 304
sequence length 338
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01119 DNA_mis_repair DNA mismatch repair protein, C-terminal domain
A PF13589 HATPase_c_3 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1ea6A02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1ea6A01
3T1YE 2XX2A 5GMDA 1YC3A 1UEKA 4DR3I 5M4NA 3Q1QA 5FNFA 2YKBA 2ZM6I 2YE4A 4LF6I 2J7KA 2DEJA 2XDKA 5BODA 4ZVIA 4DR3E 3K17A 4LWIA 4XCJA 4KHPI 4JI2I 2ZM6E 1UYHA 1U2RA 4QPKA 2UUAI 3J80Q 1AJ6A 3K99A 2R3VA 1B63A 4HY1A 3OTOI 4JI2E 4KHPE 2UWDA 3TTZA 4EGHA 3D0BA 4DPTA 1I5BA 1UYDA 2UUAE 3PEHA 1EA6A 2WI1A 4CE1A 4DPYA 2BTZA 4JI3I 3OTOE 2XCMA 3F0NA 1TILA 2BU2A 2XK2A 1D6TA 2YEFA 1NHJA 4JI3E 4KTNA 2WI5A 3PYDA 4LWFA 4DPXA 3FT8A 3R92A 3GIEA 2ZITA 3A0ZA 5F5RA 2BSMA 4JI1I 2V34A 3LPSA 2XJGA 3EHFA 1QYEA 1PIEA 1XMOI 4JI8I 4JI1E 3R4MA 5M4HA 4FCPA 2XDXA 2CZ9A 4EFTA 2E5LI 5BR8I 2JJCA 4HY6A 4U7NA 1XMOE 4JI8E 2YI0A 2UUBI 4FWDA 2E5LE 5BR8E 5CTXA 1DARA 2VCJA 1S14A 1Z59A 4JI5I 4MB9A 4NXMI 1Z0TA 2UUBE 2EXLA 1BKNA 3DGEA 1YS3A 3EKOA 4JI5E 2XABA 3A0YA 3EHJA 4JQLA 4NXME 1XMQI 4YKTA 1I59A 1UYCA 5M4EA 4LFBI 2BU5A 4AQYE 2H8MA 2BM1A 4XTJA 1I58A 1XMQE 4LP0A 3CWVA 2HKJA 4B3TI 2NPFA 4LFBE 5M4PA 4XC0A 4KSHA 3NMQA 4B3TE 2VWCA 2WEQA 1UY8A 3O6OA 3T2SA 4GT8A 1TH8A 3OWBA 4XIQA 4YHHI 5J71A 1KVKA 1N0VC 2CH4A 3GIFA 3QT5A 4GFNA 4YHHE 3OW6A 4DV6I 4W7TA 1THNA 4KQVA 2V2VA 4E00A 4LF9I 3B28A 4DPWA 3B26A 4GKJI 4U7OA 1RREA 3EKRA 4DV6E 4HZ0A 4LF9E 4LF8I 4B3MI 3A0XA 4GKJE 4NH7A 2Q8IA 1NZ0A 3T1KA 3VHDA 4LF8E 4B3ME 1OJ4A 2H55A 4L94A 4NH8A 5FLXC 4LF7I 2YK2A 1TBWA 2XHTA 4USMA 4QPJA 4MP7A 4EEHA 2BRCA 5GMEA 3U2DA 4LF7E 4DR4I 3FT5A 3G7BA 4R1FA 5CTYA 2BT0A 1GJVA 3Q5LA 4DV4I 1MX0A 4DR4E 2QG0A 2HK2A 2VW5A 2HFSA 5D7CA 4AWOA 1XNQI 2IOQA 2O1WA 4DV4E 3D36A 2IWSA 2ZBKB 1UYLA 4HYPA 1MG7A 1VISA 4HZ5A 4X9LA 4X62I 1XNQE 5FNDA 4UTGA 3VHAA 3C0EA 1QZRA 1Y8PA 4X62E 3EHHA 4DUHA 4I5SA 3ZZUA 3JAMQ 1Y4SA 2YEHA 4L8ZA 4BIZA 4FN5A 1YERA 3B8HA 1Z0GA 2ZKJA 2WW4A 5A2QC 1TIDA 1JM6A 4MPNA 2YGFA 2YK9A 1RR9A 3LTOA 4GEEA 2AKPA 3GONA 4YKRA 4CWSA 1PKPA 1MU5A 4PL9A 4O09A 3J7AM 4LFAI 5CPHA 2HG1A 3D4JA 3OPDA 3ZZ0A 5J6AA 4JI4I 3J81C 4LFAE 1ID0A 4U93A 3IEDA 4HYMA 2IWUA 1WUUA 4O05A 4GGLA 4URNA 1U2OA 1Z5AA 1YT0A 4JI4E 2YEDA 3T0HA 1IBMI 2XJJA 4XE2A 2YKIA 2V8PA 2QF6A 4BQJA 1I5CA 2HFUA 3K97A 4DV0I 1YSZA 1IBME 4JI6E 1YESA 2YKEA 4JAVA 2YEJA 2UXBI 4H85A 2IOPA 4DV0E 2YGAA 3RLRA 3KE6A 1NHIA 2XHRA 3LNUA 5M4MA 2UXBE 1N32I 3ZKBA 2ZDYA 3T0ZA 4OX9I 4HXZA 1N32E 2A2DA 4MYUA 1R62A 2YJXA 2XX5A 4OX9E 4LF4I 3RKZA 4NXNI 4BIUA 4E01A 1ELOA 4FWGA 2K5BA 4YKYA 2BU8A 3WU3A 4LF4E 4NXNE 3PEJA 1N0UA 2IORA 4PRXA 4AQYI 1QY8A 4CWRA 4CWFA 2WI6A 4LWGA 3Q5KA 4ASGA 4ASBA 4EGKA 3HZ5A 3HYZA 2OI2A 3BM9A 1B62A 5IN9A 2YE8A 1FI4A 4KFGA 3VADA 4FW9A 2UUCE 4EFUA 1Z0VA 5LMNI 3J80C 3GIGB 3INXA 4RPFA 4XKAA 1HNXI 4BQGA 3C11A 3RLQA 2YKCA 4JI7I 3TUHA 4X64I 5LMNE 3ZKDA 4JV5I 3B78A 3OWDA 1HNXE 5L3JA 1KIJA 4JI7E 3WQ9A 3MNRP 4MOTA 4X64E 4DUYI 4JV5E 3A0WA 3TZ0A 1FWKA 4BAEA 2BREA 4LF5I 5M4KA 4ASAA 4PU9A 4DUYE 1BGQA 1UY9A 1NHHA 1Y4UA 1YC1A 5LL6R 4LF5E 1XNRI 2CGFA 2YECA 4CWQA 2BYHA 2YKJA 4HACB 3Q5JA 4DR5I 1YT2A 1PVGA 1XNRE 4JASA 4URLA 3ZM7A 4EMDA 3WU5A 1H72C 2XEXA 2A2CA 5A2QQ 5IWAI 4DR5E 2O1VA 3HZ1A 4MYTA 3U67A 2HK3A 1H7SA 1FWLA 3A0RA 1AH8A 4LPBA 5IWAE 3R91A 1S4EA 4MPCA 4L91A 4XCLA 1UYGA 1YT1A 4PRVA 1I5AA 3CGYA 5CTUA 4UROA 3U2KA 4YKZA 5FWKA 2YE9A 2YEGA 1GKXA 1N36I 1GKZA 3J81Q 4LFCI 2WI3A 4GQTA 1N36E 1UYKA 4H81A 2XDSA 3OMUA 1A6FA 1ZM3A 4K0KI 2Q8HA 4MP2A 4LFCE 2FYPA 3A0TA 3V2UC 4DUZI 2GQPA 2CCUA 4K0KE 4DZYA 1K47A 2YEAA 4NH9A 4XDMA 4DUZE 2DEIA 1IBKI 2FWYA 2WERA 2YE3A 3R4NA 4O04A 5IT9C 2YGEA 3K1JA 3VHCA 2QFOA 2YE6A 1FKAE 1IBKE 4XKOA 2BM0A 4DU7A 4CWTA 3RLPA 3WU6A 4P52A 4E02A 4DV5I 1KZNA 4YKWA 3K60A 1Z0BA 1Z0CA 3G75A 1AM1A 4MPEA 2VQEI 3J7AG 1YC4A 3QT7A 4CWOA 3WHAA 1Z5BA 4DV3I 4DV5E 4XKKA 1B3QA 3ZXQA 1BYQA 3O2FA 2VQEE 4CE2A 4DV3E 4JI6I 4MBCA 2UXDI 3R4PA 5CTWA 2UXCE 3T10A 2XDLA 3BMYA 2YJWA 1ZM4A 2UXDE 4YKQA 5IDMA 2CG9A 1Z0WA 4ASFA 1UYMA 2WI2A 2UU9I 4AWQA 4B7PA 4BXIA 3D2RA 2WI7A 2PNRA 4XITA 4XIPA 2UU9E 4DU8A 4LF6E 2YE5A 2BYIA 2YEIA 2FWZA 2R42A 2GFDA 5BOCA 2BU6A 1HNZI 1ZW9A 4KP4A 4L90A 2HCHA 3PYGA 5D7DA 4FPPA 3CGZA 1L0OA 1A4HA 1HNZE 4CWNA 4Z7YA 3B82A 4WUCA 1I5DA 3B27A 3JAMC 4L93A 3QT6A 4DR2I 5CF0A 2HKEA 3M6AA 2YE2A 4YY3I 2XDUA 2YE7A 2WEPA 3JZ3A 1TC6A 2XJXA 4FWHA 4DR2E 3INWA 3HULA 3SL2A 1Y8NA 2IWXA 2AJ4A 4YY3E 2EFGA 2XD6A 1HNWI 4Q20A 3B25A 4B3SI 3GIGA 1IBLI 4AS9A 2CCSA 2VQFI 2UUCI 1H74A 1HNWE 4P8OA 1H73A 1TC0A 2VF3A 3WU4A 5FLXQ 3T1HI 4B3SE 1IBLE 3HEKA 1UYIA 4K4OA 4V26A 2VQFE 4JI0I 3T1HE 2YI6A 4I3HA 4WUDA 2HHHI 1HR0I 4JI0E 2FXSA 4EMVA 1ZXNA 5LMUI 3TZ5A 3TZ4A 1AMWA 1ZWHA 1ZM2A 1Y8OA 2ESAA 2HHHE 3ZXOA 4M1KA 1HR0E 5IDJA 5LMUE 1UY6A 4DPUA 4USKA 2YEEA 4X66I 4DV1I 4DR1I 3CRLA 2YI5A 4XIRA 4HACA 2E0AA 2Q2EB 4DXLA 4DR6I 4X66E 4DV1E 4DR1E 1N34I 3TZ2A 2F4VI 1EI1A 1S16A 3H80A 4P7AA 3CRKA 2V2ZA 4DR6E 3B24A 1N34E 2WI4A 1J5EI 3QTFA 2GS8A 4LWEA 3QDDA 2F4VE 4GKKI 5D6QA 2E1RA 4KSGA 1Z0EA 4O07A 2QG2A 1J5EE 3G7EA 5F3KA 5IT9Q 4JYAI 4GKKE 1KKHA 4R3MA 4YKXA 4GCZA 3H4LA 4O0BA 1BXDA 4FCRA 4R3AA 1OSFA 4JYAE 4JG4A 2BZ5A 4H7QA 2XHXA 4WUBA 3PYEA 1N33I 4CWPA 4DR7I 1KTVA 1US7A 1ZXMA 2XX4A 3K98A 4HXWA 4DV2I 2O1UA 5FNCA 1N33E 3V5RA 4DR7E 3O0IA 2ZDXA 2VCIA 1FJGI 4EGIA 1UYFA 4DV2E 2X7IA 4URMA 4AWPA 3FV5A 2Q8FA 3QT8A 4UT4A 4ED4A 1FJGE 4X65I 3PYFA 4V25A 4B6CA 2JKIA 1UYEA 2YEBA 4B3RI 4JAUA 4EM7A 4DV7I 2LJPA 2CCTA 4X65E 4XD8A 2YI7A 1H7UA 4B3RE 4FMTA 4DV7E 4Z7CA 2BU7A 1I94I 5GGZA 2Q8GA 1UY7A 1YETA 1ZM9A 1XHKA 2V2QA 1Z5CA 4LWHA 2X36A 3ZZTA 4CE3A 1I94E 1FNMA 1U0ZA 2UXCI 1YSRA 4FCQA 3HHUA 5D6PA 3T1YI 2BV3A 1AH6A 5D7RA 3HYYA 4YKUA 5C93A 3R4OA 3EHGA 4ZKIA 2C2AA
chains in the Genus database with same CATH superfamily
3T1YE 2XX2A 5GMDA 1YC3A 1UEKA 2C1IA 2JT2A 4DR3I 4BA2A 5M4NA 3Q1QA 5FNFA 2YKBA 2ZM6I 2YE4A 4LF6I 2J7KA 4LPFA 2DEJA 2XDKA 5BODA 5JEAD 2C39B 4ZVIA 4DR3E 3K17A 4LWIA 4XCJA 4KHPI 4OO1C 4JI2I 2ZM6E 3GLLA 4BA2B 4MDTA 1UYHA 4E72A 1U2RA 5K36B 2UUAI 4QPKA 3J80Q 2GO4A 1AJ6A 3K99A 2R3VA 1B63A 4HY1A 3OTOI 4JI2E 4KHPE 2UWDA 3TTZA 2JEBA 4EGHA 3D0BA 4DPTA 1I5BA 1UYDA 2UUAE 2O3ZA 1EA6A 2WI1A 3PEHA 1IXMA 4DPYA 2BTZA 4JI3I 4CE1A 5JEAE 3OTOE 2XCMA 3F0NA 1TILA 2BU2A 2PO2A 1D6TA 2XK2A 4IZJD 2YEFA 1NHJA 4JI3E 4KTNA 4FW3A 2WI5A 3PYDA 4LWFA 2BA1G 4DPXA 3FT8A 3R92A 3GIEA 3PS1A 5DNLA 2ZITA 3A0ZA 5F5RA 2BSMA 4JI1I 2V34A 1E3HA 3LPSA 4N3OA 4U3DA 2XJGA 3EHFA 1QYEA 1PIEA 1XMOI 1XXEA 4JI8I 4JI1E 3R4MA 5M4HA 1OYRA 2XDXA 2CZ9A 4FCPA 4EFTA 2E5LI 5BR8I 4OO1B 2JJCA 4HY6A 4U7NA 2PNZB 2IESA 1XMOE 4JI8E 2YI0A 3M7ND 2UUBI 4FWDA 2E5LE 5BR8E 5CTXA 1DARA 2VCJA 1S14A 3S5TA 1Z59A 4JI5I 4MB9A 4NXMI 1Z0TA 2UUBE 2EXLA 1BKNA 5DRQA 3DGEA 1YS3A 3EKOA 1Y5YA 4JI5E 2XABA 2PO1A 3A0YA 3EHJA 4JQLA 4NXME 1XMQI 4YKTA 1I59A 1UYCA 1P42A 5M4EA 4LFBI 2BU5A 4AQYE 2H8MA 2BM1A 3PS2A 4XTJA 1I58A 4J3DA 1XMQE 4LP0A 3CWVA 2HKJA 3GMEA 4B3TI 2NPFA 4LFBE 5M4PA 5EKWA 4XC0A 4FW4A 4KSHA 2WNRB 2NN6F 3U1YA 3NMQA 4B3TE 2VWCA 2WEQA 1UY8A 3O6OA 3T2SA 4GT8A 1TH8A 3OWBA 4AIDA 4XIQA 4YHHI 5J71A 1KVKA 1N0VC 2CH4A 3GIFA 3QT5A 4GFNA 4YHHE 3OW6A 3H1CA 4DV6I 1THNA 4KQVA 2V2VA 4W7TA 4E00A 4LF9I 3B28A 4DPWA 3B26A 4GKJI 4U7OA 1RREA 3EKRA 2Z5CA 4DV6E 2FTKA 3Q6NA 4HZ0A 1Y60A 4LF9E 4LF8I 4B3MI 3A0XA 4GKJE 4NH7A 2Q8IA 2NN6A 1NZ0A 3T1KA 3VHDA 4LF8E 4B3ME 1OJ4A 3M7NG 2H55A 4L94A 5FLXC 4NH8A 4LF7I 2YK2A 1TBWA 4IFDC 2XHTA 4USMA 4QPJA 1UDQA 4MP7A 4U3BA 2BRCA 5GMEA 3U2DA 4LF7E 4DR4I 2C1GA 3FT5A 4EEHA 3G7BA 4R1FA 5CTYA 4IS9A 2BT0A 4LCFA 1GJVA 1OYSA 3Q5LA 4BA1A 4DV4I 1MX0A 4DR4E 2QG0A 2HK2A 2VW5A 5JEAC 2HFSA 5D7CA 4AWOA 1XNQI 2IOQA 2O1WA 4DV4E 3D36A 2IWSA 2ZBKB 1UYLA 4HYPA 1MG7A 2BA1D 1VISA 4HZ5A 1USUA 4X9LA 4X62I 1XNQE 3HJCA 5FNDA 4UTGA 3VHAA 3C0EA 1QZRA 1Y8PA 4X62E 3EHHA 4DUHA 2NN6D 5C0XC 4I5SA 3ZZUA 1Y4SA 3JAMQ 3K85A 1Y6ZA 2YEHA 4L8ZA 4BIZA 4FN5A 1YERA 3B8HA 4IFDB 1Z0GA 2ZKJA 2WW4A 5A2QC 1TIDA 1JM6A 4MPNA 2YGFA 2YK9A 1RR9A 2C39A 3LTOA 2AKPA 4GEEA 2JE6B 2NN6E 3GONA 4YKRA 4CWSA 1PKPA 1MU5A 5JENA 4PL9A 4LCGA 4O09A 5K36A 3J7AM 4LFAI 5CPHA 2HG1A 1OYPA 5JEAB 3D4JA 3OPDA 3ZZ0A 5J6AA 4JI4I 4OO1F 3J81C 4LFAE 3L7ZB 1ID0A 4U93A 3IEDA 4HYMA 5DRPA 1WUUA 2IWUA 4GGLA 4O05A 4URNA 1U2OA 1Z5AA 1YT0A 4JI4E 2YEDA 3T0HA 1IBMI 2XJJA 4XE2A 5DRRA 2YKIA 2V8PA 2QF6A 4BQJA 1I5CA 2HFUA 3CDIA 3K97A 3CDJA 4DV0I 2CGEA 1IBME 1YSZA 5C0XB 4JI6E 1UDOA 1YESA 2YKEA 4JAVA 2YEJA 5EL9A 2UXBI 4H85A 2IOPA 4DV0E 2YGAA 3RLRA 3KE6A 1NHIA 2XHRA 4QNKA 3LNUA 3PS3A 5M4MA 2UXBE 2PNMA 1N32I 1RHYA 3ZKBA 4OO1A 2ZDYA 2PNZA 4FW7A 3T0ZA 4OX9I 4HXZA 1N32E 1VI7A 2A2DA 4MYUA 1R62A 2YJXA 2XX5A 4GQUA 4OX9E 4LF4I 3RKZA 4NXNI 4BIUA 3M85D 4E01A 1R6LA 1ELOA 4FWGA 2K5BA 1YH8A 4YKYA 2BU8A 3WU3A 4LF4E 4NXNE 2C38B 3PEJA 1N0UA 2IORA 2BA0D 4PRXA 4AQYI 1QY8A 2VESA 4CWRA 3LMMA 4CWFA 4LOMA 2WI6A 3U1KA 3Q5KA 4LWGA 3B4TA 2WNRA 4ASGA 4ASBA 4EGKA 3HZ5A 3HYZA 2OI2A 3BM9A 1B62A 5IN9A 2YE8A 1FI4A 4KFGA 3VADA 4FW9A 2C37A 2UUCE 1Z0VA 3J80C 5LMNI 3GIGB 3INXA 4EFUA 4RPFA 4XKAA 1HNXI 2JEAB 4BQGA 2Z5BB 3C11A 3RLQA 2YKCA 4JI7I 3TUHA 4X64I 5LMNE 3ZKDA 4JV5I 3B78A 3OWDA 2C37B 1HNXE 5L3JA 1KIJA 4FW6A 4JI7E 3WQ9A 3MNRP 4MOTA 4X64E 3PRYA 4MQYA 2PO0B 4DUYI 4JV5E 3A0WA 3TZ0A 1FWKA 4BAEA 2BREA 4LF5I 5M4KA 4ASAA 4PU9A 4DUYE 1BGQA 1UY9A 1NHHA 4MU1A 1Y4UA 1YC1A 5LL6R 4LF5E 1XNRI 4AIMA 2CGFA 2YECA 4CWQA 2BYHA 2YKJA 4HACB 3Q5JA 4DR5I 1YT2A 1PVGA 1XNRE 4JASA 3M85G 4URLA 3ZM7A 4EMDA 3WU5A 1H72C 2XEXA 4IFDF 2A2CA 2O1VA 5A2QQ 5IWAI 4DR5E 3HZ1A 4MYTA 3U67A 5DNXA 2HK3A 1H7SA 1FWLA 4QNJA 3A0RA 2BA0G 1R6MA 3P06A 1AH8A 5IWAE 4LPBA 3R91A 1S4EA 4MPCA 4L91A 4XCLA 1UYGA 1YT1A 4PRVA 1I5AA 2BR2B 3CGYA 5CTUA 3Q6MA 4UROA 3U2KA 4YKZA 5FWKA 2YE9A 2YEGA 1GKXA 1N36I 1GKZA 3J81Q 4ISAA 5K36F 4LFCI 2WI3A 4GQTA 1N36E 3P3GA 1UYKA 4H81A 2XDSA 3OMUA 1A6FA 1ZM3A 4K0KI 2Q8HA 4MP2A 4LFCE 4IFDA 2FYPA 3A0TA 3V2UC 3DD6A 4DUZI 5C0XF 2GQPA 2CCUA 4K0KE 4DZYA 1K47A 2YEAA 4NH9A 2JE6A 4XDMA 4DUZE 2DEIA 1IBKI 2FWYA 2WERA 2YE3A 3R4NA 4O04A 5IT9C 4MU0A 3K1JA 5JEAA 2YGEA 3VHCA 2QFOA 4IZKB 2YE6A 1FKAE 1IBKE 4XKOA 2BM0A 3L7ZA 4MU4A 4DU7A 3RLPA 4CWTA 3WU6A 4P52A 4E02A 4DV5I 1KZNA 4YKWA 3K60A 1Z0BA 1Z0CA 3G75A 1AM1A 1UDSA 4MPEA 2VQEI 3J7AG 1YC4A 3QT7A 4CWOA 3WHAA 1Z5BA 4DV3I 4DV5E 4XKKA 1B3QA 2O1TA 1BYQA 3O2FA 3ZXQA 5ELWA 5C0XA 2VQEE 4CE2A 4DV3E 4JI6I 4MBCA 4IFDD 2UXDI 3R4PA 5CTWA 2UXCE 3T10A 2XDLA 3BMYA 4IZJB 2YJWA 2GQ0A 1ZM4A 1F51A 2UXDE 4YKQA 5IDMA 2CG9A 1Z0WA 2WP8B 4ASFA 1UYMA 2WI2A 2UU9I 4AWQA 4B7PA 3KRNA 3P3CA 5DROA 4BXIA 3D2RA 2WI7A 4IFDE 2PNRA 4XITA 4XIPA 2UU9E 4DU8A 4LF6E 2YE5A 2BYIA 2YEIA 2FWZA 5K36D 2R42A 2GFDA 5BOCA 2BU6A 4LCHA 1HNZI 1ZW9A 4KP4A 4L90A 2HCHA 3PYGA 5D7DA 4FPPA 3CGZA 1L0OA 2C38A 1A4HA 1HNZE 4CWNA 4Z7YA 3B82A 2PNLA 4WUCA 5C0XD 1I5DA 3B27A 3JAMC 2JEBB 4L93A 3QT6A 4DR2I 5CF0A 5K36E 2HKEA 4MU3A 3M6AA 4YY3I 2YE2A 2J65A 2XDUA 2YE7A 2WEPA 3JZ3A 1TC6A 3UHMA 2PO2B 4FWHA 4DR2E 2XJXA 3HULA 3INWA 1Y8NA 2IWXA 3SL2A 2AJ4A 4YY3E 2EFGA 2XD6A 1HNWI 4Q20A 5C0XE 2GO3A 3B25A 3HKMA 3NZKA 4B3SI 3GIGA 1IBLI 4AS9A 2CCSA 2VQFI 2UUCI 1H74A 2JEAA 2Z5BA 3P76A 1HNWE 4P8OA 1H73A 1TC0A 2VF3A 3WU4A 1HK7A 5FLXQ 4OO1D 3T1HI 4B3SE 1IBLE 3HEKA 1UYIA 4K4OA 4V26A 2VQFE 4JI0I 2IERA 3T1HE 2PO0A 2YI6A 4I3HA 4WUDA 2AE8A 4OZEA 1HR0I 2HHHI 4JI0E 2FXSA 4EMVA 1ZXNA 5LMUI 3TZ5A 3TZ4A 1AMWA 1ZWHA 1ZM2A 1Y8OA 1YHCA 2HHHE 4OO1E 2ESAA 4M1KA 3GCMA 1HR0E 3ZXOA 5IDJA 5LMUE 1UY6A 4DPUA 3P3EA 4USKA 2YEEA 4X66I 4DV1I 4DR1I 3CRLA 4NBQA 2YI5A 3CYGA 2CVEA 4XIRA 4HACA 2E0AA 2PO1B 2Q2EB 4DXLA 4DR6I 4X66E 4DV1E 4DR1E 1N34I 3TZ2A 4FW5A 1EI1A 1S16A 2NN6C 2F4VI 3H80A 4P7AA 3CRKA 2V2ZA 4DR6E 3B24A 1N34E 2WI4A 1J5EI 3QTFA 2GS8A 4LWEA 3QDDA 2F4VE 4GKKI 5D6QA 2E1RA 4KSGA 1Z0EA 4O07A 2QG2A 1J5EE 3G7EA 2BR2A 5F3KA 5IT9Q 4JYAI 4GKKE 1KKHA 4R3MA 4YKXA 4GCZA 3H4LA 4O0BA 1BXDA 4FCRA 4R3AA 1OSFA 4JYAE 4JG4A 4AM3A 1USVA 5JEAF 2BZ5A 2HHIA 4H7QA 2XHXA 4WUBA 3PYEA 1N33I 4CWPA 4DR7I 1KTVA 1US7A 1ZXMA 2XX4A 3K98A 4HXWA 2Z5CB 4DV2I 2O1UA 5FNCA 1N33E 3V5RA 4DR7E 3O0IA 2ZDXA 2NN6B 1FJGI 2VCIA 4EGIA 1UYFA 4DV2E 2X7IA 4URMA 4AWPA 3FV5A 2Q8FA 3QT8A 4UT4A 4IZKA 4ED4A 1FJGE 4X65I 3PYFA 4V25A 4B6CA 2JKIA 1UYEA 2YEBA 1E3PA 4B3RI 4JAUA 4EM7A 4DV7I 2LJPA 2CCTA 4X65E 4XD8A 2YI7A 1H7UA 1UDNA 4BA1B 4B3RE 2Z5EA 5K36C 4FMTA 4DV7E 4OKGA 4Z7CA 2BU7A 1I94I 5GGZA 2Q8GA 1UY7A 1YETA 1ZM9A 1XHKA 2V2QA 1Z5CA 4LWHA 2X36A 3ZZTA 4CE3A 1I94E 1FNMA 4IZJA 2UXCI 1U0ZA 1YSRA 4FCQA 3HHUA 5D6PA 3T1YI 2BV3A 1AH6A 5D7RA 3HYYA 4YKUA 5C93A 2F1DA 2WP8A 3EHGA 3R4OA 4ZKIA 2C2AA
chains in the Genus database with same CATH topology
3T1YE 2XX2A 5GMDA 1YC3A 1UEKA 4DR3I 5M4NA 3Q1QA 5FNFA 2YKBA 2ZM6I 2YE4A 4LF6I 2J7KA 2DEJA 2XDKA 5BODA 4ZVIA 4DR3E 3K17A 4LWIA 4XCJA 4KHPI 4JI2I 2ZM6E 1UYHA 1U2RA 4QPKA 2UUAI 3J80Q 1AJ6A 3K99A 2R3VA 1B63A 4HY1A 3OTOI 4JI2E 4KHPE 2UWDA 3TTZA 4EGHA 3D0BA 4DPTA 1I5BA 1UYDA 2UUAE 3PEHA 1EA6A 2WI1A 4CE1A 4DPYA 2BTZA 4JI3I 3OTOE 2XCMA 3F0NA 1TILA 2BU2A 2XK2A 1D6TA 2YEFA 4IZJD 1NHJA 4JI3E 4KTNA 2WI5A 3PYDA 4LWFA 4DPXA 3FT8A 3R92A 3GIEA 2ZITA 3A0ZA 5F5RA 2BSMA 4JI1I 2V34A 3LPSA 4N3OA 2XJGA 3EHFA 1QYEA 1PIEA 1XMOI 4JI8I 4JI1E 3R4MA 5M4HA 4FCPA 2XDXA 2CZ9A 4EFTA 2E5LI 5BR8I 2JJCA 4HY6A 4U7NA 1XMOE 4JI8E 2YI0A 2UUBI 4FWDA 2E5LE 5BR8E 5CTXA 1DARA 2VCJA 1S14A 1Z59A 4JI5I 4MB9A 4NXMI 1Z0TA 2UUBE 2EXLA 1BKNA 3DGEA 1YS3A 3EKOA 4JI5E 2XABA 3A0YA 3EHJA 4JQLA 4NXME 1XMQI 4YKTA 1I59A 1UYCA 5M4EA 4LFBI 2BU5A 4AQYE 2H8MA 2BM1A 4XTJA 1I58A 1XMQE 4LP0A 3CWVA 2HKJA 4B3TI 2NPFA 4LFBE 5M4PA 4XC0A 4KSHA 3NMQA 4B3TE 2VWCA 2WEQA 1UY8A 3O6OA 3T2SA 4GT8A 1TH8A 3OWBA 4XIQA 4YHHI 5J71A 1KVKA 1N0VC 2CH4A 3GIFA 3QT5A 4GFNA 4YHHE 3OW6A 4DV6I 4W7TA 1THNA 4KQVA 2V2VA 4E00A 4LF9I 3B28A 4DPWA 3B26A 4GKJI 4U7OA 1RREA 3EKRA 2Z5CA 4DV6E 3Q6NA 4HZ0A 4LF9E 4LF8I 4B3MI 3A0XA 4GKJE 4NH7A 2Q8IA 1NZ0A 3T1KA 3VHDA 4LF8E 4B3ME 1OJ4A 2H55A 4L94A 4NH8A 5FLXC 4LF7I 2YK2A 1TBWA 2XHTA 4USMA 4QPJA 4MP7A 4EEHA 2BRCA 5GMEA 3U2DA 4LF7E 4DR4I 3FT5A 3G7BA 4R1FA 5CTYA 2BT0A 1GJVA 3Q5LA 4DV4I 1MX0A 4DR4E 2QG0A 2HK2A 2VW5A 2HFSA 5D7CA 4AWOA 1XNQI 2IOQA 2O1WA 4DV4E 3D36A 2IWSA 2ZBKB 1UYLA 4HYPA 1MG7A 1VISA 4HZ5A 1USUA 4X9LA 4X62I 1XNQE 3HJCA 5FNDA 4UTGA 3VHAA 3C0EA 1QZRA 1Y8PA 4X62E 3EHHA 4DUHA 4I5SA 3ZZUA 1Y4SA 3JAMQ 3K85A 1Y6ZA 2YEHA 4L8ZA 4BIZA 4FN5A 1YERA 3B8HA 1Z0GA 2ZKJA 2WW4A 5A2QC 1TIDA 1JM6A 4MPNA 2YGFA 2YK9A 1RR9A 3LTOA 4GEEA 2AKPA 3GONA 4YKRA 4CWSA 1PKPA 1MU5A 4PL9A 4O09A 3J7AM 4LFAI 5CPHA 2HG1A 3D4JA 3OPDA 3ZZ0A 5J6AA 4JI4I 3J81C 4LFAE 1ID0A 4U93A 3IEDA 4HYMA 2IWUA 1WUUA 4O05A 4GGLA 4URNA 1U2OA 1Z5AA 1YT0A 4JI4E 2YEDA 3T0HA 1IBMI 2XJJA 4XE2A 2YKIA 2V8PA 2QF6A 4BQJA 1I5CA 2HFUA 3K97A 4DV0I 2CGEA 1IBME 1YSZA 4JI6E 1YESA 2YKEA 4JAVA 2YEJA 2UXBI 4H85A 2IOPA 4DV0E 2YGAA 3RLRA 3KE6A 1NHIA 2XHRA 3LNUA 5M4MA 2UXBE 2PNMA 1N32I 3ZKBA 2ZDYA 3T0ZA 4OX9I 4HXZA 1N32E 2A2DA 4MYUA 1R62A 2YJXA 2XX5A 4OX9E 4LF4I 3RKZA 4NXNI 4BIUA 4E01A 1ELOA 4FWGA 2K5BA 4YKYA 2BU8A 3WU3A 4LF4E 4NXNE 3PEJA 1N0UA 2IORA 4PRXA 4AQYI 1QY8A 4CWRA 4CWFA 2WI6A 4LWGA 3Q5KA 4ASGA 4ASBA 4EGKA 3HZ5A 3HYZA 2OI2A 3BM9A 1B62A 5IN9A 2YE8A 1FI4A 4KFGA 3VADA 4FW9A 2UUCE 4EFUA 1Z0VA 5LMNI 3J80C 3GIGB 3INXA 4RPFA 4XKAA 1HNXI 4BQGA 2Z5BB 3C11A 3RLQA 2YKCA 4JI7I 3TUHA 4X64I 5LMNE 3ZKDA 4JV5I 3B78A 3OWDA 1HNXE 5L3JA 1KIJA 4JI7E 3WQ9A 3MNRP 4MOTA 4X64E 3PRYA 4DUYI 4JV5E 3A0WA 3TZ0A 1FWKA 4BAEA 2BREA 4LF5I 5M4KA 4ASAA 4PU9A 4DUYE 1BGQA 1UY9A 1NHHA 1Y4UA 1YC1A 5LL6R 4LF5E 1XNRI 2CGFA 2YECA 4CWQA 2BYHA 2YKJA 4HACB 3Q5JA 4DR5I 1YT2A 1PVGA 1XNRE 4JASA 4URLA 3ZM7A 4EMDA 3WU5A 1H72C 2XEXA 2A2CA 2O1VA 5A2QQ 5IWAI 4DR5E 3HZ1A 4MYTA 3U67A 2HK3A 1H7SA 1FWLA 3A0RA 3P06A 1AH8A 5IWAE 4LPBA 3R91A 1S4EA 4MPCA 4L91A 4XCLA 1UYGA 1YT1A 4PRVA 1I5AA 3CGYA 5CTUA 3Q6MA 4UROA 3U2KA 4YKZA 5FWKA 2YE9A 2YEGA 1GKXA 1N36I 1GKZA 3J81Q 4LFCI 2WI3A 4GQTA 1N36E 1UYKA 4H81A 2XDSA 3OMUA 1A6FA 1ZM3A 4K0KI 2Q8HA 4MP2A 4LFCE 2FYPA 3A0TA 3V2UC 4DUZI 2GQPA 2CCUA 4K0KE 4DZYA 1K47A 2YEAA 4NH9A 4XDMA 4DUZE 2DEIA 1IBKI 2FWYA 2WERA 2YE3A 3R4NA 4O04A 5IT9C 2YGEA 3K1JA 3VHCA 2QFOA 4IZKB 2YE6A 1FKAE 1IBKE 4XKOA 2BM0A 4DU7A 4CWTA 3RLPA 3WU6A 4P52A 4E02A 4DV5I 1KZNA 4YKWA 3K60A 1Z0BA 1Z0CA 3G75A 1AM1A 4MPEA 2VQEI 3J7AG 1YC4A 3QT7A 4CWOA 3WHAA 1Z5BA 4DV3I 4DV5E 4XKKA 1B3QA 2O1TA 1BYQA 3O2FA 3ZXQA 2VQEE 4CE2A 4DV3E 4JI6I 4MBCA 2UXDI 3R4PA 5CTWA 2UXCE 3T10A 2XDLA 3BMYA 4IZJB 2YJWA 2GQ0A 1ZM4A 2UXDE 4YKQA 5IDMA 2CG9A 1Z0WA 4ASFA 1UYMA 2WI2A 2UU9I 4AWQA 4B7PA 4BXIA 3D2RA 2WI7A 2PNRA 4XITA 4XIPA 2UU9E 4DU8A 4LF6E 2YE5A 2BYIA 2YEIA 2FWZA 2R42A 2GFDA 5BOCA 2BU6A 1HNZI 1ZW9A 4KP4A 4L90A 2HCHA 3PYGA 5D7DA 4FPPA 3CGZA 1L0OA 1A4HA 1HNZE 4CWNA 4Z7YA 3B82A 2PNLA 4WUCA 1I5DA 3B27A 3JAMC 4L93A 3QT6A 4DR2I 5CF0A 2HKEA 3M6AA 2YE2A 4YY3I 2XDUA 2YE7A 2WEPA 3JZ3A 1TC6A 2XJXA 4FWHA 4DR2E 3INWA 3HULA 3SL2A 1Y8NA 2IWXA 2AJ4A 4YY3E 2EFGA 2XD6A 1HNWI 4Q20A 3B25A 4B3SI 3GIGA 1IBLI 4AS9A 2CCSA 2VQFI 2UUCI 1H74A 1HNWE 2Z5BA 4P8OA 1H73A 1TC0A 2VF3A 3WU4A 1HK7A 5FLXQ 3T1HI 4B3SE 1IBLE 3HEKA 1UYIA 4K4OA 4V26A 2VQFE 4JI0I 3T1HE 2YI6A 4I3HA 4WUDA 2HHHI 1HR0I 4JI0E 2FXSA 4EMVA 1ZXNA 5LMUI 3TZ5A 3TZ4A 1AMWA 1ZWHA 1ZM2A 1Y8OA 2ESAA 2HHHE 3ZXOA 4M1KA 1HR0E 5IDJA 5LMUE 1UY6A 4DPUA 4USKA 2YEEA 4X66I 4DV1I 4DR1I 3CRLA 2YI5A 4XIRA 4HACA 2E0AA 2Q2EB 4DXLA 4DR6I 4X66E 4DV1E 4DR1E 1N34I 3TZ2A 2F4VI 1EI1A 1S16A 3H80A 4P7AA 3CRKA 2V2ZA 4DR6E 3B24A 1N34E 2WI4A 1J5EI 3QTFA 2GS8A 4LWEA 3QDDA 2F4VE 4GKKI 5D6QA 2E1RA 4KSGA 1Z0EA 4O07A 2QG2A 1J5EE 3G7EA 5F3KA 5IT9Q 4JYAI 4GKKE 1KKHA 4R3MA 4YKXA 4GCZA 3H4LA 4O0BA 1BXDA 4FCRA 4R3AA 1OSFA 4JYAE 4JG4A 1USVA 2BZ5A 4H7QA 2XHXA 4WUBA 3PYEA 1N33I 4CWPA 4DR7I 1KTVA 1US7A 1ZXMA 2XX4A 3K98A 4HXWA 2Z5CB 4DV2I 2O1UA 5FNCA 1N33E 3V5RA 4DR7E 3O0IA 2ZDXA 2VCIA 1FJGI 4EGIA 1UYFA 4DV2E 2X7IA 4URMA 4AWPA 3FV5A 2Q8FA 3QT8A 4UT4A 4IZKA 4ED4A 1FJGE 4X65I 3PYFA 4V25A 4B6CA 2JKIA 1UYEA 2YEBA 4B3RI 4JAUA 4EM7A 4DV7I 2LJPA 2CCTA 4X65E 4XD8A 2YI7A 1H7UA 4B3RE 2Z5EA 4FMTA 4DV7E 4Z7CA 2BU7A 1I94I 5GGZA 2Q8GA 1UY7A 1YETA 1ZM9A 1XHKA 2V2QA 1Z5CA 4LWHA 2X36A 3ZZTA 4CE3A 1I94E 1FNMA 4IZJA 2UXCI 1U0ZA 1YSRA 4FCQA 3HHUA 5D6PA 3T1YI 2BV3A 1AH6A 5D7RA 3HYYA 4YKUA 5C93A 3R4OA 3EHGA 4ZKIA 2C2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1Y E;  2XX2 A;  5GMD A;  1YC3 A;  1UEK A;  4DR3 I;  5M4N A;  3Q1Q A;  5FNF A;  2YKB A;  2ZM6 I;  2YE4 A;  4LF6 I;  2J7K A;  2DEJ A;  2XDK A;  5BOD A;  4ZVI A;  4DR3 E;  3K17 A;  4LWI A;  4XCJ A;  4KHP I;  4JI2 I;  2ZM6 E;  1UYH A;  1U2R A;  4QPK A;  2UUA I;  3J80 Q;  1AJ6 A;  3K99 A;  2R3V A;  1B63 A;  4HY1 A;  3OTO I;  4JI2 E;  4KHP E;  2UWD A;  3TTZ A;  4EGH A;  3D0B A;  4DPT A;  1I5B A;  1UYD A;  2UUA E;  3PEH A;  1EA6 A;  2WI1 A;  4CE1 A;  4DPY A;  2BTZ A;  4JI3 I;  3OTO E;  2XCM A;  3F0N A;  1TIL A;  2BU2 A;  2XK2 A;  1D6T A;  2YEF A;  1NHJ A;  4JI3 E;  4KTN A;  2WI5 A;  3PYD A;  4LWF A;  4DPX A;  3FT8 A;  3R92 A;  3GIE A;  2ZIT A;  3A0Z A;  5F5R A;  2BSM A;  4JI1 I;  2V34 A;  3LPS A;  2XJG A;  3EHF A;  1QYE A;  1PIE A;  1XMO I;  4JI8 I;  4JI1 E;  3R4M A;  5M4H A;  4FCP A;  2XDX A;  2CZ9 A;  4EFT A;  2E5L I;  5BR8 I;  2JJC A;  4HY6 A;  4U7N A;  1XMO E;  4JI8 E;  2YI0 A;  2UUB I;  4FWD A;  2E5L E;  5BR8 E;  5CTX A;  1DAR A;  2VCJ A;  1S14 A;  1Z59 A;  4JI5 I;  4MB9 A;  4NXM I;  1Z0T A;  2UUB E;  2EXL A;  1BKN A;  3DGE A;  1YS3 A;  3EKO A;  4JI5 E;  2XAB A;  3A0Y A;  3EHJ A;  4JQL A;  4NXM E;  1XMQ I;  4YKT A;  1I59 A;  1UYC A;  5M4E A;  4LFB I;  2BU5 A;  4AQY E;  2H8M A;  2BM1 A;  4XTJ A;  1I58 A;  1XMQ E;  4LP0 A;  3CWV A;  2HKJ A;  4B3T I;  2NPF A;  4LFB E;  5M4P A;  4XC0 A;  4KSH A;  3NMQ A;  4B3T E;  2VWC A;  2WEQ A;  1UY8 A;  3O6O A;  3T2S A;  4GT8 A;  1TH8 A;  3OWB A;  4XIQ A;  4YHH I;  5J71 A;  1KVK A;  1N0V C;  2CH4 A;  3GIF A;  3QT5 A;  4GFN A;  4YHH E;  3OW6 A;  4DV6 I;  4W7T A;  1THN A;  4KQV A;  2V2V A;  4E00 A;  4LF9 I;  3B28 A;  4DPW A;  3B26 A;  4GKJ I;  4U7O A;  1RRE A;  3EKR A;  4DV6 E;  4HZ0 A;  4LF9 E;  4LF8 I;  4B3M I;  3A0X A;  4GKJ E;  4NH7 A;  2Q8I A;  1NZ0 A;  3T1K A;  3VHD A;  4LF8 E;  4B3M E;  1OJ4 A;  2H55 A;  4L94 A;  4NH8 A;  5FLX C;  4LF7 I;  2YK2 A;  1TBW A;  2XHT A;  4USM A;  4QPJ A;  4MP7 A;  4EEH A;  2BRC A;  5GME A;  3U2D A;  4LF7 E;  4DR4 I;  3FT5 A;  3G7B A;  4R1F A;  5CTY A;  2BT0 A;  1GJV A;  3Q5L A;  4DV4 I;  1MX0 A;  4DR4 E;  2QG0 A;  2HK2 A;  2VW5 A;  2HFS A;  5D7C A;  4AWO A;  1XNQ I;  2IOQ A;  2O1W A;  4DV4 E;  3D36 A;  2IWS A;  2ZBK B;  1UYL A;  4HYP A;  1MG7 A;  1VIS A;  4HZ5 A;  4X9L A;  4X62 I;  1XNQ E;  5FND A;  4UTG A;  3VHA A;  3C0E A;  1QZR A;  1Y8P A;  4X62 E;  3EHH A;  4DUH A;  4I5S A;  3ZZU A;  3JAM Q;  1Y4S A;  2YEH A;  4L8Z A;  4BIZ A;  4FN5 A;  1YER A;  3B8H A;  1Z0G A;  2ZKJ A;  2WW4 A;  5A2Q C;  1TID A;  1JM6 A;  4MPN A;  2YGF A;  2YK9 A;  1RR9 A;  3LTO A;  4GEE A;  2AKP A;  3GON A;  4YKR A;  4CWS A;  1PKP A;  1MU5 A;  4PL9 A;  4O09 A;  3J7A M;  4LFA I;  5CPH A;  2HG1 A;  3D4J A;  3OPD A;  3ZZ0 A;  5J6A A;  4JI4 I;  3J81 C;  4LFA E;  1ID0 A;  4U93 A;  3IED A;  4HYM A;  2IWU A;  1WUU A;  4O05 A;  4GGL A;  4URN A;  1U2O A;  1Z5A A;  1YT0 A;  4JI4 E;  2YED A;  3T0H A;  1IBM I;  2XJJ A;  4XE2 A;  2YKI A;  2V8P A;  2QF6 A;  4BQJ A;  1I5C A;  2HFU A;  3K97 A;  4DV0 I;  1YSZ A;  1IBM E;  4JI6 E;  1YES A;  2YKE A;  4JAV A;  2YEJ A;  2UXB I;  4H85 A;  2IOP A;  4DV0 E;  2YGA A;  3RLR A;  3KE6 A;  1NHI A;  2XHR A;  3LNU A;  5M4M A;  2UXB E;  1N32 I;  3ZKB A;  2ZDY A;  3T0Z A;  4OX9 I;  4HXZ A;  1N32 E;  2A2D A;  4MYU A;  1R62 A;  2YJX A;  2XX5 A;  4OX9 E;  4LF4 I;  3RKZ A;  4NXN I;  4BIU A;  4E01 A;  1ELO A;  4FWG A;  2K5B A;  4YKY A;  2BU8 A;  3WU3 A;  4LF4 E;  4NXN E;  3PEJ A;  1N0U A;  2IOR A;  4PRX A;  4AQY I;  1QY8 A;  4CWR A;  4CWF A;  2WI6 A;  4LWG A;  3Q5K A;  4ASG A;  4ASB A;  4EGK A;  3HZ5 A;  3HYZ A;  2OI2 A;  3BM9 A;  1B62 A;  5IN9 A;  2YE8 A;  1FI4 A;  4KFG A;  3VAD A;  4FW9 A;  2UUC E;  4EFU A;  1Z0V A;  5LMN I;  3J80 C;  3GIG B;  3INX A;  4RPF A;  4XKA A;  1HNX I;  4BQG A;  3C11 A;  3RLQ A;  2YKC A;  4JI7 I;  3TUH A;  4X64 I;  5LMN E;  3ZKD A;  4JV5 I;  3B78 A;  3OWD A;  1HNX E;  5L3J A;  1KIJ A;  4JI7 E;  3WQ9 A;  3MNR P;  4MOT A;  4X64 E;  4DUY I;  4JV5 E;  3A0W A;  3TZ0 A;  1FWK A;  4BAE A;  2BRE A;  4LF5 I;  5M4K A;  4ASA A;  4PU9 A;  4DUY E;  1BGQ A;  1UY9 A;  1NHH A;  1Y4U A;  1YC1 A;  5LL6 R;  4LF5 E;  1XNR I;  2CGF A;  2YEC A;  4CWQ A;  2BYH A;  2YKJ A;  4HAC B;  3Q5J A;  4DR5 I;  1YT2 A;  1PVG A;  1XNR E;  4JAS A;  4URL A;  3ZM7 A;  4EMD A;  3WU5 A;  1H72 C;  2XEX A;  2A2C A;  5A2Q Q;  5IWA I;  4DR5 E;  2O1V A;  3HZ1 A;  4MYT A;  3U67 A;  2HK3 A;  1H7S A;  1FWL A;  3A0R A;  1AH8 A;  4LPB A;  5IWA E;  3R91 A;  1S4E A;  4MPC A;  4L91 A;  4XCL A;  1UYG A;  1YT1 A;  4PRV A;  1I5A A;  3CGY A;  5CTU A;  4URO A;  3U2K A;  4YKZ A;  5FWK A;  2YE9 A;  2YEG A;  1GKX A;  1N36 I;  1GKZ A;  3J81 Q;  4LFC I;  2WI3 A;  4GQT A;  1N36 E;  1UYK A;  4H81 A;  2XDS A;  3OMU A;  1A6F A;  1ZM3 A;  4K0K I;  2Q8H A;  4MP2 A;  4LFC E;  2FYP A;  3A0T A;  3V2U C;  4DUZ I;  2GQP A;  2CCU A;  4K0K E;  4DZY A;  1K47 A;  2YEA A;  4NH9 A;  4XDM A;  4DUZ E;  2DEI A;  1IBK I;  2FWY A;  2WER A;  2YE3 A;  3R4N A;  4O04 A;  5IT9 C;  2YGE A;  3K1J A;  3VHC A;  2QFO A;  2YE6 A;  1FKA E;  1IBK E;  4XKO A;  2BM0 A;  4DU7 A;  4CWT A;  3RLP A;  3WU6 A;  4P52 A;  4E02 A;  4DV5 I;  1KZN A;  4YKW A;  3K60 A;  1Z0B A;  1Z0C A;  3G75 A;  1AM1 A;  4MPE A;  2VQE I;  3J7A G;  1YC4 A;  3QT7 A;  4CWO A;  3WHA A;  1Z5B A;  4DV3 I;  4DV5 E;  4XKK A;  1B3Q A;  3ZXQ A;  1BYQ A;  3O2F A;  2VQE E;  4CE2 A;  4DV3 E;  4JI6 I;  4MBC A;  2UXD I;  3R4P A;  5CTW A;  2UXC E;  3T10 A;  2XDL A;  3BMY A;  2YJW A;  1ZM4 A;  2UXD E;  4YKQ A;  5IDM A;  2CG9 A;  1Z0W A;  4ASF A;  1UYM A;  2WI2 A;  2UU9 I;  4AWQ A;  4B7P A;  4BXI A;  3D2R A;  2WI7 A;  2PNR A;  4XIT A;  4XIP A;  2UU9 E;  4DU8 A;  4LF6 E;  2YE5 A;  2BYI A;  2YEI A;  2FWZ A;  2R42 A;  2GFD A;  5BOC A;  2BU6 A;  1HNZ I;  1ZW9 A;  4KP4 A;  4L90 A;  2HCH A;  3PYG A;  5D7D A;  4FPP A;  3CGZ A;  1L0O A;  1A4H A;  1HNZ E;  4CWN A;  4Z7Y A;  3B82 A;  4WUC A;  1I5D A;  3B27 A;  3JAM C;  4L93 A;  3QT6 A;  4DR2 I;  5CF0 A;  2HKE A;  3M6A A;  2YE2 A;  4YY3 I;  2XDU A;  2YE7 A;  2WEP A;  3JZ3 A;  1TC6 A;  2XJX A;  4FWH A;  4DR2 E;  3INW A;  3HUL A;  3SL2 A;  1Y8N A;  2IWX A;  2AJ4 A;  4YY3 E;  2EFG A;  2XD6 A;  1HNW I;  4Q20 A;  3B25 A;  4B3S I;  3GIG A;  1IBL I;  4AS9 A;  2CCS A;  2VQF I;  2UUC I;  1H74 A;  1HNW E;  4P8O A;  1H73 A;  1TC0 A;  2VF3 A;  3WU4 A;  5FLX Q;  3T1H I;  4B3S E;  1IBL E;  3HEK A;  1UYI A;  4K4O A;  4V26 A;  2VQF E;  4JI0 I;  3T1H E;  2YI6 A;  4I3H A;  4WUD A;  2HHH I;  1HR0 I;  4JI0 E;  2FXS A;  4EMV A;  1ZXN A;  5LMU I;  3TZ5 A;  3TZ4 A;  1AMW A;  1ZWH A;  1ZM2 A;  1Y8O A;  2ESA A;  2HHH E;  3ZXO A;  4M1K A;  1HR0 E;  5IDJ A;  5LMU E;  1UY6 A;  4DPU A;  4USK A;  2YEE A;  4X66 I;  4DV1 I;  4DR1 I;  3CRL A;  2YI5 A;  4XIR A;  4HAC A;  2E0A A;  2Q2E B;  4DXL A;  4DR6 I;  4X66 E;  4DV1 E;  4DR1 E;  1N34 I;  3TZ2 A;  2F4V I;  1EI1 A;  1S16 A;  3H80 A;  4P7A A;  3CRK A;  2V2Z A;  4DR6 E;  3B24 A;  1N34 E;  2WI4 A;  1J5E I;  3QTF A;  2GS8 A;  4LWE A;  3QDD A;  2F4V E;  4GKK I;  5D6Q A;  2E1R A;  4KSG A;  1Z0E A;  4O07 A;  2QG2 A;  1J5E E;  3G7E A;  5F3K A;  5IT9 Q;  4JYA I;  4GKK E;  1KKH A;  4R3M A;  4YKX A;  4GCZ A;  3H4L A;  4O0B A;  1BXD A;  4FCR A;  4R3A A;  1OSF A;  4JYA E;  4JG4 A;  2BZ5 A;  4H7Q A;  2XHX A;  4WUB A;  3PYE A;  1N33 I;  4CWP A;  4DR7 I;  1KTV A;  1US7 A;  1ZXM A;  2XX4 A;  3K98 A;  4HXW A;  4DV2 I;  2O1U A;  5FNC A;  1N33 E;  3V5R A;  4DR7 E;  3O0I A;  2ZDX A;  2VCI A;  1FJG I;  4EGI A;  1UYF A;  4DV2 E;  2X7I A;  4URM A;  4AWP A;  3FV5 A;  2Q8F A;  3QT8 A;  4UT4 A;  4ED4 A;  1FJG E;  4X65 I;  3PYF A;  4V25 A;  4B6C A;  2JKI A;  1UYE A;  2YEB A;  4B3R I;  4JAU A;  4EM7 A;  4DV7 I;  2LJP A;  2CCT A;  4X65 E;  4XD8 A;  2YI7 A;  1H7U A;  4B3R E;  4FMT A;  4DV7 E;  4Z7C A;  2BU7 A;  1I94 I;  5GGZ A;  2Q8G A;  1UY7 A;  1YET A;  1ZM9 A;  1XHK A;  2V2Q A;  1Z5C A;  4LWH A;  2X36 A;  3ZZT A;  4CE3 A;  1I94 E;  1FNM A;  1U0Z A;  2UXC I;  1YSR A;  4FCQ A;  3HHU A;  5D6P A;  3T1Y I;  2BV3 A;  1AH6 A;  5D7R A;  3HYY A;  4YKU A;  5C93 A;  3R4O A;  3EHG A;  4ZKI A;  2C2A A; 
#chains in the Genus database with same CATH topology
 3T1Y E;  2XX2 A;  5GMD A;  1YC3 A;  1UEK A;  2C1I A;  2JT2 A;  4DR3 I;  4BA2 A;  5M4N A;  3Q1Q A;  5FNF A;  2YKB A;  2ZM6 I;  2YE4 A;  4LF6 I;  2J7K A;  4LPF A;  2DEJ A;  2XDK A;  5BOD A;  5JEA D;  2C39 B;  4ZVI A;  4DR3 E;  3K17 A;  4LWI A;  4XCJ A;  4KHP I;  4OO1 C;  4JI2 I;  2ZM6 E;  3GLL A;  4BA2 B;  4MDT A;  1UYH A;  4E72 A;  1U2R A;  5K36 B;  2UUA I;  4QPK A;  3J80 Q;  2GO4 A;  1AJ6 A;  3K99 A;  2R3V A;  1B63 A;  4HY1 A;  3OTO I;  4JI2 E;  4KHP E;  2UWD A;  3TTZ A;  2JEB A;  4EGH A;  3D0B A;  4DPT A;  1I5B A;  1UYD A;  2UUA E;  2O3Z A;  1EA6 A;  2WI1 A;  3PEH A;  1IXM A;  4DPY A;  2BTZ A;  4JI3 I;  4CE1 A;  5JEA E;  3OTO E;  2XCM A;  3F0N A;  1TIL A;  2BU2 A;  2PO2 A;  1D6T A;  2XK2 A;  4IZJ D;  2YEF A;  1NHJ A;  4JI3 E;  4KTN A;  4FW3 A;  2WI5 A;  3PYD A;  4LWF A;  2BA1 G;  4DPX A;  3FT8 A;  3R92 A;  3GIE A;  3PS1 A;  5DNL A;  2ZIT A;  3A0Z A;  5F5R A;  2BSM A;  4JI1 I;  2V34 A;  1E3H A;  3LPS A;  4N3O A;  4U3D A;  2XJG A;  3EHF A;  1QYE A;  1PIE A;  1XMO I;  1XXE A;  4JI8 I;  4JI1 E;  3R4M A;  5M4H A;  1OYR A;  2XDX A;  2CZ9 A;  4FCP A;  4EFT A;  2E5L I;  5BR8 I;  4OO1 B;  2JJC A;  4HY6 A;  4U7N A;  2PNZ B;  2IES A;  1XMO E;  4JI8 E;  2YI0 A;  3M7N D;  2UUB I;  4FWD A;  2E5L E;  5BR8 E;  5CTX A;  1DAR A;  2VCJ A;  1S14 A;  3S5T A;  1Z59 A;  4JI5 I;  4MB9 A;  4NXM I;  1Z0T A;  2UUB E;  2EXL A;  1BKN A;  5DRQ A;  3DGE A;  1YS3 A;  3EKO A;  1Y5Y A;  4JI5 E;  2XAB A;  2PO1 A;  3A0Y A;  3EHJ A;  4JQL A;  4NXM E;  1XMQ I;  4YKT A;  1I59 A;  1UYC A;  1P42 A;  5M4E A;  4LFB I;  2BU5 A;  4AQY E;  2H8M A;  2BM1 A;  3PS2 A;  4XTJ A;  1I58 A;  4J3D A;  1XMQ E;  4LP0 A;  3CWV A;  2HKJ A;  3GME A;  4B3T I;  2NPF A;  4LFB E;  5M4P A;  5EKW A;  4XC0 A;  4FW4 A;  4KSH A;  2WNR B;  2NN6 F;  3U1Y A;  3NMQ A;  4B3T E;  2VWC A;  2WEQ A;  1UY8 A;  3O6O A;  3T2S A;  4GT8 A;  1TH8 A;  3OWB A;  4AID A;  4XIQ A;  4YHH I;  5J71 A;  1KVK A;  1N0V C;  2CH4 A;  3GIF A;  3QT5 A;  4GFN A;  4YHH E;  3OW6 A;  3H1C A;  4DV6 I;  1THN A;  4KQV A;  2V2V A;  4W7T A;  4E00 A;  4LF9 I;  3B28 A;  4DPW A;  3B26 A;  4GKJ I;  4U7O A;  1RRE A;  3EKR A;  2Z5C A;  4DV6 E;  2FTK A;  3Q6N A;  4HZ0 A;  1Y60 A;  4LF9 E;  4LF8 I;  4B3M I;  3A0X A;  4GKJ E;  4NH7 A;  2Q8I A;  2NN6 A;  1NZ0 A;  3T1K A;  3VHD A;  4LF8 E;  4B3M E;  1OJ4 A;  3M7N G;  2H55 A;  4L94 A;  5FLX C;  4NH8 A;  4LF7 I;  2YK2 A;  1TBW A;  4IFD C;  2XHT A;  4USM A;  4QPJ A;  1UDQ A;  4MP7 A;  4U3B A;  2BRC A;  5GME A;  3U2D A;  4LF7 E;  4DR4 I;  2C1G A;  3FT5 A;  4EEH A;  3G7B A;  4R1F A;  5CTY A;  4IS9 A;  2BT0 A;  4LCF A;  1GJV A;  1OYS A;  3Q5L A;  4BA1 A;  4DV4 I;  1MX0 A;  4DR4 E;  2QG0 A;  2HK2 A;  2VW5 A;  5JEA C;  2HFS A;  5D7C A;  4AWO A;  1XNQ I;  2IOQ A;  2O1W A;  4DV4 E;  3D36 A;  2IWS A;  2ZBK B;  1UYL A;  4HYP A;  1MG7 A;  2BA1 D;  1VIS A;  4HZ5 A;  1USU A;  4X9L A;  4X62 I;  1XNQ E;  3HJC A;  5FND A;  4UTG A;  3VHA A;  3C0E A;  1QZR A;  1Y8P A;  4X62 E;  3EHH A;  4DUH A;  2NN6 D;  5C0X C;  4I5S A;  3ZZU A;  1Y4S A;  3JAM Q;  3K85 A;  1Y6Z A;  2YEH A;  4L8Z A;  4BIZ A;  4FN5 A;  1YER A;  3B8H A;  4IFD B;  1Z0G A;  2ZKJ A;  2WW4 A;  5A2Q C;  1TID A;  1JM6 A;  4MPN A;  2YGF A;  2YK9 A;  1RR9 A;  2C39 A;  3LTO A;  2AKP A;  4GEE A;  2JE6 B;  2NN6 E;  3GON A;  4YKR A;  4CWS A;  1PKP A;  1MU5 A;  5JEN A;  4PL9 A;  4LCG A;  4O09 A;  5K36 A;  3J7A M;  4LFA I;  5CPH A;  2HG1 A;  1OYP A;  5JEA B;  3D4J A;  3OPD A;  3ZZ0 A;  5J6A A;  4JI4 I;  4OO1 F;  3J81 C;  4LFA E;  3L7Z B;  1ID0 A;  4U93 A;  3IED A;  4HYM A;  5DRP A;  1WUU A;  2IWU A;  4GGL A;  4O05 A;  4URN A;  1U2O A;  1Z5A A;  1YT0 A;  4JI4 E;  2YED A;  3T0H A;  1IBM I;  2XJJ A;  4XE2 A;  5DRR A;  2YKI A;  2V8P A;  2QF6 A;  4BQJ A;  1I5C A;  2HFU A;  3CDI A;  3K97 A;  3CDJ A;  4DV0 I;  2CGE A;  1IBM E;  1YSZ A;  5C0X B;  4JI6 E;  1UDO A;  1YES A;  2YKE A;  4JAV A;  2YEJ A;  5EL9 A;  2UXB I;  4H85 A;  2IOP A;  4DV0 E;  2YGA A;  3RLR A;  3KE6 A;  1NHI A;  2XHR A;  4QNK A;  3LNU A;  3PS3 A;  5M4M A;  2UXB E;  2PNM A;  1N32 I;  1RHY A;  3ZKB A;  4OO1 A;  2ZDY A;  2PNZ A;  4FW7 A;  3T0Z A;  4OX9 I;  4HXZ A;  1N32 E;  1VI7 A;  2A2D A;  4MYU A;  1R62 A;  2YJX A;  2XX5 A;  4GQU A;  4OX9 E;  4LF4 I;  3RKZ A;  4NXN I;  4BIU A;  3M85 D;  4E01 A;  1R6L A;  1ELO A;  4FWG A;  2K5B A;  1YH8 A;  4YKY A;  2BU8 A;  3WU3 A;  4LF4 E;  4NXN E;  2C38 B;  3PEJ A;  1N0U A;  2IOR A;  2BA0 D;  4PRX A;  4AQY I;  1QY8 A;  2VES A;  4CWR A;  3LMM A;  4CWF A;  4LOM A;  2WI6 A;  3U1K A;  3Q5K A;  4LWG A;  3B4T A;  2WNR A;  4ASG A;  4ASB A;  4EGK A;  3HZ5 A;  3HYZ A;  2OI2 A;  3BM9 A;  1B62 A;  5IN9 A;  2YE8 A;  1FI4 A;  4KFG A;  3VAD A;  4FW9 A;  2C37 A;  2UUC E;  1Z0V A;  3J80 C;  5LMN I;  3GIG B;  3INX A;  4EFU A;  4RPF A;  4XKA A;  1HNX I;  2JEA B;  4BQG A;  2Z5B B;  3C11 A;  3RLQ A;  2YKC A;  4JI7 I;  3TUH A;  4X64 I;  5LMN E;  3ZKD A;  4JV5 I;  3B78 A;  3OWD A;  2C37 B;  1HNX E;  5L3J A;  1KIJ A;  4FW6 A;  4JI7 E;  3WQ9 A;  3MNR P;  4MOT A;  4X64 E;  3PRY A;  4MQY A;  2PO0 B;  4DUY I;  4JV5 E;  3A0W A;  3TZ0 A;  1FWK A;  4BAE A;  2BRE A;  4LF5 I;  5M4K A;  4ASA A;  4PU9 A;  4DUY E;  1BGQ A;  1UY9 A;  1NHH A;  4MU1 A;  1Y4U A;  1YC1 A;  5LL6 R;  4LF5 E;  1XNR I;  4AIM A;  2CGF A;  2YEC A;  4CWQ A;  2BYH A;  2YKJ A;  4HAC B;  3Q5J A;  4DR5 I;  1YT2 A;  1PVG A;  1XNR E;  4JAS A;  3M85 G;  4URL A;  3ZM7 A;  4EMD A;  3WU5 A;  1H72 C;  2XEX A;  4IFD F;  2A2C A;  2O1V A;  5A2Q Q;  5IWA I;  4DR5 E;  3HZ1 A;  4MYT A;  3U67 A;  5DNX A;  2HK3 A;  1H7S A;  1FWL A;  4QNJ A;  3A0R A;  2BA0 G;  1R6M A;  3P06 A;  1AH8 A;  5IWA E;  4LPB A;  3R91 A;  1S4E A;  4MPC A;  4L91 A;  4XCL A;  1UYG A;  1YT1 A;  4PRV A;  1I5A A;  2BR2 B;  3CGY A;  5CTU A;  3Q6M A;  4URO A;  3U2K A;  4YKZ A;  5FWK A;  2YE9 A;  2YEG A;  1GKX A;  1N36 I;  1GKZ A;  3J81 Q;  4ISA A;  5K36 F;  4LFC I;  2WI3 A;  4GQT A;  1N36 E;  3P3G A;  1UYK A;  4H81 A;  2XDS A;  3OMU A;  1A6F A;  1ZM3 A;  4K0K I;  2Q8H A;  4MP2 A;  4LFC E;  4IFD A;  2FYP A;  3A0T A;  3V2U C;  3DD6 A;  4DUZ I;  5C0X F;  2GQP A;  2CCU A;  4K0K E;  4DZY A;  1K47 A;  2YEA A;  4NH9 A;  2JE6 A;  4XDM A;  4DUZ E;  2DEI A;  1IBK I;  2FWY A;  2WER A;  2YE3 A;  3R4N A;  4O04 A;  5IT9 C;  4MU0 A;  3K1J A;  5JEA A;  2YGE A;  3VHC A;  2QFO A;  4IZK B;  2YE6 A;  1FKA E;  1IBK E;  4XKO A;  2BM0 A;  3L7Z A;  4MU4 A;  4DU7 A;  3RLP A;  4CWT A;  3WU6 A;  4P52 A;  4E02 A;  4DV5 I;  1KZN A;  4YKW A;  3K60 A;  1Z0B A;  1Z0C A;  3G75 A;  1AM1 A;  1UDS A;  4MPE A;  2VQE I;  3J7A G;  1YC4 A;  3QT7 A;  4CWO A;  3WHA A;  1Z5B A;  4DV3 I;  4DV5 E;  4XKK A;  1B3Q A;  2O1T A;  1BYQ A;  3O2F A;  3ZXQ A;  5ELW A;  5C0X A;  2VQE E;  4CE2 A;  4DV3 E;  4JI6 I;  4MBC A;  4IFD D;  2UXD I;  3R4P A;  5CTW A;  2UXC E;  3T10 A;  2XDL A;  3BMY A;  4IZJ B;  2YJW A;  2GQ0 A;  1ZM4 A;  1F51 A;  2UXD E;  4YKQ A;  5IDM A;  2CG9 A;  1Z0W A;  2WP8 B;  4ASF A;  1UYM A;  2WI2 A;  2UU9 I;  4AWQ A;  4B7P A;  3KRN A;  3P3C A;  5DRO A;  4BXI A;  3D2R A;  2WI7 A;  4IFD E;  2PNR A;  4XIT A;  4XIP A;  2UU9 E;  4DU8 A;  4LF6 E;  2YE5 A;  2BYI A;  2YEI A;  2FWZ A;  5K36 D;  2R42 A;  2GFD A;  5BOC A;  2BU6 A;  4LCH A;  1HNZ I;  1ZW9 A;  4KP4 A;  4L90 A;  2HCH A;  3PYG A;  5D7D A;  4FPP A;  3CGZ A;  1L0O A;  2C38 A;  1A4H A;  1HNZ E;  4CWN A;  4Z7Y A;  3B82 A;  2PNL A;  4WUC A;  5C0X D;  1I5D A;  3B27 A;  3JAM C;  2JEB B;  4L93 A;  3QT6 A;  4DR2 I;  5CF0 A;  5K36 E;  2HKE A;  4MU3 A;  3M6A A;  4YY3 I;  2YE2 A;  2J65 A;  2XDU A;  2YE7 A;  2WEP A;  3JZ3 A;  1TC6 A;  3UHM A;  2PO2 B;  4FWH A;  4DR2 E;  2XJX A;  3HUL A;  3INW A;  1Y8N A;  2IWX A;  3SL2 A;  2AJ4 A;  4YY3 E;  2EFG A;  2XD6 A;  1HNW I;  4Q20 A;  5C0X E;  2GO3 A;  3B25 A;  3HKM A;  3NZK A;  4B3S I;  3GIG A;  1IBL I;  4AS9 A;  2CCS A;  2VQF I;  2UUC I;  1H74 A;  2JEA A;  2Z5B A;  3P76 A;  1HNW E;  4P8O A;  1H73 A;  1TC0 A;  2VF3 A;  3WU4 A;  1HK7 A;  5FLX Q;  4OO1 D;  3T1H I;  4B3S E;  1IBL E;  3HEK A;  1UYI A;  4K4O A;  4V26 A;  2VQF E;  4JI0 I;  2IER A;  3T1H E;  2PO0 A;  2YI6 A;  4I3H A;  4WUD A;  2AE8 A;  4OZE A;  1HR0 I;  2HHH I;  4JI0 E;  2FXS A;  4EMV A;  1ZXN A;  5LMU I;  3TZ5 A;  3TZ4 A;  1AMW A;  1ZWH A;  1ZM2 A;  1Y8O A;  1YHC A;  2HHH E;  4OO1 E;  2ESA A;  4M1K A;  3GCM A;  1HR0 E;  3ZXO A;  5IDJ A;  5LMU E;  1UY6 A;  4DPU A;  3P3E A;  4USK A;  2YEE A;  4X66 I;  4DV1 I;  4DR1 I;  3CRL A;  4NBQ A;  2YI5 A;  3CYG A;  2CVE A;  4XIR A;  4HAC A;  2E0A A;  2PO1 B;  2Q2E B;  4DXL A;  4DR6 I;  4X66 E;  4DV1 E;  4DR1 E;  1N34 I;  3TZ2 A;  4FW5 A;  1EI1 A;  1S16 A;  2NN6 C;  2F4V I;  3H80 A;  4P7A A;  3CRK A;  2V2Z A;  4DR6 E;  3B24 A;  1N34 E;  2WI4 A;  1J5E I;  3QTF A;  2GS8 A;  4LWE A;  3QDD A;  2F4V E;  4GKK I;  5D6Q A;  2E1R A;  4KSG A;  1Z0E A;  4O07 A;  2QG2 A;  1J5E E;  3G7E A;  2BR2 A;  5F3K A;  5IT9 Q;  4JYA I;  4GKK E;  1KKH A;  4R3M A;  4YKX A;  4GCZ A;  3H4L A;  4O0B A;  1BXD A;  4FCR A;  4R3A A;  1OSF A;  4JYA E;  4JG4 A;  4AM3 A;  1USV A;  5JEA F;  2BZ5 A;  2HHI A;  4H7Q A;  2XHX A;  4WUB A;  3PYE A;  1N33 I;  4CWP A;  4DR7 I;  1KTV A;  1US7 A;  1ZXM A;  2XX4 A;  3K98 A;  4HXW A;  2Z5C B;  4DV2 I;  2O1U A;  5FNC A;  1N33 E;  3V5R A;  4DR7 E;  3O0I A;  2ZDX A;  2NN6 B;  1FJG I;  2VCI A;  4EGI A;  1UYF A;  4DV2 E;  2X7I A;  4URM A;  4AWP A;  3FV5 A;  2Q8F A;  3QT8 A;  4UT4 A;  4IZK A;  4ED4 A;  1FJG E;  4X65 I;  3PYF A;  4V25 A;  4B6C A;  2JKI A;  1UYE A;  2YEB A;  1E3P A;  4B3R I;  4JAU A;  4EM7 A;  4DV7 I;  2LJP A;  2CCT A;  4X65 E;  4XD8 A;  2YI7 A;  1H7U A;  1UDN A;  4BA1 B;  4B3R E;  2Z5E A;  5K36 C;  4FMT A;  4DV7 E;  4OKG A;  4Z7C A;  2BU7 A;  1I94 I;  5GGZ A;  2Q8G A;  1UY7 A;  1YET A;  1ZM9 A;  1XHK A;  2V2Q A;  1Z5C A;  4LWH A;  2X36 A;  3ZZT A;  4CE3 A;  1I94 E;  1FNM A;  4IZJ A;  2UXC I;  1U0Z A;  1YSR A;  4FCQ A;  3HHU A;  5D6P A;  3T1Y I;  2BV3 A;  1AH6 A;  5D7R A;  3HYY A;  4YKU A;  5C93 A;  2F1D A;  2WP8 A;  3EHG A;  3R4O A;  4ZKI A;  2C2A A; 
#chains in the Genus database with same CATH homology
 3T1Y E;  2XX2 A;  5GMD A;  1YC3 A;  1UEK A;  4DR3 I;  5M4N A;  3Q1Q A;  5FNF A;  2YKB A;  2ZM6 I;  2YE4 A;  4LF6 I;  2J7K A;  2DEJ A;  2XDK A;  5BOD A;  4ZVI A;  4DR3 E;  3K17 A;  4LWI A;  4XCJ A;  4KHP I;  4JI2 I;  2ZM6 E;  1UYH A;  1U2R A;  4QPK A;  2UUA I;  3J80 Q;  1AJ6 A;  3K99 A;  2R3V A;  1B63 A;  4HY1 A;  3OTO I;  4JI2 E;  4KHP E;  2UWD A;  3TTZ A;  4EGH A;  3D0B A;  4DPT A;  1I5B A;  1UYD A;  2UUA E;  3PEH A;  1EA6 A;  2WI1 A;  4CE1 A;  4DPY A;  2BTZ A;  4JI3 I;  3OTO E;  2XCM A;  3F0N A;  1TIL A;  2BU2 A;  2XK2 A;  1D6T A;  2YEF A;  4IZJ D;  1NHJ A;  4JI3 E;  4KTN A;  2WI5 A;  3PYD A;  4LWF A;  4DPX A;  3FT8 A;  3R92 A;  3GIE A;  2ZIT A;  3A0Z A;  5F5R A;  2BSM A;  4JI1 I;  2V34 A;  3LPS A;  4N3O A;  2XJG A;  3EHF A;  1QYE A;  1PIE A;  1XMO I;  4JI8 I;  4JI1 E;  3R4M A;  5M4H A;  4FCP A;  2XDX A;  2CZ9 A;  4EFT A;  2E5L I;  5BR8 I;  2JJC A;  4HY6 A;  4U7N A;  1XMO E;  4JI8 E;  2YI0 A;  2UUB I;  4FWD A;  2E5L E;  5BR8 E;  5CTX A;  1DAR A;  2VCJ A;  1S14 A;  1Z59 A;  4JI5 I;  4MB9 A;  4NXM I;  1Z0T A;  2UUB E;  2EXL A;  1BKN A;  3DGE A;  1YS3 A;  3EKO A;  4JI5 E;  2XAB A;  3A0Y A;  3EHJ A;  4JQL A;  4NXM E;  1XMQ I;  4YKT A;  1I59 A;  1UYC A;  5M4E A;  4LFB I;  2BU5 A;  4AQY E;  2H8M A;  2BM1 A;  4XTJ A;  1I58 A;  1XMQ E;  4LP0 A;  3CWV A;  2HKJ A;  4B3T I;  2NPF A;  4LFB E;  5M4P A;  4XC0 A;  4KSH A;  3NMQ A;  4B3T E;  2VWC A;  2WEQ A;  1UY8 A;  3O6O A;  3T2S A;  4GT8 A;  1TH8 A;  3OWB A;  4XIQ A;  4YHH I;  5J71 A;  1KVK A;  1N0V C;  2CH4 A;  3GIF A;  3QT5 A;  4GFN A;  4YHH E;  3OW6 A;  4DV6 I;  4W7T A;  1THN A;  4KQV A;  2V2V A;  4E00 A;  4LF9 I;  3B28 A;  4DPW A;  3B26 A;  4GKJ I;  4U7O A;  1RRE A;  3EKR A;  2Z5C A;  4DV6 E;  3Q6N A;  4HZ0 A;  4LF9 E;  4LF8 I;  4B3M I;  3A0X A;  4GKJ E;  4NH7 A;  2Q8I A;  1NZ0 A;  3T1K A;  3VHD A;  4LF8 E;  4B3M E;  1OJ4 A;  2H55 A;  4L94 A;  4NH8 A;  5FLX C;  4LF7 I;  2YK2 A;  1TBW A;  2XHT A;  4USM A;  4QPJ A;  4MP7 A;  4EEH A;  2BRC A;  5GME A;  3U2D A;  4LF7 E;  4DR4 I;  3FT5 A;  3G7B A;  4R1F A;  5CTY A;  2BT0 A;  1GJV A;  3Q5L A;  4DV4 I;  1MX0 A;  4DR4 E;  2QG0 A;  2HK2 A;  2VW5 A;  2HFS A;  5D7C A;  4AWO A;  1XNQ I;  2IOQ A;  2O1W A;  4DV4 E;  3D36 A;  2IWS A;  2ZBK B;  1UYL A;  4HYP A;  1MG7 A;  1VIS A;  4HZ5 A;  1USU A;  4X9L A;  4X62 I;  1XNQ E;  3HJC A;  5FND A;  4UTG A;  3VHA A;  3C0E A;  1QZR A;  1Y8P A;  4X62 E;  3EHH A;  4DUH A;  4I5S A;  3ZZU A;  1Y4S A;  3JAM Q;  3K85 A;  1Y6Z A;  2YEH A;  4L8Z A;  4BIZ A;  4FN5 A;  1YER A;  3B8H A;  1Z0G A;  2ZKJ A;  2WW4 A;  5A2Q C;  1TID A;  1JM6 A;  4MPN A;  2YGF A;  2YK9 A;  1RR9 A;  3LTO A;  4GEE A;  2AKP A;  3GON A;  4YKR A;  4CWS A;  1PKP A;  1MU5 A;  4PL9 A;  4O09 A;  3J7A M;  4LFA I;  5CPH A;  2HG1 A;  3D4J A;  3OPD A;  3ZZ0 A;  5J6A A;  4JI4 I;  3J81 C;  4LFA E;  1ID0 A;  4U93 A;  3IED A;  4HYM A;  2IWU A;  1WUU A;  4O05 A;  4GGL A;  4URN A;  1U2O A;  1Z5A A;  1YT0 A;  4JI4 E;  2YED A;  3T0H A;  1IBM I;  2XJJ A;  4XE2 A;  2YKI A;  2V8P A;  2QF6 A;  4BQJ A;  1I5C A;  2HFU A;  3K97 A;  4DV0 I;  2CGE A;  1IBM E;  1YSZ A;  4JI6 E;  1YES A;  2YKE A;  4JAV A;  2YEJ A;  2UXB I;  4H85 A;  2IOP A;  4DV0 E;  2YGA A;  3RLR A;  3KE6 A;  1NHI A;  2XHR A;  3LNU A;  5M4M A;  2UXB E;  2PNM A;  1N32 I;  3ZKB A;  2ZDY A;  3T0Z A;  4OX9 I;  4HXZ A;  1N32 E;  2A2D A;  4MYU A;  1R62 A;  2YJX A;  2XX5 A;  4OX9 E;  4LF4 I;  3RKZ A;  4NXN I;  4BIU A;  4E01 A;  1ELO A;  4FWG A;  2K5B A;  4YKY A;  2BU8 A;  3WU3 A;  4LF4 E;  4NXN E;  3PEJ A;  1N0U A;  2IOR A;  4PRX A;  4AQY I;  1QY8 A;  4CWR A;  4CWF A;  2WI6 A;  4LWG A;  3Q5K A;  4ASG A;  4ASB A;  4EGK A;  3HZ5 A;  3HYZ A;  2OI2 A;  3BM9 A;  1B62 A;  5IN9 A;  2YE8 A;  1FI4 A;  4KFG A;  3VAD A;  4FW9 A;  2UUC E;  4EFU A;  1Z0V A;  5LMN I;  3J80 C;  3GIG B;  3INX A;  4RPF A;  4XKA A;  1HNX I;  4BQG A;  2Z5B B;  3C11 A;  3RLQ A;  2YKC A;  4JI7 I;  3TUH A;  4X64 I;  5LMN E;  3ZKD A;  4JV5 I;  3B78 A;  3OWD A;  1HNX E;  5L3J A;  1KIJ A;  4JI7 E;  3WQ9 A;  3MNR P;  4MOT A;  4X64 E;  3PRY A;  4DUY I;  4JV5 E;  3A0W A;  3TZ0 A;  1FWK A;  4BAE A;  2BRE A;  4LF5 I;  5M4K A;  4ASA A;  4PU9 A;  4DUY E;  1BGQ A;  1UY9 A;  1NHH A;  1Y4U A;  1YC1 A;  5LL6 R;  4LF5 E;  1XNR I;  2CGF A;  2YEC A;  4CWQ A;  2BYH A;  2YKJ A;  4HAC B;  3Q5J A;  4DR5 I;  1YT2 A;  1PVG A;  1XNR E;  4JAS A;  4URL A;  3ZM7 A;  4EMD A;  3WU5 A;  1H72 C;  2XEX A;  2A2C A;  2O1V A;  5A2Q Q;  5IWA I;  4DR5 E;  3HZ1 A;  4MYT A;  3U67 A;  2HK3 A;  1H7S A;  1FWL A;  3A0R A;  3P06 A;  1AH8 A;  5IWA E;  4LPB A;  3R91 A;  1S4E A;  4MPC A;  4L91 A;  4XCL A;  1UYG A;  1YT1 A;  4PRV A;  1I5A A;  3CGY A;  5CTU A;  3Q6M A;  4URO A;  3U2K A;  4YKZ A;  5FWK A;  2YE9 A;  2YEG A;  1GKX A;  1N36 I;  1GKZ A;  3J81 Q;  4LFC I;  2WI3 A;  4GQT A;  1N36 E;  1UYK A;  4H81 A;  2XDS A;  3OMU A;  1A6F A;  1ZM3 A;  4K0K I;  2Q8H A;  4MP2 A;  4LFC E;  2FYP A;  3A0T A;  3V2U C;  4DUZ I;  2GQP A;  2CCU A;  4K0K E;  4DZY A;  1K47 A;  2YEA A;  4NH9 A;  4XDM A;  4DUZ E;  2DEI A;  1IBK I;  2FWY A;  2WER A;  2YE3 A;  3R4N A;  4O04 A;  5IT9 C;  2YGE A;  3K1J A;  3VHC A;  2QFO A;  4IZK B;  2YE6 A;  1FKA E;  1IBK E;  4XKO A;  2BM0 A;  4DU7 A;  4CWT A;  3RLP A;  3WU6 A;  4P52 A;  4E02 A;  4DV5 I;  1KZN A;  4YKW A;  3K60 A;  1Z0B A;  1Z0C A;  3G75 A;  1AM1 A;  4MPE A;  2VQE I;  3J7A G;  1YC4 A;  3QT7 A;  4CWO A;  3WHA A;  1Z5B A;  4DV3 I;  4DV5 E;  4XKK A;  1B3Q A;  2O1T A;  1BYQ A;  3O2F A;  3ZXQ A;  2VQE E;  4CE2 A;  4DV3 E;  4JI6 I;  4MBC A;  2UXD I;  3R4P A;  5CTW A;  2UXC E;  3T10 A;  2XDL A;  3BMY A;  4IZJ B;  2YJW A;  2GQ0 A;  1ZM4 A;  2UXD E;  4YKQ A;  5IDM A;  2CG9 A;  1Z0W A;  4ASF A;  1UYM A;  2WI2 A;  2UU9 I;  4AWQ A;  4B7P A;  4BXI A;  3D2R A;  2WI7 A;  2PNR A;  4XIT A;  4XIP A;  2UU9 E;  4DU8 A;  4LF6 E;  2YE5 A;  2BYI A;  2YEI A;  2FWZ A;  2R42 A;  2GFD A;  5BOC A;  2BU6 A;  1HNZ I;  1ZW9 A;  4KP4 A;  4L90 A;  2HCH A;  3PYG A;  5D7D A;  4FPP A;  3CGZ A;  1L0O A;  1A4H A;  1HNZ E;  4CWN A;  4Z7Y A;  3B82 A;  2PNL A;  4WUC A;  1I5D A;  3B27 A;  3JAM C;  4L93 A;  3QT6 A;  4DR2 I;  5CF0 A;  2HKE A;  3M6A A;  2YE2 A;  4YY3 I;  2XDU A;  2YE7 A;  2WEP A;  3JZ3 A;  1TC6 A;  2XJX A;  4FWH A;  4DR2 E;  3INW A;  3HUL A;  3SL2 A;  1Y8N A;  2IWX A;  2AJ4 A;  4YY3 E;  2EFG A;  2XD6 A;  1HNW I;  4Q20 A;  3B25 A;  4B3S I;  3GIG A;  1IBL I;  4AS9 A;  2CCS A;  2VQF I;  2UUC I;  1H74 A;  1HNW E;  2Z5B A;  4P8O A;  1H73 A;  1TC0 A;  2VF3 A;  3WU4 A;  1HK7 A;  5FLX Q;  3T1H I;  4B3S E;  1IBL E;  3HEK A;  1UYI A;  4K4O A;  4V26 A;  2VQF E;  4JI0 I;  3T1H E;  2YI6 A;  4I3H A;  4WUD A;  2HHH I;  1HR0 I;  4JI0 E;  2FXS A;  4EMV A;  1ZXN A;  5LMU I;  3TZ5 A;  3TZ4 A;  1AMW A;  1ZWH A;  1ZM2 A;  1Y8O A;  2ESA A;  2HHH E;  3ZXO A;  4M1K A;  1HR0 E;  5IDJ A;  5LMU E;  1UY6 A;  4DPU A;  4USK A;  2YEE A;  4X66 I;  4DV1 I;  4DR1 I;  3CRL A;  2YI5 A;  4XIR A;  4HAC A;  2E0A A;  2Q2E B;  4DXL A;  4DR6 I;  4X66 E;  4DV1 E;  4DR1 E;  1N34 I;  3TZ2 A;  2F4V I;  1EI1 A;  1S16 A;  3H80 A;  4P7A A;  3CRK A;  2V2Z A;  4DR6 E;  3B24 A;  1N34 E;  2WI4 A;  1J5E I;  3QTF A;  2GS8 A;  4LWE A;  3QDD A;  2F4V E;  4GKK I;  5D6Q A;  2E1R A;  4KSG A;  1Z0E A;  4O07 A;  2QG2 A;  1J5E E;  3G7E A;  5F3K A;  5IT9 Q;  4JYA I;  4GKK E;  1KKH A;  4R3M A;  4YKX A;  4GCZ A;  3H4L A;  4O0B A;  1BXD A;  4FCR A;  4R3A A;  1OSF A;  4JYA E;  4JG4 A;  1USV A;  2BZ5 A;  4H7Q A;  2XHX A;  4WUB A;  3PYE A;  1N33 I;  4CWP A;  4DR7 I;  1KTV A;  1US7 A;  1ZXM A;  2XX4 A;  3K98 A;  4HXW A;  2Z5C B;  4DV2 I;  2O1U A;  5FNC A;  1N33 E;  3V5R A;  4DR7 E;  3O0I A;  2ZDX A;  2VCI A;  1FJG I;  4EGI A;  1UYF A;  4DV2 E;  2X7I A;  4URM A;  4AWP A;  3FV5 A;  2Q8F A;  3QT8 A;  4UT4 A;  4IZK A;  4ED4 A;  1FJG E;  4X65 I;  3PYF A;  4V25 A;  4B6C A;  2JKI A;  1UYE A;  2YEB A;  4B3R I;  4JAU A;  4EM7 A;  4DV7 I;  2LJP A;  2CCT A;  4X65 E;  4XD8 A;  2YI7 A;  1H7U A;  4B3R E;  2Z5E A;  4FMT A;  4DV7 E;  4Z7C A;  2BU7 A;  1I94 I;  5GGZ A;  2Q8G A;  1UY7 A;  1YET A;  1ZM9 A;  1XHK A;  2V2Q A;  1Z5C A;  4LWH A;  2X36 A;  3ZZT A;  4CE3 A;  1I94 E;  1FNM A;  4IZJ A;  2UXC I;  1U0Z A;  1YSR A;  4FCQ A;  3HHU A;  5D6P A;  3T1Y I;  2BV3 A;  1AH6 A;  5D7R A;  3HYY A;  4YKU A;  5C93 A;  3R4O A;  3EHG A;  4ZKI A;  2C2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...