1EAFA

Atomic structure of the cubic core of the pyruvate dehydrogenase multienzyme complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
243
structure length
243
Chain Sequence
IPPIPPVDFAKYGEIEEVPMTRLMQIGATNLHRSWLNVPHVTQFESADITELEAFRVAQKAVAKKAGVKLTVLPLLLKACAYLLKELPDFNSSLAPSGQALIRKKYVHIGFAVDTPDGLLVPVIRNVDQKSLLQLAAEAAELAEKARSKKLGADAMQGACFTISSLGHIGGTAFTPIVNAPEVAILGVSKASMQPVWDGKAFQPRLMLPLSLSYDHRVINGAAAARFTKRLGDLLADIRAILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DIHYDROLIPOYL-TRANSACETYLASE
publication title Crystallographic analysis of substrate binding and catalysis in dihydrolipoyl transacetylase (E2p).
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Dihydrolipoamide acetyltransferase
total genus 65
structure length 243
sequence length 243
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 1992-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1eafA00
1E2OA 1CIAA 3L60A 1NOCB 2XHGA 1DPBA 5DUAA 5DU9A 2JGPA 4HVMA 5FALA 5KJUA 1EAFA 2ZBAA 4JN3A 1PD5A 1EAAA 2XR7A 4G22A 5KJSA 2CLAA 2RKVA 2E1TA 3FOTA 4G0BA 4KE4A 2VSQA 5KJWA 2II4A 1EABA 1EADA 1QCAA 1XMCA 2RKTA 2E1VA 1DPCA 1DPDA 1EAEA 2BGHA 3CLAA 5T3EA 5KJVA 1SCZA 4N72A 2I9DA 3B2SA 4CLAA 1L5AA 4G2MA 2E1UA 1Q9JA 4KECA 3U9BA 3B30A 2II5A 1CLAA 5FANA 1Q23A 3MAEA 3U9FA 2II3A 5KJTA 2IHWA 1XMDA 3FP0A 4JN5A 1XL7A 1EACA 1C4TA 1XL8A
chains in the Genus database with same CATH superfamily
1CIAA 1EAFA 1PD5A 1NDIA 2CLAA 1Q6XA 2RCUA 4G0BA 4KE4A 2FW3A 2VSQA 5KJWA 2FYOA 2II4A 5KJVA 2BGHA 3CLAA 2FY4A 1NDFA 1NDBA 1CLAA 3U9FA 5KJTA 1E2OA 2H3WA 1NOCB 5KJUA 5DU9A 1T1UA 1T7QA 5KJSA 3FOTA 2H3UA 1EADA 2E1VA 1DPCA 5T3EA 2I9DA 4G2MA 1S5OA 2E1UA 2II5A 2H4TA 2H3PA 4JN5A 3FP0A 1XL7A 1EACA 4HVMA 1DPBA 5DUAA 5FALA 1T7OA 2ZBAA 4JN3A 2FY2A 2DEBA 4G22A 4EPHA 2FY5A 4EYWA 1EABA 2RKTA 1XMCA 1EAEA 3B2SA 4CLAA 1L5AA 3U9BA 3B30A 5FANA 3MAEA 2IHWA 1XMDA 2FY3A 1T7NA 1C4TA 3L60A 2XHGA 2JGPA 1NM8A 1EAAA 2XR7A 2RKVA 2E1TA 1QCAA 1DPDA 1SCZA 4N72A 1Q9JA 4KECA 1Q23A 2II3A 1XL8A 4EP9A
chains in the Genus database with same CATH topology
1E2OA 1CIAA 3L60A 1NOCB 2XHGA 1DPBA 5DUAA 5DU9A 2JGPA 4HVMA 5FALA 5KJUA 1EAFA 2ZBAA 4JN3A 1PD5A 1EAAA 2XR7A 4G22A 5KJSA 2CLAA 2RKVA 2E1TA 3FOTA 4G0BA 4KE4A 2VSQA 5KJWA 2II4A 1EABA 1EADA 1QCAA 1XMCA 2RKTA 2E1VA 1DPCA 1DPDA 1EAEA 2BGHA 3CLAA 5T3EA 5KJVA 1SCZA 4N72A 2I9DA 3B2SA 4CLAA 1L5AA 4G2MA 2E1UA 1Q9JA 4KECA 3U9BA 3B30A 2II5A 1CLAA 5FANA 1Q23A 3MAEA 3U9FA 2II3A 5KJTA 2IHWA 1XMDA 3FP0A 4JN5A 1XL7A 1EACA 1C4TA 1XL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E2O A;  1CIA A;  3L60 A;  1NOC B;  2XHG A;  1DPB A;  5DUA A;  5DU9 A;  2JGP A;  4HVM A;  5FAL A;  5KJU A;  1EAF A;  2ZBA A;  4JN3 A;  1PD5 A;  1EAA A;  2XR7 A;  4G22 A;  5KJS A;  2CLA A;  2RKV A;  2E1T A;  3FOT A;  4G0B A;  4KE4 A;  2VSQ A;  5KJW A;  2II4 A;  1EAB A;  1EAD A;  1QCA A;  1XMC A;  2RKT A;  2E1V A;  1DPC A;  1DPD A;  1EAE A;  2BGH A;  3CLA A;  5T3E A;  5KJV A;  1SCZ A;  4N72 A;  2I9D A;  3B2S A;  4CLA A;  1L5A A;  4G2M A;  2E1U A;  1Q9J A;  4KEC A;  3U9B A;  3B30 A;  2II5 A;  1CLA A;  5FAN A;  1Q23 A;  3MAE A;  3U9F A;  2II3 A;  5KJT A;  2IHW A;  1XMD A;  3FP0 A;  4JN5 A;  1XL7 A;  1EAC A;  1C4T A;  1XL8 A; 
#chains in the Genus database with same CATH topology
 1CIA A;  1EAF A;  1PD5 A;  1NDI A;  2CLA A;  1Q6X A;  2RCU A;  4G0B A;  4KE4 A;  2FW3 A;  2VSQ A;  5KJW A;  2FYO A;  2II4 A;  5KJV A;  2BGH A;  3CLA A;  2FY4 A;  1NDF A;  1NDB A;  1CLA A;  3U9F A;  5KJT A;  1E2O A;  2H3W A;  1NOC B;  5KJU A;  5DU9 A;  1T1U A;  1T7Q A;  5KJS A;  3FOT A;  2H3U A;  1EAD A;  2E1V A;  1DPC A;  5T3E A;  2I9D A;  4G2M A;  1S5O A;  2E1U A;  2II5 A;  2H4T A;  2H3P A;  4JN5 A;  3FP0 A;  1XL7 A;  1EAC A;  4HVM A;  1DPB A;  5DUA A;  5FAL A;  1T7O A;  2ZBA A;  4JN3 A;  2FY2 A;  2DEB A;  4G22 A;  4EPH A;  2FY5 A;  4EYW A;  1EAB A;  2RKT A;  1XMC A;  1EAE A;  3B2S A;  4CLA A;  1L5A A;  3U9B A;  3B30 A;  5FAN A;  3MAE A;  2IHW A;  1XMD A;  2FY3 A;  1T7N A;  1C4T A;  3L60 A;  2XHG A;  2JGP A;  1NM8 A;  1EAA A;  2XR7 A;  2RKV A;  2E1T A;  1QCA A;  1DPD A;  1SCZ A;  4N72 A;  1Q9J A;  4KEC A;  1Q23 A;  2II3 A;  1XL8 A;  4EP9 A; 
#chains in the Genus database with same CATH homology
 1E2O A;  1CIA A;  3L60 A;  1NOC B;  2XHG A;  1DPB A;  5DUA A;  5DU9 A;  2JGP A;  4HVM A;  5FAL A;  5KJU A;  1EAF A;  2ZBA A;  4JN3 A;  1PD5 A;  1EAA A;  2XR7 A;  4G22 A;  5KJS A;  2CLA A;  2RKV A;  2E1T A;  3FOT A;  4G0B A;  4KE4 A;  2VSQ A;  5KJW A;  2II4 A;  1EAB A;  1EAD A;  1QCA A;  1XMC A;  2RKT A;  2E1V A;  1DPC A;  1DPD A;  1EAE A;  2BGH A;  3CLA A;  5T3E A;  5KJV A;  1SCZ A;  4N72 A;  2I9D A;  3B2S A;  4CLA A;  1L5A A;  4G2M A;  2E1U A;  1Q9J A;  4KEC A;  3U9B A;  3B30 A;  2II5 A;  1CLA A;  5FAN A;  1Q23 A;  3MAE A;  3U9F A;  2II3 A;  5KJT A;  2IHW A;  1XMD A;  3FP0 A;  4JN5 A;  1XL7 A;  1EAC A;  1C4T A;  1XL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...