1EAFA

Atomic structure of the cubic core of the pyruvate dehydrogenase multienzyme complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
243
structure length
243
Chain Sequence
IPPIPPVDFAKYGEIEEVPMTRLMQIGATNLHRSWLNVPHVTQFESADITELEAFRVAQKAVAKKAGVKLTVLPLLLKACAYLLKELPDFNSSLAPSGQALIRKKYVHIGFAVDTPDGLLVPVIRNVDQKSLLQLAAEAAELAEKARSKKLGADAMQGACFTISSLGHIGGTAFTPIVNAPEVAILGVSKASMQPVWDGKAFQPRLMLPLSLSYDHRVINGAAAARFTKRLGDLLADIRAILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DIHYDROLIPOYL-TRANSACETYLASE
publication title Crystallographic analysis of substrate binding and catalysis in dihydrolipoyl transacetylase (E2p).
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Dihydrolipoamide acetyltransferase
total genus 65
structure length 243
sequence length 243
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 1992-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1eafA00
2II3A 4G2MA 2CLAA 1L5AA 5FALA 1XMCA 1Q23A 4JN3A 4CLAA 2II5A 4KECA 1EAFA 1Q9JA 2E1VA 2XR7A 3CLAA 2BGHA 5FANA 5KJWA 3FP0A 1NOCB 1XMDA 1C4TA 2JGPA 1CIAA 2I9DA 2IHWA 2ZBAA 1E2OA 2E1UA 1DPDA 3B30A 1DPBA 4JN5A 4KE4A 2II4A 5DU9A 1XL7A 1CLAA 5DUAA 1SCZA 1EAEA 2RKVA 2VSQA 5KJVA 5KJTA 1EACA 1PD5A 4N72A 3FOTA 3U9FA 3B2SA 1EABA 1QCAA 1XL8A 4G22A 5T3EA 4G0BA 4HVMA 2RKTA 3L60A 3MAEA 1DPCA 5KJUA 1EAAA 1EADA 5KJSA 2E1TA 2XHGA 3U9BA
chains in the Genus database with same CATH superfamily
2FW3A 1S5OA 1Q23A 2II5A 2H3PA 5KJTA 3CLAA 3FP0A 1NOCB 1XMDA 1C4TA 1DPDA 3B30A 1T7OA 2II4A 2FY4A 1NM8A 2H3UA 1PD5A 3FOTA 1QCAA 1T7NA 1EADA 2XHGA 1Q6XA 5FALA 1NDIA 4KECA 1EAFA 1Q9JA 2XR7A 2ZBAA 2IHWA 2E1UA 4JN5A 5DUAA 1NDBA 5T3EA 1EAAA 1T7QA 2H3WA 2II3A 2CLAA 1L5AA 1XMCA 4JN3A 4CLAA 2E1VA 4G2MA 2I9DA 2RCUA 1E2OA 4EPHA 4KE4A 5DU9A 2FY5A 2RKVA 1EAEA 2VSQA 5KJVA 3U9FA 2FYOA 1XL8A 4G22A 4EYWA 4G0BA 4HVMA 3MAEA 1DPCA 2FY3A 3U9BA 4EP9A 2H4TA 1T1UA 5FANA 5KJWA 2BGHA 2JGPA 1CIAA 1DPBA 1XL7A 1CLAA 2FY2A 1SCZA 1EACA 4N72A 3B2SA 1EABA 2DEBA 2RKTA 3L60A 5KJUA 5KJSA 2E1TA 1NDFA
chains in the Genus database with same CATH topology
2II3A 4G2MA 2CLAA 1L5AA 5FALA 1XMCA 1Q23A 4JN3A 4CLAA 2II5A 4KECA 1EAFA 1Q9JA 2E1VA 2XR7A 3CLAA 2BGHA 5FANA 5KJWA 3FP0A 1NOCB 1XMDA 1C4TA 2JGPA 1CIAA 2I9DA 2IHWA 2ZBAA 1E2OA 2E1UA 1DPDA 3B30A 1DPBA 4JN5A 4KE4A 2II4A 5DU9A 1XL7A 1CLAA 5DUAA 1SCZA 1EAEA 2RKVA 2VSQA 5KJVA 5KJTA 1EACA 1PD5A 4N72A 3FOTA 3U9FA 3B2SA 1EABA 1QCAA 1XL8A 4G22A 5T3EA 4G0BA 4HVMA 2RKTA 3L60A 3MAEA 1DPCA 5KJUA 1EAAA 1EADA 5KJSA 2E1TA 2XHGA 3U9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2II3 A;  4G2M A;  2CLA A;  1L5A A;  5FAL A;  1XMC A;  1Q23 A;  4JN3 A;  4CLA A;  2II5 A;  4KEC A;  1EAF A;  1Q9J A;  2E1V A;  2XR7 A;  3CLA A;  2BGH A;  5FAN A;  5KJW A;  3FP0 A;  1NOC B;  1XMD A;  1C4T A;  2JGP A;  1CIA A;  2I9D A;  2IHW A;  2ZBA A;  1E2O A;  2E1U A;  1DPD A;  3B30 A;  1DPB A;  4JN5 A;  4KE4 A;  2II4 A;  5DU9 A;  1XL7 A;  1CLA A;  5DUA A;  1SCZ A;  1EAE A;  2RKV A;  2VSQ A;  5KJV A;  5KJT A;  1EAC A;  1PD5 A;  4N72 A;  3FOT A;  3U9F A;  3B2S A;  1EAB A;  1QCA A;  1XL8 A;  4G22 A;  5T3E A;  4G0B A;  4HVM A;  2RKT A;  3L60 A;  3MAE A;  1DPC A;  5KJU A;  1EAA A;  1EAD A;  5KJS A;  2E1T A;  2XHG A;  3U9B A; 
#chains in the Genus database with same CATH topology
 2FW3 A;  1S5O A;  1Q23 A;  2II5 A;  2H3P A;  5KJT A;  3CLA A;  3FP0 A;  1NOC B;  1XMD A;  1C4T A;  1DPD A;  3B30 A;  1T7O A;  2II4 A;  2FY4 A;  1NM8 A;  2H3U A;  1PD5 A;  3FOT A;  1QCA A;  1T7N A;  1EAD A;  2XHG A;  1Q6X A;  5FAL A;  1NDI A;  4KEC A;  1EAF A;  1Q9J A;  2XR7 A;  2ZBA A;  2IHW A;  2E1U A;  4JN5 A;  5DUA A;  1NDB A;  5T3E A;  1EAA A;  1T7Q A;  2H3W A;  2II3 A;  2CLA A;  1L5A A;  1XMC A;  4JN3 A;  4CLA A;  2E1V A;  4G2M A;  2I9D A;  2RCU A;  1E2O A;  4EPH A;  4KE4 A;  5DU9 A;  2FY5 A;  2RKV A;  1EAE A;  2VSQ A;  5KJV A;  3U9F A;  2FYO A;  1XL8 A;  4G22 A;  4EYW A;  4G0B A;  4HVM A;  3MAE A;  1DPC A;  2FY3 A;  3U9B A;  4EP9 A;  2H4T A;  1T1U A;  5FAN A;  5KJW A;  2BGH A;  2JGP A;  1CIA A;  1DPB A;  1XL7 A;  1CLA A;  2FY2 A;  1SCZ A;  1EAC A;  4N72 A;  3B2S A;  1EAB A;  2DEB A;  2RKT A;  3L60 A;  5KJU A;  5KJS A;  2E1T A;  1NDF A; 
#chains in the Genus database with same CATH homology
 2II3 A;  4G2M A;  2CLA A;  1L5A A;  5FAL A;  1XMC A;  1Q23 A;  4JN3 A;  4CLA A;  2II5 A;  4KEC A;  1EAF A;  1Q9J A;  2E1V A;  2XR7 A;  3CLA A;  2BGH A;  5FAN A;  5KJW A;  3FP0 A;  1NOC B;  1XMD A;  1C4T A;  2JGP A;  1CIA A;  2I9D A;  2IHW A;  2ZBA A;  1E2O A;  2E1U A;  1DPD A;  3B30 A;  1DPB A;  4JN5 A;  4KE4 A;  2II4 A;  5DU9 A;  1XL7 A;  1CLA A;  5DUA A;  1SCZ A;  1EAE A;  2RKV A;  2VSQ A;  5KJV A;  5KJT A;  1EAC A;  1PD5 A;  4N72 A;  3FOT A;  3U9F A;  3B2S A;  1EAB A;  1QCA A;  1XL8 A;  4G22 A;  5T3E A;  4G0B A;  4HVM A;  2RKT A;  3L60 A;  3MAE A;  1DPC A;  5KJU A;  1EAA A;  1EAD A;  5KJS A;  2E1T A;  2XHG A;  3U9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...