1EAH4

Pv2l complexed with antiviral agent sch48973
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
68
structure length
68
Chain Sequence
b'GAQVSSQKVGAHENSNRAYGGSTINYTTINYYRDSASNAASKQDFAQDPSKFTEPIKDVLIKTAPTLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLIOVIRUS TYPE 2 COAT PROTEINS VP1 TO VP4
publication title Structure of poliovirus type 2 Lansing complexed with antiviral agent SCH48973: comparison of the structural and biological properties of three poliovirus serotypes.
pubmed doi rcsb
source organism Human poliovirus 2
molecule tags Virus
total genus 6
structure length 68
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1eah400
1PIV4 2RMU4 1MQTD 1AR94 3JBG4 3J8F4 1COV4 4Q4Y4 1RUI4 1RUG4 2X5ID 2HWC4 2R074 2RS14 1RUH4 2RM24 1EV14 3JD74 1RUE4 1VBC4 1PVC4 1EAH4 1AL24 1VBD4 1OOPD 1VRH4 2HWB4 2R044 1RVF4 1K5MD 4Q4X4 1VBE4 1AR74 1RUC4 1HXS4 1HRV4 2R064 1Z7S4 1NA1D 4PDWD 1AR64 1RUD4 4Q4W4 1VBA4 1PO24 1ASJ4 1R084 1BEV4 2RR14 1POV0 1D4M4 1RMU4 1HRI4 4Q4V4 2RS54 1R094 4RHV4 4GB34 1H8TD 1NCQD 1VBB4 1PO14 2PLV4 1AR84 1RHI4 1RUJ4 2RS34 1RUF4
chains in the Genus database with same CATH superfamily
1MQTD 3AE4A 1RUI4 2R074 3VRAA 3AEGA 1KFYA 4YSYA 1EAH4 1AL24 3FI7A 1K5MD 3AE9A 2B76A 4KX6A 1Z7S4 1NA1D 4YTNA 4PDWD 3AE1A 1ZOYA 4YTMA 2EX3A 1RUD4 1XHZA 1VBA4 1ZP0A 1XI1A 3AE3A 1BEV4 2WP9A 1D4M4 1HRI4 3GQKA 3AE5A 1KF6A 1NCQD 1VBB4 4YSXA 3JBG4 3AECA 3J8F4 4Q4Y4 2X5ID 2HWC4 2PYLA 1RUH4 3P4SA 2RM24 2PZSA 1VBD4 1VRH4 3AEFA 4YSZA 1L0VA 1VBE4 3AEBA 1AR74 3ABVA 1AR64 2WDVA 1PO24 2ACZA 1R084 2WS3A 1POV0 2H89A 4Q4V4 2RS54 4RHV4 2H88A 4YT0A 1AR84 1RHI4 1RUJ4 3VR8A 1RUF4 1NENA 1PIV4 3CIRA 2WU2A 2WDRA 3AE6A 3SFEA 1EV14 1PVC4 2HWB4 2R044 4Q4X4 1YQ4A 1RUC4 4YTPA 3SUCA 2WU5A 2R064 1HRV4 3P4QA 4Q4W4 1ASJ4 1RMU4 2FBWA 3GQHA 3AE8A 3AEAA 1R094 2PYJA 3AEEA 2PLV4 2PW9A 5C2TA 2RMU4 1AR94 3P4RA 1COV4 1RUG4 2R7FA 3SFDA 2RS14 2PY5A 1XHXA 1YQ3A 3JD74 2WQYA 1RUE4 1VBC4 4GB34 3P4PA 1OOPD 1RVF4 2WDQA 3VR9A 3AE2A 1HXS4 1NEKA 5C3JA 3AEDA 2RR14 3AE7A 4YXDA 1H8TD 1PO14 3VRBA 2RS34
chains in the Genus database with same CATH topology
1PIV4 2RMU4 1MQTD 1AR94 3JBG4 3J8F4 1COV4 4Q4Y4 1RUI4 1RUG4 2X5ID 2HWC4 2R074 2RS14 1RUH4 2RM24 1EV14 3JD74 1RUE4 1VBC4 1PVC4 1EAH4 1AL24 1VBD4 1OOPD 1VRH4 2HWB4 2R044 1RVF4 1K5MD 4Q4X4 1VBE4 1AR74 1RUC4 1HXS4 1HRV4 2R064 1Z7S4 1NA1D 4PDWD 1AR64 1RUD4 4Q4W4 1VBA4 1PO24 1ASJ4 1R084 1BEV4 2RR14 1POV0 1D4M4 1RMU4 1HRI4 4Q4V4 2RS54 1R094 4RHV4 4GB34 1H8TD 1NCQD 1VBB4 1PO14 2PLV4 1AR84 1RHI4 1RUJ4 2RS34 1RUF4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PIV 4;  2RMU 4;  1MQT D;  1AR9 4;  3JBG 4;  3J8F 4;  1COV 4;  4Q4Y 4;  1RUI 4;  1RUG 4;  2X5I D;  2HWC 4;  2R07 4;  2RS1 4;  1RUH 4;  2RM2 4;  1EV1 4;  3JD7 4;  1RUE 4;  1VBC 4;  1PVC 4;  1EAH 4;  1AL2 4;  1VBD 4;  1OOP D;  1VRH 4;  2HWB 4;  2R04 4;  1RVF 4;  1K5M D;  4Q4X 4;  1VBE 4;  1AR7 4;  1RUC 4;  1HXS 4;  1HRV 4;  2R06 4;  1Z7S 4;  1NA1 D;  4PDW D;  1AR6 4;  1RUD 4;  4Q4W 4;  1VBA 4;  1PO2 4;  1ASJ 4;  1R08 4;  1BEV 4;  2RR1 4;  1POV 0;  1D4M 4;  1RMU 4;  1HRI 4;  4Q4V 4;  2RS5 4;  1R09 4;  4RHV 4;  4GB3 4;  1H8T D;  1NCQ D;  1VBB 4;  1PO1 4;  2PLV 4;  1AR8 4;  1RHI 4;  1RUJ 4;  2RS3 4;  1RUF 4; 
#chains in the Genus database with same CATH topology
 1MQT D;  3AE4 A;  1RUI 4;  2R07 4;  3VRA A;  3AEG A;  1KFY A;  4YSY A;  1EAH 4;  1AL2 4;  3FI7 A;  1K5M D;  3AE9 A;  2B76 A;  4KX6 A;  1Z7S 4;  1NA1 D;  4YTN A;  4PDW D;  3AE1 A;  1ZOY A;  4YTM A;  2EX3 A;  1RUD 4;  1XHZ A;  1VBA 4;  1ZP0 A;  1XI1 A;  3AE3 A;  1BEV 4;  2WP9 A;  1D4M 4;  1HRI 4;  3GQK A;  3AE5 A;  1KF6 A;  1NCQ D;  1VBB 4;  4YSX A;  3JBG 4;  3AEC A;  3J8F 4;  4Q4Y 4;  2X5I D;  2HWC 4;  2PYL A;  1RUH 4;  3P4S A;  2RM2 4;  2PZS A;  1VBD 4;  1VRH 4;  3AEF A;  4YSZ A;  1L0V A;  1VBE 4;  3AEB A;  1AR7 4;  3ABV A;  1AR6 4;  2WDV A;  1PO2 4;  2ACZ A;  1R08 4;  2WS3 A;  1POV 0;  2H89 A;  4Q4V 4;  2RS5 4;  4RHV 4;  2H88 A;  4YT0 A;  1AR8 4;  1RHI 4;  1RUJ 4;  3VR8 A;  1RUF 4;  1NEN A;  1PIV 4;  3CIR A;  2WU2 A;  2WDR A;  3AE6 A;  3SFE A;  1EV1 4;  1PVC 4;  2HWB 4;  2R04 4;  4Q4X 4;  1YQ4 A;  1RUC 4;  4YTP A;  3SUC A;  2WU5 A;  2R06 4;  1HRV 4;  3P4Q A;  4Q4W 4;  1ASJ 4;  1RMU 4;  2FBW A;  3GQH A;  3AE8 A;  3AEA A;  1R09 4;  2PYJ A;  3AEE A;  2PLV 4;  2PW9 A;  5C2T A;  2RMU 4;  1AR9 4;  3P4R A;  1COV 4;  1RUG 4;  2R7F A;  3SFD A;  2RS1 4;  2PY5 A;  1XHX A;  1YQ3 A;  3JD7 4;  2WQY A;  1RUE 4;  1VBC 4;  4GB3 4;  3P4P A;  1OOP D;  1RVF 4;  2WDQ A;  3VR9 A;  3AE2 A;  1HXS 4;  1NEK A;  5C3J A;  3AED A;  2RR1 4;  3AE7 A;  4YXD A;  1H8T D;  1PO1 4;  3VRB A;  2RS3 4; 
#chains in the Genus database with same CATH homology
 1PIV 4;  2RMU 4;  1MQT D;  1AR9 4;  3JBG 4;  3J8F 4;  1COV 4;  4Q4Y 4;  1RUI 4;  1RUG 4;  2X5I D;  2HWC 4;  2R07 4;  2RS1 4;  1RUH 4;  2RM2 4;  1EV1 4;  3JD7 4;  1RUE 4;  1VBC 4;  1PVC 4;  1EAH 4;  1AL2 4;  1VBD 4;  1OOP D;  1VRH 4;  2HWB 4;  2R04 4;  1RVF 4;  1K5M D;  4Q4X 4;  1VBE 4;  1AR7 4;  1RUC 4;  1HXS 4;  1HRV 4;  2R06 4;  1Z7S 4;  1NA1 D;  4PDW D;  1AR6 4;  1RUD 4;  4Q4W 4;  1VBA 4;  1PO2 4;  1ASJ 4;  1R08 4;  1BEV 4;  2RR1 4;  1POV 0;  1D4M 4;  1RMU 4;  1HRI 4;  4Q4V 4;  2RS5 4;  1R09 4;  4RHV 4;  4GB3 4;  1H8T D;  1NCQ D;  1VBB 4;  1PO1 4;  2PLV 4;  1AR8 4;  1RHI 4;  1RUJ 4;  2RS3 4;  1RUF 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...