1EAIA

Complex of ascaris chymotrpsin/elastase inhibitor with porcine elastase
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ELASTASE)
publication title The molecular structure of the complex of Ascaris chymotrypsin/elastase inhibitor with porcine elastase.
pubmed doi rcsb
molecule tags Serine proteinase
total genus 55
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1eaiA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1eaiA01
1P02A 4QT8C 2NU2E 2AGEX 2FMJA 4THNH 3SU3A 1O5DH 1QJ1B 4HZHA 2PGBB 1ELFA 1AGJA 1HAIH 3V12A 4Y71A 3BV9B 2AYWA 1C5VA 1XUKA 1G3EA 1P9UA 5FPSA 1CBWC 2B5TB 2RA0A 1KDQB 5LPFA 1Z1IA 1O38A 1TWXB 3LPRA 1T8OA 2BLQA 5EW1H 3UY9A 1P12E 2JH0D 3S9CA 2JETC 4YESB 3QZQA 1GVLA 2C8YB 1WTHD 2OTVA 2AH4X 4E7RG 5EXNA 2ZDAH 3BG4C 4DURA 1O2QA 3BTGE 8ESTE 5JB8S 2QAAA 3BTTE 3KQBA 2BDCA 2M5TA 4ISNA 1C4Y2 1F0UA 1L2EA 3ZVBA 3RXAA 4FXGH 1L4ZA 1ELBA 2BD5A 1V2TT 1TONA 1LHGH 3RUOA 1FIZA 2PW8H 2P93A 2WV4A 3RC6A 2A7CA 3ZZ9A 1T31A 1OXGA 5GJ4B 2OBQA 1TRMA 1EPTA 4O97A 1MTUA 1KXAA 1A2CH 3PWCA 1DSUA 1T4UH 2GVFA 3S9BA 1IQEA 1Y5UT 3RM0H 1C2EA 1HFDA 5CHAB 2NU3E 5DP6A 4ABAA 5JPMH 3UIRA 5AFZH 1XMNB 3FZZA 2BDAA 3M7QA 4WMFA 1EAUA 4A6LA 1GI7B 4IS5A 2A2XH 1RTKA 3DHKH 3T2NA 1A0JA 1GBHA 3F9FA 3ZZ8A 2BD4A 1FMGA 2HOBA 4DG4A 4YTAA 3LU9B 4FUIA 4FUEA 4IC6A 1TPSA 4AG2A 1TIOA 2WPLS 5A8YA 4BTUB 3GY8A 2R3YA 3S0NA 3MNSA 1FAKH 1O3FA 1Y8TA 2GCHG 3RXMA 4FVBA 2F9OA 3UUZA 1T7CA 1JWTA 4A1TA 3A82A 1BRCE 1BHXB 1BRUP 1VITF 1BZXE 1WOFA 1FV9A 2ZTYA 1EB1H 2VH6A 1B7XB 1FQ3A 1O31A 3MU8A 1GVKB 4U30A 5BPEA 2ZFFH 1QBNA 1MTSA 5FHTA 4D7GA 1SMFE 3UOPA 1QA0A 3RXHA 1THSH 4ZAEA 2Z9KA 2ZECA 2PSYA 3SJIA 1J14A 3C27B 1ZPCA 2FO9A 3UQOA 1P11E 1P2QA 1GJDB 1QQUA 1C2KA 1E37B 3MU5A 1SGTA 2CV3A 1NFYA 5AHGH 2Q6DA 1C5QA 3KCGH 2A1DB 3FP6E 1L1GA 1RGQA 1AO5A 5EPYA 3WY8A 1RJXB 3ATLA 1DPOA 4ZXYH 1GHBF 1QB6A 3RXJA 1O2MA 2ALVA 4HTCH 2ZQ2A 2ZU4A 1CT2E 1MH0A 1CA8B 2ZGXH 2J94A 3HGPA 2EC9H 3P92A 2YNBA 2EA3A 2ALPA 4IMQA 1GBKA 1INCA 1V2OT 1LHFH 2GCTC 4F49A 4AG1A 1GJAB 2WUBA 3P8OA 3I78A 1GG6B 1QJ6B 5E8EH 4B1TA 3A8AA 3GY4A 5HGGA 1FY8E 2VIWA 2ODPA 2ODQA 2BOHB 2PR3A 2ZGBH 3LIWA 4X0WU 2QYIA 1AU8A 3F68H 1CHOF 1GJBB 4AFSA 5A0CA 1P06A 1F92A 4NZQA 1DITH 5HM2A 6CHAC 2BLWA 2FOCA 1OP2A 1ZHPA 4O03A 1VR1H 2D8WA 3Q3YA 1AKSA 3MNCA 1BJUA 4A92A 4B2AA 4Z6AH 1EOJA 5C1XA 2IPHA 3BTQE 4Z0KA 2ANWA 2ZTZA 1IAUA 2G55A 1O5CB 4XSKU 1JOUB 2VIPA 3EE0B 3OYPA 2FLRH 3KGPA 2P95A 1DY9A 2QXJA 1P2MA 1C5ZB 2F9PA 1ZHRA 3LC3A 2LNCA 1BRBE 1C1WH 3ZZDA 1EASA 1YBWA 1VITG 2Z7FE 3IITA 3T27A 2SGPE 1MKWH 1IQGA 2YOLA 2ZP0H 5F8XA 1C5LH 2EI6A 3BTFE 1NN6A 4UFGH 2W7SA 2F91A 1UTOA 4CRAA 4D7FA 1OYQA 1UVUH 1ELAA 1WCZA 2Z94A 1MTVA 1UK3A 1A61H 2ZI2H 5T6FA 3QGJA 3MHWU 1NPMA 1QRZA 1TABE 1P2NA 2VJ1A 1UHBB 1C2GA 5FPTA 2HPPH 2B0FA 2UWPA 1S82A 1YPGH 2OC0A 2FOEA 2Y81A 4FUHA 2FOMB 1BTWA 1O3GA 4MQAA 3E8LA 4DJZB 1AN1E 1ELDE 5E2OA 1RIWC 2QF0A 2TBSA 2ZPQA 4PROA 3ZZ7A 4I8GA 2VNTA 1S0QA 1A0HB 2QXGA 3EYDA 2PUXB 3E0NB 2TGPZ 3BTME 5I25A 1C1MA 1YLCA 5F6MA 4GLYA 3M3TA 1H4WA 4NIXA 3LGVA 3STIA 1GBBA 3RU4T 3T62A 3VB4A 1HUTH 2BY6X 1S83A 3OSYA 4XOJA 2HGTH 1LPKB 4XE4A 1D3TB 2A4QA 2J38A 4B73A 1G3DA 1BJVA 3RLWH 3P8GA 3GISB 1CU1A 5ABWA 1YLDA 4MPXA 1THPB 4GUXA 2JH5D 3H5CB 2FESH 1ARCA 1F0RA 4AX9H 3QN7A 4X2WA 3QLPH 3M7TA 5C67A 4LK4A 2UUKB 1GMDF 1WQVH 3MYWA 3MU1A 1GJ4H 1UTNA 3SOSA 1E38B 1ZPZA 3ZVCA 2KAIA 2SNVA 4YT6H 3VXEH 3D65E 1F5RA 1LMWB 4JMYA 1UTJA 1NESE 3ZVEA 1V2QT 5EGMA 3KQEA 1G37A 3RXFA 3BTWE 2TGAA 1XUFA 1C1SA 3CS0A 2A7JA 3KF2A 3SJ9A 3RXBA 1JRTA 2UWOA 1CVWH 4I8JA 5LPEA 1JRSA 4Y11E 2XNIA 4BAQB 1GBLA 2CHAB 1Y5BT 1HAVA 2FYRA 1MUEB 2GMTB 5A0BA 3URCA 3GYMA 2QA9E 4H4FA 3K2UA 1DLEA 2AMPA 2UUFB 1MQ5A 2VIVA 3KHVA 2STBE 1ZSJA 1DSTA 1O2TA 4AGJA 1C2IA 3K9XB 4K5ZA 1DXPA 4AYVB 5CHAC 4IC5A 5B6OA 3SORA 1SGPE 4Q7XA 3ATMA 3GY7A 1EUFA 2ZCHP 2O9QA 5FXLA 5JBAS 2OC8A 1QTFA 5DPAA 4X1RU 1LVMA 5AF9H 1SPJA 4WMDA 5J4QA 1GGDB 1MZDA 5GDSH 2VGCB 2BHGA 1NU7B 4JYTA 2H2ZA 1HGTH 1TX8A 1UTPA 2Y7ZA 2ZFRH 3RXRA 1NRSH 4FUGA 2C8WB 4ABGA 1CT4E 5G4BA 1B0EA 4MPWA 8KME2 1GJ9B 1Q2WA 5AFYH 2ZPSA 2TIOA 3V3MA 3A83A 4ZROA 4E7NA 4JZEH 1V2KT 2J4IA 3BTHE 2BDIA 4RSPA 4NWLA 2J9NA 2ODYB 4Q2KA 1OPHB 2HWLB 2GZ7A 1ZYOA 5DGJA 3PTNA 1HAPH 4CBOA 1GI4A 1O5FH 1GDNA 2AFQB 4ZHAA 2SGDE 1IHTH 2FXRA 4X8VH 3DFLA 1GJCB 1F7ZA 3V13A 1GMDG 1CGHA 3ODFA 4RKJB 1KDQA 3DFJA 4A1XA 3KIDU 2C3SA 4BANB 1HV7A 4D76A 3VB5A 1TPPA 4B75A 1WUNH 3K6ZA 3KL6A 2XTTB 1V2WT 2WUCA 1WV7H 3FP8E 3Q76A 1BTXA 1H8IH 1W10U 2VVVA 1ZMJA 3ZYDA 1ELVA 1IQMA 1SGIB 1OSSA 1O2JA 2A5KA 2OINA 2VWOA 4LOYH 2ESTE 4UFFH 1QGFA 1HJ9A 2IJOB 1ANEA 1DOJA 2WPMS 3AAVA 1DICA 4LZ4B 1C1QA 3TJOA 2G52A 3PYHA 1GG6C 3IWMA 3GY6A 5FCKA 3GY5A 4Y10E 2ANYA 4GVUA 3ENSB 1BTUA 3LGTA 1Y3XA 1CGIE 1D3PB 1O3DA 2G00A 3MMGA 5SGAE 5C3NA 3QUMP 2A31A 7GCHF 1O2SA 1BTHH 5TCCA 2JKHA 3ZZ3A 3Q3KA 1ZJDA 1O2HA 2QGRA 3TH4H 1DUEA 2AEIH 4FVDA 1IHSH 1PQ7A 2V35A 5GPIB 1PJPA 4SGBE 3VFEA 1O2VA 4X1PU 1K1LA 2HNTF 4TWYA 3UOUA 2AIPA 3U8TH 2BY7X 4D8NA 4CRGA 2ZGJA 1SI5H 4DT7B 3CENA 1YPJH 3LH3A 3EAJA 1XVOA 1EZUC 1MQ6A 3SGQE 1A3BH 4ISIH 2GCHF 2THFB 8GCHF 1T8NA 3KNXA 4K3JA 1RD3B 2PV9B 1KLIH 4CR5A 1O3BA 3LOXA 3GOVB 5F03A 2Y5HA 4WMEA 3MTYA 1QL7A 1DS2E 1ESTA 5CE1A 2VWNA 2ZIQH 1MBQA 1MKXH 2RA3A 2ZHEH 4AFQA 2XBVA 3RXLA 1BCUH 2K1QA 1QCPA 2VWMA 1LCYA 1WAYB 3QZRA 3BSQA 2ZFQH 1DVAH 2ZU2A 2ZU5A 2R2MB 1S6FA 1W11U 2DE9A 1UVTH 4X2VA 3NCLA 2BDBA 4I7YH 4WH6A 1TQ7B 1ANDA 2QN5T 1G3BA 6ESTA 3KQCA 3MFJA 1YF4A 1Z1JA 1A5IA 4JK5A 1TA2A 2C8ZB 1ELTA 1TBRH 1O5BB 2B8OH 3RXSA 1RFNA 1O2IA 3RU4D 1BTZA 3SU2A 3O8BA 1XUIA 1O3MA 1C2JA 3MO3A 1GHWH 2FTMA 2W7UA 3SQEE 1K1OA 1FNIA 1K21H 1TAWA 1HPGA 2A2QH 3PTBA 2Z9GA 1H8DH 2XXLA 4MDSA 2TGTA 4AB8A 2O8MA 1N8OB 1M9UA 1GBJA 1YP9A 1EJNA 5HYOA 1ZSLA 2Z6BD 1P57B 2Z9JA 2C4FH 2AS9A 1FAXA 1AVGH 4ABHA 2EEKA 4CRFA 1SQAA 2ZU3A 3SU6A 1P05A 3M5OA 7GCHG 3VEQB 4ESTE 1CT0E 4DY7B 5FAHA 4GHTA 1SHHB 7LPRA 4K8BA 4NGAH 1LKAA 2VWLA 5GWZA 4DIIH 1YCPK 3SGAE 2FP7B 1TA6A 1VJAU 1HLTH 5DP8A 1YGCH 1LO6A 1QIXB 3MH7A 1NFUA 3SV9A 1FUJA 1KLTA 1GI5A 1O2UA 3W94A 1Z6EA 1O5EH 3RP2A 1ZGIA 1MTNB 2FIRH 1FDPA 4UFDH 2J92A 1SVPA 3W95A 8GCHG 1AE5A 1OWEA 4ZKNU 2FEQH 5IDKA 2CHAC 5C5NA 3NXPA 3LONA 4D9RA 2GMTC 3ATWA 5C1UA 4MNYA 1LPGB 1WQSA 4Q7YA 1NRNH 2TPIZ 4KTUA 2C93B 5TCAA 5DP9A 4X8UH 5DK1A 4KP0A 5A0AE 2PKAB 1PPBH 4INHA 3O8DA 4KGAA 1YC0A 3EA8A 2A4RA 1NO9H 2VH0A 1V2JT 2W5EA 1L0ZA 1GBMA 1UHBA 1J8AA 1YKTA 4AORA 1DDJA 1KTSB 1BTPA 1BTYA 2ZC9H 3FFGA 1YYY1 1TALA 1YPHC 2BD2A 2VB0A 5T3HA 2TRMA 3RU4E 3SHAH 3KQDA 3A8CA 1C5XB 2F9BH 3BTDE 1V2UT 3SQHE 3GY3A 4K1SA 1GGDC 3M36A 2VGCC 4Y8ZA 2D26C 1J15A 1GI1A 4OGYA 1Z8JB 1KXDA 1TBZH 4Y79A 4I8LA 4ZKRU 3M61U 2VIDA 4YLUA 2HPQH 1WU1A 3URDA 1ZOMA 2BDHA 5ETXA 5A2MH 1UMAH 1WSSH 1O2ZA 3F9HA 5DP4A 1F0TA 1ZTJA 4BAOB 4Y7AA 5EQSA 1V2ST 2FTLE 2GDDA 1O3KA 3NWUA 3ZV8A 3TGKE 1YPKH 1EP6A 1WYKA 1SBWA 2BY9X 4OS1A 3A7XA 3VB6A 1FY4A 1CA0B 3M5LA 3TJVA 1UK4A 1LHEH 3T26A 2F9VA 3R3GB 4MPVA 2QIQA 3ATKA 1G9IE 2ULLA 1K9OE 2BMGB 6GCHG 3TVJB 2QCYA 2BY5X 2F3CE 2Z9LA 4MVNA 1GJ5H 1THRH 4UEHH 3GDSA 3U69H 5L2ZH 3F1SB 2ZNKH 1TPOA 5FBEA 4TWWA 2BDYA 2XCFA 2FYQA 2ANKH 2O8UA 1FY1A 4XBCA 2RDLA 1SGEE 1O2RA 3I77A 3QK1A 1ACBE 6LPRA 1EP5A 1ZHMA 5GIBA 1GI9B 1FIWA 1GHXH 1ZPBA 1DWDH 2QF3A 4YLQH 2IOTA 1V2RT 4X1SU 2FOFA 1YPHE 5EODA 3N7OA 1P9SA 1P04A 2ZKSA 2FOGA 1Y3UA 1O3IA 3AAUA 4YOJA 2FI4E 2QY0B 2BD9A 3SNDA 2GZ9A 1LQDB 1TMUH 4F4OC 1SFIA 1A46H 2XBWA 4UDWH 4VGCB 3K6YA 1SB1H 1HIAB 3DT0H 1PPFE 2GT8A 2J95A 1CQQA 4MLFB 4ZHMU 4YT7H 1RTFB 4BAKB 2CJIA 2XCNA 5PTPA 1W12U 1KY9A 3RLYH 2YNAA 4O3UA 3PLPA 1BHXF 3SNCA 3RXDA 1AMHA 3GDVA 4K1TA 2WINI 4ABIA 2XRCA 1O5AB 4IMZA 1XM1A 1TYNA 1S0RA 1D6RA 2G8TA 1O30A 1DM4B 1OWIA 2GT7A 1L4DA 4FU9A 3MO6A 2Y5GA 1UVOA 1BA8B 1EZSC 1GJ7B 1PQ5A 1UTKA 2ZHFH 3BIUH 3STJA 2P16A 3TH2H 4CHAB 1T8LA 3C1KA 1P2JA 1SC8U 2PLXA 1ZSKA 1EQ9A 2BLVA 1IQHA 2QXHA 2BLOA 2HLCA 4BNRA 3VXFH 1AHTH 1FONA 1C4U2 1ESAA 8LPRA 1MMJN 1HAOH 1OWDA 3MO9A 2G81E 1ZJKA 2O8LA 4KTSA 2RG3A 1C5TA 1W8BH 3RMNH 3TJNA 1LQEA 3SUFA 1AUTC 7ESTE 3QTOH 3MNBA 1BBRK 1TX6A 2OLGA 3A7TA 3ELAH 3P8FA 3B8JA 1N6YA 4O3TA 2FI3E 3SNBA 2A5IA 4WY3A 1BB0B 3GDUA 1QY6A 1W13U 1BOQA 1RRKA 2HVXA 1VZQH 2ZZUH 4JZIA 4KKDA 3TITA 1ID5H 3NK8A 4CRCA 5DG6A 5DP7A 3AASA 2RCEA 2ZGHA 3T28A 2BD3A 2VIOA 4NIWA 5EPNA 2OQ5A 1C1OA 4ZUHA 1HNEE 2ZFSA 1GHZA 1RXPA 3UQVA 2H5CA 3UWJH 1PQ8A 1GHAF 2P3UB 2A4OA 2BB4A 1PQAA 1P0SH 1A7SA 1XUGA 5EQRA 4K2YA 3SJOA 2BTCE 1MD7A 1SGYE 4YM9A 4XDEA 1P3CA 1SHYA 3M37A 1TOMH 1IQFA 3PROA 3A7ZA 2Q6GA 3P17H 3A7WA 1O33A 3HPTB 1F0SA 4K69A 1G3CA 3EQ0H 1HAZB 2B7DH 1UVPA 3RXUA 4NZLA 1OP8A 3SV6A 1FLEE 2VVUA 1K1MA 1HJAB 1AVXA 1O2OA 3VB3A 3RMMH 1XUHA 1PYTD 3Q00A 1ETTH 1BBRE 3D49H 1RS0A 4RN6A 1SGRE 3M5NA 2FI5E 1NRRH 2P59A 4OS4A 1N8OC 1TLDA 4ABFA 2H9TH 1TFXA 3SNAA 1C5SA 4CH8B 4WJG2 4Y8XA 2WYJA 1PPCE 3SI4H 2BM2A 1SOTA 1FI8A 4Y7BA 1TGSZ 5L6NH 4ZMAH 1V2PT 3SNEA 2PGQB 2XWBI 3TIUA 2GKVE 5A09A 1G2MA 1DT2A 4LZ1H 2R9PA 3OY6U 3BN9A 2QC2A 4ISHH 1SOZA 1Z6JH 2STAE 1LVOA 3GICB 5H4IB 3LDXH 1ANBA 3TPIZ 3UNSA 1CGJE 3A89A 3GCHB 3SGBE 1X7AC 1AWHB 3CP7A 3B9FH 1BBRH 1NC6A 2ZFTA 2BVSH 5C5OA 1Q3XA 5DO4H 1SGDE 2FLBH 4H42U 1MTNC 1OWHA 2R2WU 5EQQA 2BD7A 3PM3A 1O5GH 5JB9S 2OC7A 1NU9A 4ZHLU 2ZO3H 5I46H 1V2NT 5JBBS 1NY22 4GAWA 2PKSB 1MAYA 4I8KA 1H9IE 4E05H 1O2LA 5IYTA 3RC5A 1C4V2 5C20A 1KXEA 4X2XA 4GSOA 1C1UH 1TNGA 1D3QB 1H1BA 1O36A 1EXFA 1ELGA 1GHAG 4IN1A 4I33A 1P10A 5FPYA 3U8RH 2OD3B 4OS2A 1ZZZA 1AD8H 2A7HA 1EKBB 1ZLRA 1O3CA 4AFUA 7KMEH 4WWYA 1O2WA 3MH6A 1AFQB 1GCDA 4J1YA 1W0YH 1N6XA 2FX4A 3ZZCA 2PTCE 1FN6A 2FDAA 1IQNA 1TMBH 1GDUA 2BVRH 1YPEH 1W7GH 2WPJS 1BRAA 3SN8A 3Q77A 1BMMH 2BVXH 1T32A 3I29A 3PWBA 1QR3E 3A84A 3U1IB 1GI6A 4A7IB 1A3EH 1C2HA 2XC4A 3S7HB 1EJMA 1V6DA 5EXLA 2P8OB 4X6PA 2WV5A 2ZHQH 4MPUA 3GCNA 1C9PA 2BYAX 1VCPA 1TGCA 3ZZ6A 1DUAA 2SFAA 4OS7A 1EX3A 2FS8A 1CA0C 2PFEA 3SV2H 1IQIA 3SU5A 3E90B 1BITA 4MG3A 1TGBA 4B2BA 9ESTA 2V3OH 3E1XB 2AERH 5JBTA 2P3TB 3TH3H 1KSNA 1OOKB 1A4WH 1HRTH 4TY6A 1ARBA 1VCWA 1ABIH 1DWCH 3AVZA 1NFWA 5ESTE 1G36A 3U8OH 1OWJA 1YPMH 3SU1A 1ORFA 1T8MA 1ZR0A 3PV4A 1FN8A 1QURH 3RC4A 2GD4B 4ABDA 2Z3CA 3OX7U 2BZAA 2ZHWH 4NFEA 1GI2A 1GVZA 1J16A 4VGCC 5C2ZA 2ZDMA 2EI8A 1EZQA 1ELCA 1E35B 2ZQ1A 2PUQH 1O3JA 1Z71A 2B9LA 1ZTLA 1AI8H 5EG4A 3EGKH 3ODDA 2NU0E 3LJJA 2R0KA 2A0QB 3IG6B 1C5WB 2TGDA 2R0LA 1XUJA 3SBKA 3T29A 1IQJA 4Y0ZE 4BAMB 1QBOA 2ZA5A 3BTKE 1T4VH 3SJ8A 2SGEE 1VGCB 4ISLA 4OGXA 1W2KH 1F5KU 2BQ7B 1JMOH 2CN0H 2PKAA 3BG8A 4Y8YA 1IQLA 3MU0A 4X6NA 1A1RA 1A5GH 4CH2B 2XC0A 4CHAC 1GL1A 1P03A 1TB6H 2DUCA 1K2I1 2ZDNA 3BTEE 4DW2U 1RTLA 1S84A 1AFEH 2XBXA 1QRWA 4X1NU 3RMOH 3D62A 3JZ1B 1GMHF 2A5AA 2OXSA 1SL3A 4AYYB 1AB9B 1P01A 1ETRH 4DIHH 1LVYA 2WPHS 3PLBA 1C5RA 3O8CA 4ABEA 3A85A 3BF6H 2A32A 2H9EH 1FXYA 1MU6B 1O3AA 1AQ7A 3A86A 1O3HA 3SV8A 1P2IA 2OP9A 1K28D 3U98H 2JH6D 1KTTB 3HGNA 1V3XA 4HFPB 1GI0A 4SGAE 4NCYA 2OBOA 4ZKOU 1JXPA 1TNHA 1BUIA 2A45B 4ZH8A 1HAYB 1SQTA 1V2VT 3QGNB 6GCHF 2BOKA 5C1YA 2O8WA 4Q80A 2G4TA 1P2KA 3M5MA 4B76A 4X2YA 1S6HA 2SGQE 1TGNA 1NRQH 5EU8A 3BIVH 1BMLA 4AGKA 2UUJB 1QFKH 3G01A 4OS5A 5K0HA 5GCHF 1KXBA 1AZ8A 3RDZA 1PPHE 4NIVA 1D6WA 2AIQA 2F9NA 3TNTA 5JDUB 4ASHA 1TPAE 1GCTB 1ZMNA 5DP5A 1E34B 1JIMA 2ZDLA 1TBQH 1SGFA 4X8TH 3L33A 3U9AH 3JZ2B 1GBAA 1P09A 2GV7A 2Y80A 3B23B 1HAHH 4O9VA 1HIAA 1NFXA 1HJAC 1D4PB 1XXDA 3PB1E 2V0BA 3SI3H 2ZWLH 1V2MT 2NU4E 3BEUA 3F9EA 3P8NA 4CRBA 1O34A 2G4UA 1K1NA 5DKMA 1B5GH 4K1EA 4OS6A 5DP3A 1YPLH 5T6GA 2NU1E 2UWLA 3NPSA 3UR9A 1DE7H 1HBTH 3GCTF 2SGAA 3MOCA 3A8DA 1QL9A 1OKXA 1EB2A 1GPZA 3ATIA 3RXIA 3TGIE 1GBTA 3RXGA 1PFXC 9LPRA 1Y59T 2FWWA 4LXBH 4CBNA 1GBDA 5AVDA 3H7TA 1ZRKA 3OY5U 4AZ2B 1C5NH 1NT1A 4ABBA 2G51A 1EAIA 1HXFH 1O37A 1O2PA 4JZ1A 3KEEA 1QB9A 1O2GH 1F2SE 3A7VA 1EAWA 2VIQA 3GCHC 3UFAA 1GMHG 3ESTA 1MBMA 1IOEA 3VB7A 1G30B 3CS7A 1SLWB 2WPKS 1MKWK 1W0ZU 1HJ8A 1AWFH 2EI7A 3LGWA 5EW2H 5L30H 3AW1A 1NRPH 1O32A 2H1UA 1O0DH 2UUYA 2ILNA 4IGDA 2CXVA 4IBLH 1QRXA 1VCQA 2GZ8A 1NS3A 3VPKA 1TNKA 1MTWA 2D2DA 1UVSH 2PKSC 5GXPA 1OX1A 3HK6B 1QQ4A 1WTGH 5BRRE 2HNTC 4JYVH 1ELEE 1WBGB 3NKKA 3HK3B 3PLKA 4FU8A 3P6ZB 2BXTH 4RKOB 4B74A 3DD2H 1Z8IB 2XBYA 3SW2B 4A1VA 2SNWA 4AB9A 2W3IA 1QA7A 4K60A 1LPZB 1UTQA 1GBEA 4NSYA 3EA9A 3SHCH 3SU4A 1BMAA 2H5DA 2GP9B 3FZDA 2F83A 1Z8GA 1YCPH 1HAXB 3OU0A 3EA7A 2XWAA 1DWEH 4JZDH 1HXEH 3QO6A 5FCRA 1C2DA 5GCHG 3QX5H 5TJXA 3GY2A 3RXQA 2G5VA 1KXFA 1AFQC 1OWKA 1LKBA 1HAGE 2CF9H 2AMQA 5JYIA 2O8TA 1EPTB 3QWCH 2FPZA 2ZF0H 2VVCA 2GX4A 1ESBA 3E6PH 3HKIB 1FPCH 2W3KA 2PTNA 3KN2A 3PO1B 2J34A 3EDXB 3PMAB 1BT7A 1LVBA 4FUJA 3SU0A 4BXSA 1VJ9U 4UFEH 2Z9IA 1FPHH 1HB0B 2P8OC 5J4SA 1ANCA 1PPGE 3LT3A 1HDTH 2ZHDA 5JBCS 3SV7A 2AGGX 3SJKA 4KTCA 2VINA 4NFFA 3V0XA 3ZVDA 1DY8A 4JK6A 4UD9H 1LDTT 1Z7KA 2ZU1A 3NUMA 1W3CA 2GGVB 3HKJB 4I32A 2HNTE 1TMTH 4MNVA 4Y76A 1KXCA 3GCTG 1DXWA 3HATH 1ZGVA 3FP7E 4K8YA 3ITIA 3MI4A 1DANH 1HYLA 4U2WA 1Y3VA 5ESBA 5F8TA 2ZDKA 2F9UA 3RXPA 5HM9A 4MTBA 1GBFA 2BQ6B 1SFQB 2NWNA 5T6DA 2FM2A 3VGCB 1ZMLA 3LGUA 1Q31A 2VU8E 1BQYA 4IW4E 4TYDA 2Y7XA 4DGJA 5L2YH 4ISOA 4X6MA 3PMJA 1UCYK 1SG8B 3SZNA 1QB1A 5E2PA 1PPEE 3A81A 1NROH 3SUDA 3S9AA 4Q7ZA 3TK9A 1P2OA 3SUEA 1GJ8B 2FOBA 2GDEH 1O2XA 3RXTA 4UE7H 1QJ7B 1KIGH 3MU4A 1AY6H 5FBIA 1CO7E 3SUGA 2WYGA 3ZVAA 4BAHB 1EAXA 1L1NA 4MNWA 1CBWB 4TPYA 1EATA 1CE5A 4X1QU 3FAOA 3ZVFA 1P3EA 2FODA 1O3OA 1MZAA 5E0GA 1VGCC 1DWBH 1MCVA 2JETB 1G2LA 1GHBG 3RM2H 3V7TA 1AZZA 2BXUH 4CRDA 4BXWA 2P3FH 3BG4B 3MWIU 2GV6A 2V3HH 3S7KB 1BIOA 2PSXA 4GCHF 2Z3DA 1TNLA 2BY8X 1OYTH 2V6NA 2C8XB 4FU7A 4WXVA 4NA9H 1TQ0B 2QXIA 4BTIB 2ZGCA 4XBBA 3M3VA 3ZVGA 4YOIA 1AIXH 1N1LA 1D3DB 1DX5M 4JCNA 1TOCB 1AB9C 1XX9A 1O2KA 3UR6A 1XKAC 1P8VC 1FZZA 1GHVH 3M3SA 1H9HE 1CHOG 4HI3A 1Y5AT 3ZZ5A 4NA8A 4FUCA 1QL8A 1UCYE 2OUAA 1YCPM 1D9IA 3L3TA 2ZCKP 2CF8H 3TLOA 3O8RA 4WH8A 1AKSB 3RXEA 4YO9A 4I8HA 4U32A 1K22H 1HCGA 5E0JA 1GDQA 1KLJH 1UTLM 1Z8RA 1C5PA 1C5OH 4FUBA 5LGOA 3MH5A 3MNXA 1O3LA 1QNJA 2BZ6H 2CGAA 1C1RA 3ZZBA 4DVAU 1MAXA 2ZEBA 2AMDA 1FY5A 3NZIA 4CREA 2LPRA 3DUXH 1LTOA 2XW9A 3UNQA 1GI8B 3UPEA 3UREA 3LH1A 1IQKA 3TU7H 5F8ZA 1MU8B 1UCYH 2I6QA 4J2YB 3TJUA 4U01A 2ANMH 3A88A 1GCTC 4TPIZ 4M7GA 2BQWB 1PYTC 1GWAA 2PHBA 4TY7A 2IN2A 1YM0A 2ASUB 3AW0A 5A8XA 2ZG0H 1K1JA 3TK6A 2ZTXA 1OS8A 1SGQE 2Y82A 4GPGA 3UTUH 1ZRBA 3UWIA 1TNJA 3ZV9A 5LPRA 4NIYA 2PWXA 2XYAA 4JZFH 3RMLH 3RXOA 1S85A 1O2YA 3P70B 2A4GA 1AE8H 1GMCF 1C2MA 1XVMA 1MD8A 2I6SA 3QDZB 4BOHA 4YZUA 1E36B 2BD8A 3FANA 1K1IA 2C90B 1AVWA 2QV1A 5EXMA 5A8ZA 2AGIX 1K1PA 3OTJE 3S69A 1VITH 3TNSA 4X8SH 1SSXA 3A8BA 1LHDH 1DLKB 1SLVB 1GHYH 4INLA 4JYUH 4FUFA 4IN2A 3A80A 3TK5A 4XFQA 1C1PA 3ZYEA 5HXFA 1O3PB 3LKWA 2HRVA 1FY3A 4GCHG 1C5YB 1B0FA 4A5TS 3TGJE 3LJOA 1L1JA 2GCTB 3T25A 2FS9A 2W26A 2H9HA 4BTTB 4MNXA 1BMNH 4ZXXH 1J17T 1C2FA 4NA7A 1UK2A 1V2LT 3UNRA 1O39A 1TRYA 1SGFG 1JIRA 4XBDA 4YOGA 2DE8A 1S5SA 1MKXK 3K65B 3RXKA 1C2LA 3T5FH 1C5UA 1GL0E 1TX7A 4H6SB 1NZQH 3M7UA 1C1TA 6CHAB 1O3NA 4D9QA 4INKA 2GTBA 1ETSH 5LH8A 4R8TB 2FOAA 2R3UA 2KAIB 3E0PB 3BEFB 3F9GA 5CMXH 3E3TA 1SLUB 1OP0A 4I31A 4Y6DA 1KYNA 4DOQA 4FUDA 1C1NA 1UTMA 2OCVB 4WXIA 1E0FD 1XXFA 4R0IA 2Y6TA 2XC5A 3D23A 1DFPA 1W14U 4CR9A 4DCDA 1O2NA 1GI3A 3GCOA 2ZFPH 1ABJH 2Q1JA 3BEIB 2P94A 4HGCA 1O3EA 1C1VH 1CSOE 1HAVB 3LGYA 2J2UA 1O35A 1C9TA 3L6PA 3ZZAA 1XKBC 1TNIA 4E06H 1EPTC 1SGCA 1BDAA 3P95A 1GBIA 2Q6FA 5DJ7A 5E0HA 4AFZA 4B71A 1A5HA 3PMHB 3PO1C 3QTVH 2ZPRA 1S81A 1PPZA 2BDGA 1GBCA 1H9LB 1QBVH 1U6QA 2ZCLP 1ZTKA 3DA9B 2CMYA 4AN7A 4NWKA 1JBUH 5K7RA 1EZXC 4WF8A 3H7OA 2Y5FA 1Y3YA 4KELA 2HALA 3FVFB 3GYLB 4GHQA 1GMCG 4ZKSU 1SLXB 3U1JB 4H6TA 3R0FA 1TGTA 1FJSA 1UO6A 2ZDVH 3Q3XA 2Z3EA 2FOHA 4NG9H 1MCTA 3SO3A 1CHGA 1AUJA 1RIWB 1Y3WA 2D1JA 2SGFE 3A7YA 3RXCA 2FZZA 3E91A 2G5NA 4UONA 5HMAA 2FX6A 4WVPE 1TRNA 1UJ1A 1A0LA 3F6UH 2OC1A 3MH4A 3E16B 4B2CA 4X6OA 2H6MA 1NTPA 1F5LA 1TE0A 2BX4A 1NM6A 1C5MD 2BX3A 1EJAA 1QHRB 1SGNE 1GJ6A 5FX5A 4Y0YE 1SQOA 3VGCC 3A87A 1W7XH 3ZZ4A 2OQUA 5FX6A 1LHCH 4AOQA 4NSVA 5EOKA 3LC5A 4ABJA 3M35A 1J9CH 3PMBB 1G32B 3RXVA 1SR5C 2WPIS 3LGIA 1EOLA
chains in the Genus database with same CATH superfamily
4ASUD 1P02A 4QT8C 2NU2E 2AGEX 2FMJA 4THNH 3SU3A 1O5DH 1QJ1B 4HZHA 2PGBB 1ELFA 1AGJA 1HAIH 3V12A 4Y71A 3BV9B 2AYWA 1C5VA 1XUKA 1G3EA 1P9UA 5FPSA 1CBWC 2B5TB 2RA0A 1KDQB 5LPFA 1Z1IA 1O38A 1TWXB 3LPRA 1T8OA 2BLQA 5EW1H 3UY9A 1P12E 2JH0D 3S9CA 2JETC 4YESB 3QZQA 1GVLA 2C8YB 1WTHD 2V3MA 2OTVA 2AH4X 4E7RG 5EXNA 2ZDAH 3BG4C 4DURA 1O2QA 3BTGE 8ESTE 5JB8S 2QAAA 3BTTE 3KQBA 2BDCA 2M5TA 4ISNA 3H09A 1C4Y2 1F0UA 1L2EA 3ZVBA 2V7QD 3RXAA 4FXGH 1L4ZA 1ELBA 2BD5A 1V2TT 1TONA 1LHGH 3RUOA 1FIZA 2PW8H 2P93A 2WV4A 3RC6A 2A7CA 3ZZ9A 1T31A 1OXGA 5GJ4B 2OBQA 1TRMA 1EPTA 4O97A 1MTUA 1KXAA 1A2CH 3PWCA 1DSUA 1T4UH 2GVFA 3S9BA 1IQEA 3FOAA 1Y5UT 3RM0H 1C2EA 1HFDA 5CHAB 2NU3E 5DP6A 4ABAA 5JPMH 3UIRA 5AFZH 1XMNB 3FZZA 2BDAA 3M7QA 4WMFA 1EAUA 4A6LA 1GI7B 4IS5A 2A2XH 1RTKA 3DHKH 3T2NA 1A0JA 1GBHA 3F9FA 3ZZ8A 2BD4A 1FMGA 5HIYA 2HOBA 4DG4A 4YTAA 3LU9B 4FUIA 4FUEA 4IC6A 1TPSA 4AG2A 1TIOA 2WPLS 5A8YA 4BTUB 3GY8A 2R3YA 2W6JD 3S0NA 3MNSA 1FAKH 1O3FA 1Y8TA 2GCHG 3RXMA 4FVBA 2F9OA 3UUZA 1T7CA 1JWTA 2KCOA 4A1TA 3A82A 1BRCE 4Q63A 1BHXB 1BRUP 1VITF 1BZXE 1WOFA 1FV9A 2ZTYA 1EB1H 2VH6A 1B7XB 1FQ3A 1O31A 3MU8A 1GVKB 4U30A 5BPEA 2ZFFH 1QBNA 1MTSA 5FHTA 4D7GA 1SMFE 1H8HD 3UOPA 1QA0A 3RXHA 1THSH 4ZAEA 2F4LA 2Z9KA 2ZECA 2PSYA 3SJIA 1J14A 3C27B 1ZPCA 2FO9A 3UQOA 1P11E 1P2QA 1GJDB 1QQUA 1C2KA 1E37B 3MU5A 5DSFA 1SGTA 2CV3A 4Z1MD 1NFYA 5AHGH 2Q6DA 1C5QA 3KCGH 2A1DB 3FP6E 1L1GA 1RGQA 1AO5A 5EPYA 3WY8A 1RJXB 3ATLA 1DPOA 4ZXYH 1GHBF 1QB6A 3RXJA 2EY4C 1O2MA 2ALVA 4HTCH 2ZQ2A 2ZU4A 1CT2E 1MH0A 1CA8B 2ZGXH 5KGOA 2J94A 3HGPA 2EC9H 3P92A 2YNBA 2EA3A 2ALPA 4IMQA 1GBKA 1INCA 4Q4LA 1V2OT 1LHFH 2GCTC 4F49A 4AG1A 1GJAB 2WUBA 3P8OA 3I78A 1GG6B 1QJ6B 5E8EH 4B1TA 3A8AA 3GY4A 5HGGA 1FY8E 2VIWA 1FX0B 2ODPA 2ODQA 2BOHB 2PR3A 2ZGBH 3LIWA 4X0WU 2QYIA 1AU8A 3F68H 1CHOF 1GJBB 4AFSA 5A0CA 1P06A 1F92A 4NZQA 1DITH 2IPQX 5HM2A 6CHAC 2BLWA 2FOCA 1OP2A 1ZHPA 4O03A 1VR1H 2D8WA 3Q3YA 1AKSA 3MNCA 1BJUA 4A92A 4B2AA 4XRNA 4Z6AH 1EOJA 5C1XA 2IPHA 3BTQE 4Z0KA 2ANWA 2ZTZA 3SZEA 1IAUA 2G55A 1O5CB 4XSKU 1JOUB 2VIPA 3EE0B 5HIZA 3OYPA 2FLRH 3KGPA 1SKYE 2P95A 1DY9A 2QXJA 1P2MA 1C5ZB 2F9PA 1ZHRA 3LC3A 2LNCA 1BRBE 2VBCA 1C1WH 4ZCNA 3ZZDA 1EASA 1YBWA 1VITG 2Z7FE 3IITA 1BMFD 3T27A 2SGPE 1MKWH 1IQGA 2YOLA 2ZP0H 5F8XA 1C5LH 2EI6A 3BTFE 1NN6A 4UFGH 2W7SA 2F91A 1UTOA 4CRAA 4D7FA 2M2AA 1OYQA 1UVUH 1ELAA 1WCZA 2Z94A 1MTVA 1UK3A 1A61H 2ZI2H 5T6FA 1MABB 3QGJA 3MHWU 2WHXA 1NPMA 3NRLA 1QRZA 1TABE 1P2NA 2VJ1A 1UHBB 1C2GA 4F55A 5FPTA 2HPPH 2B0FA 2UWPA 1S82A 1YPGH 2OC0A 2FOEA 2Y81A 4FUHA 2FOMB 1BTWA 1O3GA 4MQAA 3E8LA 4DJZB 5GNDA 1AN1E 1ELDE 5E2OA 1RIWC 2QF0A 2TBSA 2ZPQA 4PROA 3ZZ7A 4I8GA 2VNTA 1S0QA 1A0HB 3W1EA 2QXGA 3EYDA 2PUXB 3E0NB 2TGPZ 3BTME 5I25A 1C1MA 5KECA 1YLCA 5F6MA 4GLYA 3M3TA 1H4WA 4NIXA 3LGVA 3STIA 1GBBA 3RU4T 3T62A 5HKKD 3VB4A 1HUTH 2BY6X 3DSOA 1S83A 3OSYA 4XOJA 2HGTH 1LPKB 4XE4A 1D3TB 2A4QA 2J38A 4B73A 1G3DA 1BJVA 2WZQA 3RLWH 3P8GA 3GISB 1CU1A 5ABWA 1YLDA 3SYJA 4MPXA 1THPB 4GUXA 2JH5D 3H5CB 2FESH 1ARCA 1F0RA 4AX9H 3QN7A 4X2WA 4ACBA 3QLPH 3M7TA 5C67A 4LK4A 2UUKB 1GMDF 1WQVH 3MYWA 3MU1A 1GJ4H 1UTNA 3SOSA 1E38B 1ZPZA 3ZVCA 2KAIA 2SNVA 4YT6H 3MQKC 3VXEH 3D65E 2WSSD 1F5RA 1LMWB 4JMYA 1UTJA 1NESE 3ZVEA 1V2QT 5EGMA 4RI0A 3KQEA 1G37A 3RXFA 3BTWE 2TGAA 1XUFA 1C1SA 3CS0A 2A7JA 3KF2A 3SJ9A 3RXBA 1JRTA 2UWOA 1CVWH 4I8JA 5LPEA 1JRSA 4Y11E 2XNIA 4BAQB 1GBLA 2CHAB 1Y5BT 1HAVA 2FYRA 4I86A 1MUEB 2GMTB 5A0BA 3URCA 3GYMA 2QA9E 4H4FA 3K2UA 1DLEA 2AMPA 2UUFB 1MQ5A 2VIVA 3KHVA 2STBE 1ZSJA 1DSTA 1O2TA 4AGJA 1C2IA 3K9XB 4K5ZA 1DXPA 4AYVB 5CHAC 4IC5A 5B6OA 3SORA 1SGPE 4Q7XA 3ATMA 3GY7A 1EUFA 2ZCHP 2O9QA 5FXLA 5JBAS 2OC8A 1QTFA 5DPAA 4X1RU 1LVMA 5AF9H 1SPJA 4WMDA 5J4QA 1GGDB 1MZDA 5GDSH 2VGCB 2BHGA 1NU7B 2EQNA 4JYTA 2H2ZA 1HGTH 1TX8A 1UTPA 2Y7ZA 2ZFRH 3RXRA 1NRSH 4FUGA 2C8WB 4ABGA 1CT4E 5G4BA 1B0EA 4MPWA 8KME2 1GJ9B 1Q2WA 5AFYH 2ZPSA 2TIOA 3V3MA 3A83A 4ZROA 4E7NA 4JZEH 1V2KT 2J4IA 3BTHE 2BDIA 4RSPA 4NWLA 2J9NA 3U28C 2ODYB 4Q2KA 1OPHB 2HWLB 2GZ7A 1ZYOA 5DGJA 3PTNA 1HAPH 4CBOA 1GI4A 1O5FH 1GDNA 2AFQB 4ZHAA 2SGDE 1IHTH 2FXRA 4X8VH 3DFLA 1GJCB 1F7ZA 3PV5A 1GMDG 3V13A 1CGHA 3ODFA 4RKJB 1KDQA 3DFJA 4A1XA 3KIDU 2C3SA 4BANB 1HV7A 4D76A 3VB5A 1TPPA 4B75A 1WUNH 3K6ZA 3KL6A 2XTTB 1V2WT 2WUCA 1WV7H 3FP8E 3Q76A 1BTXA 1H8IH 1W10U 2VVVA 2JJ1D 1ZMJA 3ZYDA 1ELVA 1IQMA 1SGIB 1OSSA 1O2JA 2A5KA 2OINA 2VWOA 4LOYH 2ESTE 4UFFH 1QGFA 1HJ9A 2IJOB 1ANEA 1DOJA 2WPMS 3AAVA 1DICA 4LZ4B 1C1QA 3TJOA 2G52A 3PYHA 1GG6C 3IWMA 3GY6A 5FCKA 3GY5A 4Y10E 2ANYA 4GVUA 3ENSB 1BTUA 3LGTA 1Y3XA 1CGIE 1D3PB 1O3DA 2G00A 3MMGA 5SGAE 5C3NA 3QUMP 2A31A 7GCHF 1O2SA 1BTHH 5TCCA 2JKHA 3ZZ3A 4RT1A 3Q3KA 1ZJDA 1O2HA 2QGRA 3TH4H 1DUEA 2AEIH 4FVDA 1IHSH 1PQ7A 2V35A 5GPIB 1PJPA 3N99A 4SGBE 3VFEA 1O2VA 4X1PU 1K1LA 2HNTF 4TWYA 3UOUA 2AIPA 3U8TH 2BY7X 4D8NA 4CRGA 2ZGJA 1SI5H 4DT7B 3CENA 1YPJH 3LH3A 3EAJA 1XVOA 1EZUC 1MQ6A 3SGQE 1A3BH 4ISIH 2GCHF 2THFB 8GCHF 1T8NA 3KNXA 4K3JA 1RD3B 2PV9B 1KLIH 4CR5A 1O3BA 1OHHD 3LOXA 3GOVB 5F03A 2Y5HA 4WMEA 3MTYA 1QL7A 1DS2E 1ESTA 5CE1A 2VWNA 2ZIQH 1MBQA 4OM9A 1MKXH 2RA3A 2ZHEH 3WWFA 4AFQA 2XBVA 3RXLA 1BCUH 2K1QA 1QCPA 5DN6D 2VWMA 1LCYA 1WAYB 3QZRA 3ZIAD 3BSQA 2ZFQH 1DVAH 2ZU2A 2ZU5A 2HVYB 2R2MB 1S6FA 1W11U 2DE9A 1UVTH 4X2VA 3NCLA 2BDBA 4I7YH 4WH6A 1TQ7B 1COWD 1ANDA 2QN5T 1G3BA 6ESTA 2GJGA 3KQCA 3MFJA 1YF4A 1Z1JA 1A5IA 4JK5A 1TA2A 2C8ZB 1ELTA 1TBRH 5C17A 1O5BB 2B8OH 3RXSA 1RFNA 1O2IA 3RU4D 1BTZA 3SU2A 4B6FA 3O8BA 1XUIA 1O3MA 1C2JA 3GS9A 3MO3A 1GHWH 2FTMA 2W7UA 3SQEE 1K1OA 1FNIA 1K21H 1TAWA 1HPGA 2A2QH 3PTBA 2Z9GA 1H8DH 2XXLA 4MDSA 2TGTA 4AB8A 2O8MA 1N8OB 1M9UA 1GBJA 1YP9A 1EJNA 5HYOA 1ZSLA 2Z6BD 1P57B 2Z9JA 2C4FH 2AS9A 1FAXA 1AVGH 4ABHA 2EEKA 4CRFA 1SQAA 2ZU3A 3SU6A 1P05A 3M5OA 7GCHG 3VEQB 4ESTE 1CT0E 4DY7B 1S6LA 5FAHA 4GHTA 1SHHB 7LPRA 4K8BA 4NGAH 1LKAA 2VWLA 5GWZA 3KYFA 4DIIH 1YCPK 2OK5A 3SGAE 2FP7B 1TA6A 1VJAU 1HLTH 5DP8A 1YGCH 1LO6A 1QIXB 3MH7A 1NFUA 3SV9A 1FUJA 1KLTA 1GI5A 1O2UA 3W94A 1Z6EA 1O5EH 3RP2A 3OAAD 1ZGIA 1MTNB 2FIRH 1FDPA 4UFDH 2J92A 1SVPA 3W95A 8GCHG 1AE5A 1E79D 1OWEA 4ZKNU 2FEQH 1WXRA 2KFWA 5IDKA 2CHAC 5C5NA 3NXPA 3LONA 4D9RA 2GMTC 3ATWA 5C1UA 4MNYA 1LPGB 1WQSA 4Q7YA 1NRNH 2TPIZ 4KTUA 2C93B 5TCAA 5DP9A 4X8UH 5DK1A 4KP0A 5A0AE 1PPBH 2PKAB 4INHA 3O8DA 4KGAA 1YC0A 3EA8A 2A4RA 1NO9H 2VH0A 1V2JT 2W5EA 1L0ZA 1GBMA 1UHBA 1J8AA 1YKTA 4AORA 1DDJA 1KTSB 1BTPA 1BTYA 2LP6A 2ZC9H 3FFGA 1YYY1 1TALA 1YPHC 2BD2A 2VB0A 5T3HA 2TRMA 3RU4E 3SHAH 3KQDA 3A8CA 1C5XB 2F9BH 3BTDE 1V2UT 3SQHE 3GY3A 4K1SA 1GGDC 3M36A 1NBMD 2VGCC 4Y8ZA 2D26C 1J15A 1GI1A 4OGYA 1Z8JB 1KXDA 1TBZH 4Y79A 4I8LA 4ZKRU 3M61U 2VIDA 5FL7D 4YLUA 2HPQH 1WU1A 3URDA 1ZOMA 2BDHA 5ETXA 5A2MH 1UMAH 1WSSH 1O2ZA 3F9HA 5DP4A 1F0TA 1ZTJA 4BAOB 4Y7AA 5EQSA 1V2ST 2FTLE 2GDDA 1O3KA 2WPDD 3NWUA 3ZV8A 3TGKE 1YPKH 1EP6A 1WYKA 1SBWA 1W0KD 2BY9X 4OS1A 3A7XA 3VB6A 1FY4A 3CNRA 1CA0B 3M5LA 3TJVA 1UK4A 1LHEH 3T26A 2F9VA 3N7EA 3R3GB 4MPVA 2QIQA 3ATKA 1G9IE 2ULLA 1K9OE 2BMGB 6GCHG 3TVJB 2QCYA 2BY5X 2F3CE 2Z9LA 4MVNA 1GJ5H 1THRH 4UEHH 3GDSA 3U69H 5L2ZH 3F1SB 2ZNKH 1TPOA 5FBEA 4TWWA 2BDYA 2XCFA 2FYQA 2ANKH 2O8UA 1FY1A 2XOKD 2KCAA 4XBCA 2RDLA 1SGEE 1O2RA 3I77A 3QK1A 1ACBE 6LPRA 1EP5A 1ZHMA 5GIBA 1GI9B 1FIWA 1GHXH 1ZPBA 1DWDH 2CK3D 2QF3A 4YLQH 2IOTA 1V2RT 4X1SU 2FOFA 1YPHE 5EODA 3N7OA 1P9SA 1P04A 2ZKSA 2FOGA 1Y3UA 1O3IA 3AAUA 4YOJA 2FI4E 2QY0B 2BD9A 3SNDA 2GZ9A 1LQDB 1TMUH 4F4OC 1SFIA 1A46H 2XBWA 1W0JD 4UDWH 4VGCB 3K6YA 1SB1H 1HIAB 3DT0H 1PPFE 2GT8A 2J95A 1CQQA 4MLFB 4ZHMU 4ACAA 4YT7H 1RTFB 4BAKB 2CJIA 1SQRA 2XCNA 5PTPA 1W12U 1KY9A 3RLYH 2YNAA 4O3UA 3PLPA 1BHXF 1KMHB 3SNCA 3RXDA 1AMHA 3GDVA 4K1TA 2WINI 4ABIA 2XRCA 1O5AB 4IMZA 1XM1A 1TYNA 1S0RA 1D6RA 2G8TA 1O30A 1DM4B 1OWIA 2GT7A 1L4DA 4FU9A 3MO6A 2Y5GA 1UVOA 1BA8B 1EZSC 1GJ7B 1PQ5A 1UTKA 2ZHFH 3BIUH 3STJA 2P16A 3TH2H 4B6EA 4CHAB 1T8LA 3C1KA 4XD7D 1P2JA 1SC8U 2PLXA 2BLVA 1EQ9A 1ZSKA 1IQHA 2QXHA 2BLOA 2HLCA 4BNRA 3VXFH 1AHTH 1FONA 1C4U2 1ESAA 8LPRA 1MMJN 1HAOH 1OWDA 3MO9A 2G81E 1ZJKA 2O8LA 5CHBA 4KTSA 2RG3A 1C5TA 1W8BH 3RMNH 3TJNA 1LQEA 3SUFA 1AUTC 7ESTE 3QTOH 3MNBA 1BBRK 1TX6A 2OLGA 3A7TA 3ELAH 3P8FA 3B8JA 1N6YA 4O3TA 2FI3E 3SNBA 5CDFE 2A5IA 4WY3A 1BB0B 3GDUA 1QY6A 1W13U 1BOQA 2QF5A 1RRKA 2HVXA 3F2GA 1VZQH 2ZZUH 4JZIA 4KKDA 3TITA 1ID5H 3NK8A 4CRCA 5DG6A 5DP7A 3AASA 2RCEA 2ZGHA 3T28A 2BD3A 2VIOA 4NIWA 5EPNA 2OQ5A 1C1OA 4ZUHA 1HNEE 2ZFSA 1GHZA 2J98B 2RDEA 1RXPA 3UQVA 2H5CA 3UWJH 1PQ8A 1GHAF 2P3UB 2A4OA 2BB4A 1PQAA 1P0SH 1A7SA 1XUGA 2QE7D 5EQRA 4K2YA 3SJOA 2BTCE 1MD7A 1SGYE 4YM9A 4XDEA 1P3CA 1SHYA 3M37A 1TOMH 1IQFA 3PROA 3A7ZA 2Q6GA 3P17H 3A7WA 1O33A 3HPTB 1F0SA 4K69A 1G3CA 3EQ0H 1HAZB 2B7DH 1UVPA 3RXUA 4NZLA 1OP8A 3SV6A 1FLEE 2VVUA 1K1MA 1HJAB 1AVXA 4HG6A 1O2OA 3VB3A 3RMMH 1XUHA 1PYTD 3Q00A 3OEED 1ETTH 1BBRE 3D49H 1RS0A 4RN6A 1SGRE 3M5NA 2FI5E 5EJZA 1NRRH 2P59A 4OS4A 1N8OC 1TLDA 4ABFA 2H9TH 1TFXA 3SNAA 1C5SA 4CH8B 4WJG2 4Y8XA 2WYJA 1PPCE 3SI4H 2BM2A 1SOTA 1FI8A 4Y7BA 1TGSZ 5L6NH 4ZMAH 1V2PT 2PP6A 3SNEA 2PGQB 2XWBI 3TIUA 2GKVE 5A09A 1G2MA 1DT2A 4LZ1H 2R9PA 3OY6U 3BN9A 2QC2A 4FOUC 4ISHH 1SOZA 1Z6JH 2STAE 1LVOA 3GICB 5H4IB 3LDXH 1ANBA 3TPIZ 3UNSA 1CGJE 3A89A 3GCHB 3SGBE 1X7AC 1AWHB 3CP7A 3B9FH 1BBRH 1NC6A 2ZFTA 2BVSH 5C5OA 1Q3XA 5DO4H 1SGDE 2FLBH 4H42U 1MTNC 2YMSD 1OWHA 2R2WU 5EQQA 1WDIA 2BD7A 3PM3A 1O5GH 5JB9S 2OC7A 2L6OA 1NU9A 4ZHLU 2ZO3H 5I46H 1V2NT 5JBBS 1NY22 4GAWA 2PKSB 1MAYA 4I8KA 1H9IE 4E05H 1O2LA 5IYTA 3RC5A 1C4V2 5C20A 5T1VA 1KXEA 4X2XA 4GSOA 1C1UH 1TNGA 1D3QB 1H1BA 1O36A 1EXFA 1ELGA 1GHAG 4IN1A 4I33A 1P10A 5FPYA 3U8RH 2OD3B 4OS2A 1ZZZA 1AD8H 2A7HA 1EKBB 1ZLRA 1O3CA 4AFUA 7KMEH 4WWYA 1O2WA 3MH6A 1AFQB 1GCDA 4J1YA 1W0YH 1N6XA 2FX4A 3ZZCA 2PTCE 1FN6A 2FDAA 1IQNA 1TMBH 1GDUA 2BVRH 1YPEH 1W7GH 2WPJS 1BRAA 3SN8A 3Q77A 1BMMH 2BVXH 1T32A 3I29A 3PWBA 1QR3E 3A84A 3U1IB 1GI6A 3WWBA 1A3EH 1C2HA 4A7IB 2XC4A 3S7HB 1EJMA 1V6DA 5EXLA 2P8OB 4X6PA 2WV5A 2ZHQH 4MPUA 3GCNA 1C9PA 2BYAX 1VCPA 1TGCA 3ZZ6A 5B6LA 1DUAA 2K8IA 2SFAA 4OS7A 1EX3A 2FS8A 1CA0C 2PFEA 3OTPA 3SV2H 1IQIA 3SU5A 3E90B 1BITA 4MG3A 1TGBA 4B2BA 9ESTA 2V3OH 3E1XB 2AERH 5C94A 5JBTA 2P3TB 3TH3H 2W6ID 1KSNA 1OOKB 1A4WH 1HRTH 4TY6A 1ARBA 1VCWA 1ABIH 1DWCH 3AVZA 1NFWA 5ESTE 1G36A 3U8OH 1OWJA 1YPMH 3SU1A 1ORFA 1T8MA 1ZR0A 3PV4A 1FN8A 1QURH 3RC4A 2GD4B 4ABDA 2Z3CA 3OX7U 2BZAA 2ZHWH 1YWUA 4NFEA 1GI2A 1GVZA 1J16A 4VGCC 5C2ZA 2ZDMA 2EI8A 1EZQA 1ELCA 1E35B 2ZQ1A 2PUQH 1O3JA 1Z71A 2B9LA 1ZTLA 1AI8H 5EG4A 3EGKH 3ODDA 2NU0E 3LJJA 2R0KA 2A0QB 3IG6B 1C5WB 2TGDA 2R0LA 1XUJA 2QF4A 3SBKA 3T29A 1IQJA 4Y0ZE 4BAMB 1QBOA 2ZA5A 3BTKE 1T4VH 3SJ8A 2SGEE 1VGCB 4ISLA 4OGXA 1W2KH 3UAIC 2KX4A 4P00A 1F5KU 2BQ7B 1JMOH 2CN0H 2PKAA 3BG8A 4Y8YA 1IQLA 3MU0A 4X6NA 2LELA 1A1RA 1A5GH 4CH2B 2XC0A 4CHAC 1GL1A 1P03A 1EFRD 1TB6H 2DUCA 1K2I1 2ZDNA 3BTEE 4DW2U 1RTLA 1S84A 1AFEH 3AK5A 2XBXA 1QRWA 4X1NU 3RMOH 3D62A 3JZ1B 1GMHF 2A5AA 2OXSA 1SL3A 3VG8A 4AYYB 1AB9B 1P01A 1ETRH 4DIHH 1LVYA 2WPHS 3PLBA 1C5RA 3O8CA 4ABEA 3A85A 3BF6H 2A32A 2H9EH 1FXYA 1MU6B 3KQ5A 1O3AA 1AQ7A 3A86A 1O3HA 3SV8A 1P2IA 2OP9A 1K28D 3U98H 2JH6D 1KTTB 3HGNA 4DT4A 1V3XA 4HFPB 4RT0A 1GI0A 4SGAE 4NCYA 2OBOA 3KYGA 4ZKOU 1JXPA 1TNHA 1BUIA 2A45B 4ZH8A 1HAYB 1SQTA 1V2VT 3QGNB 6GCHF 2BOKA 5C1YA 2O8WA 4Q80A 2G4TA 1P2KA 2KCPA 3M5MA 4B76A 4X2YA 1S6HA 2SGQE 1TGNA 1NRQH 5EU8A 1E1RD 3BIVH 1BMLA 4AGKA 2UUJB 1QFKH 3G01A 4OS5A 5K0HA 5GCHF 1KXBA 2JJ2D 1AZ8A 3RDZA 1PPHE 4NIVA 1D6WA 2AIQA 2F9NA 3TNTA 5JDUB 4ASHA 1TPAE 1GCTB 1ZMNA 5DP5A 1E34B 1JIMA 2ZDLA 1TBQH 1SGFA 4X8TH 3L33A 3U9AH 3JZ2B 1GBAA 1P09A 2GV7A 2Y80A 3B23B 1HAHH 4O9VA 1HIAA 1NFXA 1HJAC 1D4PB 1XXDA 3PB1E 2V0BA 3SI3H 2ZWLH 1V2MT 3N7DA 2NU4E 3BEUA 3F9EA 3P8NA 4CRBA 1O34A 2G4UA 1K1NA 5DKMA 1B5GH 4K1EA 4OS6A 5DP3A 1YPLH 5T6GA 2NU1E 2UWLA 5KEDA 3NPSA 3UR9A 1DE7H 1HBTH 3GCTF 2SGAA 3MOCA 3A8DA 1QL9A 1OKXA 1EB2A 1GPZA 3ATIA 3RXIA 3TGIE 1GBTA 3RXGA 5EJ1A 1PFXC 9LPRA 1Y59T 2FWWA 4LXBH 4CBNA 1GBDA 5AVDA 3H7TA 1ZRKA 3OY5U 4AZ2B 1C5NH 1NT1A 4ABBA 2G51A 1EAIA 1HXFH 1O37A 1O2PA 4JZ1A 3KEEA 1QB9A 2YMSB 1O2GH 1F2SE 3A7VA 1EAWA 2VIQA 3GCHC 3UFAA 1GMHG 3ESTA 1MBMA 1IOEA 3VB7A 1G30B 3CS7A 1SLWB 2WPKS 1MKWK 1W0ZU 1HJ8A 4TSFD 1AWFH 2EI7A 3LGWA 5EW2H 5L30H 3AW1A 1NRPH 1O32A 2H1UA 1O0DH 2UUYA 1K0HA 2ILNA 4IGDA 2CXVA 4IBLH 3F2HA 3FO8D 1QRXA 1VCQA 2GZ8A 1NS3A 3VPKA 1TNKA 1MTWA 4YXWD 3F3BA 2D2DA 1UVSH 2PKSC 5GXPA 1OX1A 3HK6B 1QQ4A 1WTGH 5BRRE 2HNTC 4JYVH 1ELEE 1WBGB 3NKKA 3HK3B 3PLKA 4FU8A 3P6ZB 2BXTH 4RKOB 4B74A 3DD2H 1Z8IB 2XBYA 3SW2B 2L74A 4A1VA 2SNWA 2J98A 4AB9A 2W3IA 1QA7A 4K60A 1LPZB 2F43B 1UTQA 1GBEA 4NSYA 3EA9A 3SHCH 3SU4A 1BMAA 2XNDD 2H5DA 2GP9B 3FZDA 2F83A 1Z8GA 1YCPH 1HAXB 3OU0A 3EA7A 2XWAA 1DWEH 4JZDH 1HXEH 3QO6A 5FCRA 1C2DA 5GCHG 3QX5H 5TJXA 1H8ED 3GY2A 2G5VA 3RXQA 1KXFA 1AFQC 1OWKA 1LKBA 1HAGE 2CF9H 2AMQA 5JYIA 2O8TA 1EPTB 3QWCH 2FPZA 2ZF0H 2VVCA 2GX4A 1ESBA 3E6PH 3HKIB 1FPCH 2W3KA 2PTNA 3KN2A 3PO1B 2J34A 3EDXB 3PMAB 1BT7A 5IK2D 1LVBA 4FUJA 3SU0A 4BXSA 2HLDD 1QZ8A 1VJ9U 4UFEH 2Z9IA 1FPHH 1HB0B 2P8OC 5J4SA 1ANCA 1PPGE 3LT3A 1HDTH 1UW7A 2ZHDA 5JBCS 3SV7A 2AGGX 3SJKA 4KTCA 2VINA 4NFFA 3V0XA 3ZVDA 1DY8A 4JK6A 4UD9H 1LDTT 1Z7KA 2ZU1A 3NUMA 1W3CA 2GGVB 3HKJB 4I32A 2HNTE 1TMTH 4MNVA 4Y76A 1KXCA 3GCTG 1DXWA 3HATH 1ZGVA 3FP7E 4K8YA 3ITIA 3MI4A 1DANH 1HYLA 4U2WA 1Y3VA 5ESBA 2JIZD 5F8TA 2ZDKA 2F9UA 3RXPA 5HM9A 4MTBA 1GBFA 2BQ6B 1SFQB 2NWNA 5T6DA 2FM2A 1NBME 3VGCB 1ZMLA 3LGUA 1Q31A 5EIYA 1VKYA 1BQYA 2VU8E 4IW4E 4TYDA 2J97A 5F53A 5C0TA 2Y7XA 4DGJA 5L2YH 3OEHD 4ISOA 4X6MA 3PMJA 1UCYK 1SG8B 3SZNA 1QB1A 5EJLA 5E2PA 1PPEE 3A81A 1NROH 3SUDA 3S9AA 4Q7ZA 3TK9A 1P2OA 3SUEA 1GJ8B 2FOBA 2GDEH 1O2XA 3RXTA 4UE7H 1QJ7B 1KIGH 4F48B 3MU4A 1AY6H 5FBIA 1CO7E 3SUGA 2WYGA 3ZVAA 4BAHB 1EAXA 1L1NA 4MNWA 1CBWB 4TPYA 1EATA 1CE5A 4X1QU 3FAOA 3ZVFA 1P3EA 2FODA 1O3OA 1MZAA 5E0GA 1VGCC 1DWBH 1MCVA 2JETB 1G2LA 1GHBG 3RM2H 3V7TA 1AZZA 2BXUH 4CRDA 4BXWA 2P3FH 4M9FA 3BG4B 3MWIU 2GV6A 3PV2A 2V3HH 3S7KB 1BIOA 2PSXA 4GCHF 2Z3DA 1TNLA 2BY8X 3DSPA 1OYTH 2V6NA 2C8XB 4FU7A 4WXVA 4NA9H 2KR7A 1TQ0B 2QXIA 4BTIB 2ZGCA 4FETA 4XBBA 3M3VA 3ZVGA 4YOIA 1AIXH 1N1LA 1D3DB 1DX5M 4JCNA 3DCLA 1TOCB 1AB9C 1XX9A 1O2KA 3UR6A 1XKAC 1P8VC 1FZZA 1GHVH 3M3SA 1H9HE 1CHOG 4HI3A 1Y5AT 3ZZ5A 4NA8A 1YY3A 4FUCA 1QL8A 1UCYE 2OUAA 1YCPM 3UB0A 1D9IA 3L3TA 2ZCKP 2CF8H 3FKSD 3TLOA 3O8RA 4WH8A 1AKSB 3RXEA 4YO9A 4I8HA 4U32A 1K22H 1HCGA 5E0JA 1GDQA 1KLJH 1UTLM 1Z8RA 1C5PA 1C5OH 4FUBA 5LGOA 3MH5A 3MNXA 1O3LA 1QNJA 2BZ6H 2CGAA 3FN8A 1C1RA 3ZZBA 4DVAU 1MAXA 2ZEBA 2AMDA 1FY5A 3NZIA 4CREA 2LPRA 3DUXH 1LTOA 2XW9A 3UNQA 1GI8B 3UPEA 3UREA 3LH1A 1IQKA 3TU7H 5F8ZA 1MU8B 1UCYH 2I6QA 4J2YB 3TJUA 2RFKC 4U01A 2ANMH 3A88A 1GCTC 4TPIZ 4M7GA 2BQWB 1PYTC 1GWAA 2PHBA 4TY7A 2IN2A 1YM0A 2ASUB 3AW0A 5A8XA 2ZG0H 3EE7A 1K1JA 3TK6A 2ZTXA 1OS8A 1SGQE 2Y82A 4GPGA 3UTUH 1ZRBA 3UWIA 1TNJA 3ZV9A 5LPRA 4NIYA 2PWXA 2XYAA 4JZFH 3RMLH 3RXOA 1S85A 3F0PA 1O2YA 3P70B 2A4GA 1AE8H 1GMCF 1C2MA 1XVMA 1MD8A 2I6SA 3QDZB 4BOHA 4YZUA 1E36B 2BD8A 3FANA 1K1IA 2C90B 1AVWA 4AC9A 2QV1A 5EXMA 5A8ZA 2AGIX 1K1PA 3OTJE 3S69A 1VITH 3TNSA 2AHME 1SSXA 3A8BA 4X8SH 1LHDH 1DLKB 1SLVB 1GHYH 4INLA 4JYUH 4FUFA 4IN2A 2WV9A 3A80A 3TK5A 4XFQA 1C1PA 3ZYEA 5HXFA 1O3PB 3LKWA 2HRVA 1FY3A 4GCHG 1C5YB 1B0FA 4A5TS 3PRDA 4TT3D 3TGJE 1E1QD 3LJOA 1L1JA 2YMSC 2GCTB 3F2FA 3T25A 3PRBA 2FS9A 2KM0A 2W26A 2H9HA 4BTTB 4MNXA 1BMNH 4ZXXH 3OFND 1J17T 1C2FA 4NA7A 1UK2A 1V2LT 3UNRA 1O39A 1TRYA 1SGFG 1JIRA 4XBDA 4YOGA 2DE8A 1S5SA 1MKXK 3K65B 3RXKA 1C2LA 3T5FH 1C5UA 1GL0E 1TX7A 4H6SB 1NZQH 3M7UA 1C1TA 6CHAB 1O3NA 4D9QA 4INKA 2GTBA 1ETSH 5LH8A 4R8TB 2FOAA 2R3UA 2KAIB 3E0PB 3BEFB 3F9GA 5CMXH 3E3TA 1SLUB 1OP0A 4I31A 4Y6DA 1KYNA 4DOQA 4FUDA 1C1NA 2KCYA 3F0OA 1UTMA 2OCVB 4WXIA 1E0FD 1XXFA 4R0IA 2Y6TA 2XC5A 3D23A 1DFPA 1W14U 4CR9A 4DCDA 1O2NA 1GI3A 3OE7D 2J5UA 3GCOA 2ZFPH 1ABJH 2Q1JA 3BEIB 2P94A 4HGCA 1O3EA 1C1VH 1CSOE 1HAVB 2K0QA 3LGYA 2J2UA 1O35A 1C9TA 3L6PA 3DSGA 3WW7A 1XKBC 3ZZAA 1TNIA 4E06H 1EPTC 1SGCA 1BDAA 3P95A 1GBIA 2Q6FA 5DJ7A 5E0HA 4AFZA 5C0UA 4B71A 1A5HA 3PMHB 2KZ4A 3PO1C 3QTVH 2ZPRA 1S81A 1PPZA 2BDGA 1GBCA 1H9LB 1QBVH 1U6QA 2ZCLP 1ZTKA 3DA9B 2CMYA 4AN7A 4NWKA 1JBUH 2JDID 5K7RA 1EZXC 4WF8A 3H7OA 2Y5FA 1Y3YA 4KELA 2HALA 3FVFB 3GYLB 4GHQA 1GMCG 4ZKSU 1SLXB 3U1JB 4H6TA 3R0FA 1TGTA 1FJSA 1UO6A 2ZDVH 3Q3XA 2Z3EA 2FOHA 4NG9H 1MCTA 3SO3A 1YLNA 1CHGA 1AUJA 1RIWB 1Y3WA 2D1JA 2SGFE 3A7YA 3RXCA 2FZZA 3E91A 2G5NA 4UONA 5HMAA 2FX6A 4WVPE 1TRNA 1UJ1A 1A0LA 3F6UH 2OC1A 3MH4A 3E16B 4B2CA 4X6OA 2IJD1 2H6MA 1NTPA 1F5LA 1TE0A 2BX4A 1NM6A 1C5MD 2BX3A 1EJAA 4P02A 1QHRB 1SGNE 1GJ6A 5FX5A 4Y0YE 1SQOA 3VGCC 3A87A 1W7XH 3ZZ4A 2OQUA 5FX6A 1LHCH 4AOQA 4NSVA 5EOKA 3LC5A 4ABJA 3M35A 1J9CH 3PMBB 1G32B 3RXVA 1SR5C 2WPIS 3LGIA 1EOLA
chains in the Genus database with same CATH topology
1P02A 4QT8C 2NU2E 2AGEX 2FMJA 4THNH 3SU3A 1O5DH 1QJ1B 4HZHA 2PGBB 1ELFA 1AGJA 1HAIH 3V12A 4Y71A 3BV9B 2AYWA 1C5VA 1XUKA 1G3EA 1P9UA 5FPSA 1CBWC 2B5TB 2RA0A 1KDQB 5LPFA 1Z1IA 1O38A 1TWXB 3LPRA 1T8OA 2BLQA 5EW1H 3UY9A 1P12E 2JH0D 3S9CA 2JETC 4YESB 3QZQA 1GVLA 2C8YB 1WTHD 2OTVA 2AH4X 4E7RG 5EXNA 2ZDAH 3BG4C 4DURA 1O2QA 3BTGE 8ESTE 5JB8S 2QAAA 3BTTE 3KQBA 2BDCA 2M5TA 4ISNA 1C4Y2 1F0UA 1L2EA 3ZVBA 3RXAA 4FXGH 1L4ZA 1ELBA 2BD5A 1V2TT 1TONA 1LHGH 3RUOA 1FIZA 2PW8H 2P93A 2WV4A 3RC6A 2A7CA 3ZZ9A 1T31A 1OXGA 5GJ4B 2OBQA 1TRMA 1EPTA 4O97A 1MTUA 1KXAA 1A2CH 3PWCA 1DSUA 1T4UH 2GVFA 3S9BA 1IQEA 1Y5UT 3RM0H 1C2EA 1HFDA 5CHAB 2NU3E 5DP6A 4ABAA 5JPMH 3UIRA 5AFZH 1XMNB 3FZZA 2BDAA 3M7QA 4WMFA 1EAUA 4A6LA 1GI7B 4IS5A 2A2XH 1RTKA 3DHKH 3T2NA 1A0JA 1GBHA 3F9FA 3ZZ8A 2BD4A 1FMGA 2HOBA 4DG4A 4YTAA 3LU9B 4FUIA 4FUEA 4IC6A 1TPSA 4AG2A 1TIOA 2WPLS 5A8YA 4BTUB 3GY8A 2R3YA 3S0NA 3MNSA 1FAKH 1O3FA 1Y8TA 2GCHG 3RXMA 4FVBA 2F9OA 3UUZA 1T7CA 1JWTA 4A1TA 3A82A 1BRCE 1BHXB 1BRUP 1VITF 1BZXE 1WOFA 1FV9A 2ZTYA 1EB1H 2VH6A 1B7XB 1FQ3A 1O31A 3MU8A 1GVKB 4U30A 5BPEA 2ZFFH 1QBNA 1MTSA 5FHTA 4D7GA 1SMFE 3UOPA 1QA0A 3RXHA 1THSH 4ZAEA 2Z9KA 2ZECA 2PSYA 3SJIA 1J14A 3C27B 1ZPCA 2FO9A 3UQOA 1P11E 1P2QA 1GJDB 1QQUA 1C2KA 1E37B 3MU5A 1SGTA 2CV3A 1NFYA 5AHGH 2Q6DA 1C5QA 3KCGH 2A1DB 3FP6E 1L1GA 1RGQA 1AO5A 5EPYA 3WY8A 1RJXB 3ATLA 1DPOA 4ZXYH 1GHBF 1QB6A 3RXJA 1O2MA 2ALVA 4HTCH 2ZQ2A 2ZU4A 1CT2E 1MH0A 1CA8B 2ZGXH 2J94A 3HGPA 2EC9H 3P92A 2YNBA 2EA3A 2ALPA 4IMQA 1GBKA 1INCA 1V2OT 1LHFH 2GCTC 4F49A 4AG1A 1GJAB 2WUBA 3P8OA 3I78A 1GG6B 1QJ6B 5E8EH 4B1TA 3A8AA 3GY4A 5HGGA 1FY8E 2VIWA 2ODPA 2ODQA 2BOHB 2PR3A 2ZGBH 3LIWA 4X0WU 2QYIA 1AU8A 3F68H 1CHOF 1GJBB 4AFSA 5A0CA 1P06A 1F92A 4NZQA 1DITH 5HM2A 6CHAC 2BLWA 2FOCA 1OP2A 1ZHPA 4O03A 1VR1H 2D8WA 3Q3YA 1AKSA 3MNCA 1BJUA 4A92A 4B2AA 4Z6AH 1EOJA 5C1XA 2IPHA 3BTQE 4Z0KA 2ANWA 2ZTZA 1IAUA 2G55A 1O5CB 4XSKU 1JOUB 2VIPA 3EE0B 3OYPA 2FLRH 3KGPA 2P95A 1DY9A 2QXJA 1P2MA 1C5ZB 2F9PA 1ZHRA 3LC3A 2LNCA 1BRBE 1C1WH 3ZZDA 1EASA 1YBWA 1VITG 2Z7FE 3IITA 3T27A 2SGPE 1MKWH 1IQGA 2YOLA 2ZP0H 5F8XA 1C5LH 2EI6A 3BTFE 1NN6A 4UFGH 2W7SA 2F91A 1UTOA 4CRAA 4D7FA 1OYQA 1UVUH 1ELAA 1WCZA 2Z94A 1MTVA 1UK3A 1A61H 2ZI2H 5T6FA 3QGJA 3MHWU 1NPMA 1QRZA 1TABE 1P2NA 2VJ1A 1UHBB 1C2GA 5FPTA 2HPPH 2B0FA 2UWPA 1S82A 1YPGH 2OC0A 2FOEA 2Y81A 4FUHA 2FOMB 1BTWA 1O3GA 4MQAA 3E8LA 4DJZB 1AN1E 1ELDE 5E2OA 1RIWC 2QF0A 2TBSA 2ZPQA 4PROA 3ZZ7A 4I8GA 2VNTA 1S0QA 1A0HB 2QXGA 3EYDA 2PUXB 3E0NB 2TGPZ 3BTME 5I25A 1C1MA 1YLCA 5F6MA 4GLYA 3M3TA 1H4WA 4NIXA 3LGVA 3STIA 1GBBA 3RU4T 3T62A 3VB4A 1HUTH 2BY6X 1S83A 3OSYA 4XOJA 2HGTH 1LPKB 4XE4A 1D3TB 2A4QA 2J38A 4B73A 1G3DA 1BJVA 3RLWH 3P8GA 3GISB 1CU1A 5ABWA 1YLDA 4MPXA 1THPB 4GUXA 2JH5D 3H5CB 2FESH 1ARCA 1F0RA 4AX9H 3QN7A 4X2WA 3QLPH 3M7TA 5C67A 4LK4A 2UUKB 1GMDF 1WQVH 3MYWA 3MU1A 1GJ4H 1UTNA 3SOSA 1E38B 1ZPZA 3ZVCA 2KAIA 2SNVA 4YT6H 3VXEH 3D65E 1F5RA 1LMWB 4JMYA 1UTJA 1NESE 3ZVEA 1V2QT 5EGMA 3KQEA 1G37A 3RXFA 3BTWE 2TGAA 1XUFA 1C1SA 3CS0A 2A7JA 3KF2A 3SJ9A 3RXBA 1JRTA 2UWOA 1CVWH 4I8JA 5LPEA 1JRSA 4Y11E 2XNIA 4BAQB 1GBLA 2CHAB 1Y5BT 1HAVA 2FYRA 1MUEB 2GMTB 5A0BA 3URCA 3GYMA 2QA9E 4H4FA 3K2UA 1DLEA 2AMPA 2UUFB 1MQ5A 2VIVA 3KHVA 2STBE 1ZSJA 1DSTA 1O2TA 4AGJA 1C2IA 3K9XB 4K5ZA 1DXPA 4AYVB 5CHAC 4IC5A 5B6OA 3SORA 1SGPE 4Q7XA 3ATMA 3GY7A 1EUFA 2ZCHP 2O9QA 5FXLA 5JBAS 2OC8A 1QTFA 5DPAA 4X1RU 1LVMA 5AF9H 1SPJA 4WMDA 5J4QA 1GGDB 1MZDA 5GDSH 2VGCB 2BHGA 1NU7B 4JYTA 2H2ZA 1HGTH 1TX8A 1UTPA 2Y7ZA 2ZFRH 3RXRA 1NRSH 4FUGA 2C8WB 4ABGA 1CT4E 5G4BA 1B0EA 4MPWA 8KME2 1GJ9B 1Q2WA 5AFYH 2ZPSA 2TIOA 3V3MA 3A83A 4ZROA 4E7NA 4JZEH 1V2KT 2J4IA 3BTHE 2BDIA 4RSPA 4NWLA 2J9NA 2ODYB 4Q2KA 1OPHB 2HWLB 2GZ7A 1ZYOA 5DGJA 3PTNA 1HAPH 4CBOA 1GI4A 1O5FH 1GDNA 2AFQB 4ZHAA 2SGDE 1IHTH 2FXRA 4X8VH 3DFLA 1GJCB 1F7ZA 3V13A 1GMDG 1CGHA 3ODFA 4RKJB 1KDQA 3DFJA 4A1XA 3KIDU 2C3SA 4BANB 1HV7A 4D76A 3VB5A 1TPPA 4B75A 1WUNH 3K6ZA 3KL6A 2XTTB 1V2WT 2WUCA 1WV7H 3FP8E 3Q76A 1BTXA 1H8IH 1W10U 2VVVA 1ZMJA 3ZYDA 1ELVA 1IQMA 1SGIB 1OSSA 1O2JA 2A5KA 2OINA 2VWOA 4LOYH 2ESTE 4UFFH 1QGFA 1HJ9A 2IJOB 1ANEA 1DOJA 2WPMS 3AAVA 1DICA 4LZ4B 1C1QA 3TJOA 2G52A 3PYHA 1GG6C 3IWMA 3GY6A 5FCKA 3GY5A 4Y10E 2ANYA 4GVUA 3ENSB 1BTUA 3LGTA 1Y3XA 1CGIE 1D3PB 1O3DA 2G00A 3MMGA 5SGAE 5C3NA 3QUMP 2A31A 7GCHF 1O2SA 1BTHH 5TCCA 2JKHA 3ZZ3A 3Q3KA 1ZJDA 1O2HA 2QGRA 3TH4H 1DUEA 2AEIH 4FVDA 1IHSH 1PQ7A 2V35A 5GPIB 1PJPA 4SGBE 3VFEA 1O2VA 4X1PU 1K1LA 2HNTF 4TWYA 3UOUA 2AIPA 3U8TH 2BY7X 4D8NA 4CRGA 2ZGJA 1SI5H 4DT7B 3CENA 1YPJH 3LH3A 3EAJA 1XVOA 1EZUC 1MQ6A 3SGQE 1A3BH 4ISIH 2GCHF 2THFB 8GCHF 1T8NA 3KNXA 4K3JA 1RD3B 2PV9B 1KLIH 4CR5A 1O3BA 3LOXA 3GOVB 5F03A 2Y5HA 4WMEA 3MTYA 1QL7A 1DS2E 1ESTA 5CE1A 2VWNA 2ZIQH 1MBQA 1MKXH 2RA3A 2ZHEH 4AFQA 2XBVA 3RXLA 1BCUH 2K1QA 1QCPA 2VWMA 1LCYA 1WAYB 3QZRA 3BSQA 2ZFQH 1DVAH 2ZU2A 2ZU5A 2R2MB 1S6FA 1W11U 2DE9A 1UVTH 4X2VA 3NCLA 2BDBA 4I7YH 4WH6A 1TQ7B 1ANDA 2QN5T 1G3BA 6ESTA 3KQCA 3MFJA 1YF4A 1Z1JA 1A5IA 4JK5A 1TA2A 2C8ZB 1ELTA 1TBRH 1O5BB 2B8OH 3RXSA 1RFNA 1O2IA 3RU4D 1BTZA 3SU2A 3O8BA 1XUIA 1O3MA 1C2JA 3MO3A 1GHWH 2FTMA 2W7UA 3SQEE 1K1OA 1FNIA 1K21H 1TAWA 1HPGA 2A2QH 3PTBA 2Z9GA 1H8DH 2XXLA 4MDSA 2TGTA 4AB8A 2O8MA 1N8OB 1M9UA 1GBJA 1YP9A 1EJNA 5HYOA 1ZSLA 2Z6BD 1P57B 2Z9JA 2C4FH 2AS9A 1FAXA 1AVGH 4ABHA 2EEKA 4CRFA 1SQAA 2ZU3A 3SU6A 1P05A 3M5OA 7GCHG 3VEQB 4ESTE 1CT0E 4DY7B 5FAHA 4GHTA 1SHHB 7LPRA 4K8BA 4NGAH 1LKAA 2VWLA 5GWZA 4DIIH 1YCPK 3SGAE 2FP7B 1TA6A 1VJAU 1HLTH 5DP8A 1YGCH 1LO6A 1QIXB 3MH7A 1NFUA 3SV9A 1FUJA 1KLTA 1GI5A 1O2UA 3W94A 1Z6EA 1O5EH 3RP2A 1ZGIA 1MTNB 2FIRH 1FDPA 4UFDH 2J92A 1SVPA 3W95A 8GCHG 1AE5A 1OWEA 4ZKNU 2FEQH 5IDKA 2CHAC 5C5NA 3NXPA 3LONA 4D9RA 2GMTC 3ATWA 5C1UA 4MNYA 1LPGB 1WQSA 4Q7YA 1NRNH 2TPIZ 4KTUA 2C93B 5TCAA 5DP9A 4X8UH 5DK1A 4KP0A 5A0AE 2PKAB 1PPBH 4INHA 3O8DA 4KGAA 1YC0A 3EA8A 2A4RA 1NO9H 2VH0A 1V2JT 2W5EA 1L0ZA 1GBMA 1UHBA 1J8AA 1YKTA 4AORA 1DDJA 1KTSB 1BTPA 1BTYA 2ZC9H 3FFGA 1YYY1 1TALA 1YPHC 2BD2A 2VB0A 5T3HA 2TRMA 3RU4E 3SHAH 3KQDA 3A8CA 1C5XB 2F9BH 3BTDE 1V2UT 3SQHE 3GY3A 4K1SA 1GGDC 3M36A 2VGCC 4Y8ZA 2D26C 1J15A 1GI1A 4OGYA 1Z8JB 1KXDA 1TBZH 4Y79A 4I8LA 4ZKRU 3M61U 2VIDA 4YLUA 2HPQH 1WU1A 3URDA 1ZOMA 2BDHA 5ETXA 5A2MH 1UMAH 1WSSH 1O2ZA 3F9HA 5DP4A 1F0TA 1ZTJA 4BAOB 4Y7AA 5EQSA 1V2ST 2FTLE 2GDDA 1O3KA 3NWUA 3ZV8A 3TGKE 1YPKH 1EP6A 1WYKA 1SBWA 2BY9X 4OS1A 3A7XA 3VB6A 1FY4A 1CA0B 3M5LA 3TJVA 1UK4A 1LHEH 3T26A 2F9VA 3R3GB 4MPVA 2QIQA 3ATKA 1G9IE 2ULLA 1K9OE 2BMGB 6GCHG 3TVJB 2QCYA 2BY5X 2F3CE 2Z9LA 4MVNA 1GJ5H 1THRH 4UEHH 3GDSA 3U69H 5L2ZH 3F1SB 2ZNKH 1TPOA 5FBEA 4TWWA 2BDYA 2XCFA 2FYQA 2ANKH 2O8UA 1FY1A 4XBCA 2RDLA 1SGEE 1O2RA 3I77A 3QK1A 1ACBE 6LPRA 1EP5A 1ZHMA 5GIBA 1GI9B 1FIWA 1GHXH 1ZPBA 1DWDH 2QF3A 4YLQH 2IOTA 1V2RT 4X1SU 2FOFA 1YPHE 5EODA 3N7OA 1P9SA 1P04A 2ZKSA 2FOGA 1Y3UA 1O3IA 3AAUA 4YOJA 2FI4E 2QY0B 2BD9A 3SNDA 2GZ9A 1LQDB 1TMUH 4F4OC 1SFIA 1A46H 2XBWA 4UDWH 4VGCB 3K6YA 1SB1H 1HIAB 3DT0H 1PPFE 2GT8A 2J95A 1CQQA 4MLFB 4ZHMU 4YT7H 1RTFB 4BAKB 2CJIA 2XCNA 5PTPA 1W12U 1KY9A 3RLYH 2YNAA 4O3UA 3PLPA 1BHXF 3SNCA 3RXDA 1AMHA 3GDVA 4K1TA 2WINI 4ABIA 2XRCA 1O5AB 4IMZA 1XM1A 1TYNA 1S0RA 1D6RA 2G8TA 1O30A 1DM4B 1OWIA 2GT7A 1L4DA 4FU9A 3MO6A 2Y5GA 1UVOA 1BA8B 1EZSC 1GJ7B 1PQ5A 1UTKA 2ZHFH 3BIUH 3STJA 2P16A 3TH2H 4CHAB 1T8LA 3C1KA 1P2JA 1SC8U 2PLXA 1ZSKA 1EQ9A 2BLVA 1IQHA 2QXHA 2BLOA 2HLCA 4BNRA 3VXFH 1AHTH 1FONA 1C4U2 1ESAA 8LPRA 1MMJN 1HAOH 1OWDA 3MO9A 2G81E 1ZJKA 2O8LA 4KTSA 2RG3A 1C5TA 1W8BH 3RMNH 3TJNA 1LQEA 3SUFA 1AUTC 7ESTE 3QTOH 3MNBA 1BBRK 1TX6A 2OLGA 3A7TA 3ELAH 3P8FA 3B8JA 1N6YA 4O3TA 2FI3E 3SNBA 2A5IA 4WY3A 1BB0B 3GDUA 1QY6A 1W13U 1BOQA 1RRKA 2HVXA 1VZQH 2ZZUH 4JZIA 4KKDA 3TITA 1ID5H 3NK8A 4CRCA 5DG6A 5DP7A 3AASA 2RCEA 2ZGHA 3T28A 2BD3A 2VIOA 4NIWA 5EPNA 2OQ5A 1C1OA 4ZUHA 1HNEE 2ZFSA 1GHZA 1RXPA 3UQVA 2H5CA 3UWJH 1PQ8A 1GHAF 2P3UB 2A4OA 2BB4A 1PQAA 1P0SH 1A7SA 1XUGA