1EB0A

Crystal structure of bacillus pasteurii uree at 1.85 a, phased by siras. type i crystal form.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
143
structure length
143
Chain Sequence
MVITKIVGHIDDLSHQIKKVDWLEVEWEDLNKRILRKETENGTDIAIKLENSGTLRYGDVLYESDDTLIAIRTKLEKVYVIKPQTMQEMGKMAFEIGNRHTMCIIEDDEILVRYDKTLEKLIDEVGVSYEQSERRFKEPFKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UREASE ACCESSORY PROTEIN UREE
publication title Structural Basis for Ni2+ Transport and Assembly of the Urease Active Site by the Metallochaperone Uree from Bacillus Pasteurii
pubmed doi rcsb
source organism Bacillus pasteurii
molecule tags Chaperone
total genus 39
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2001-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02814 UreE_N UreE urease accessory protein, N-terminal domain
A PF05194 UreE_C UreE urease accessory protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 1eb0A01
3.30.70.790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits UreE, C-terminal domain 1eb0A02
3I38A 2Q2GA 1GMWA 3L9ZA 1EB0A 1GMUA 3TJ9A 1NLTA 3TJ8A 1C3GA 1GMWD 3AGXA 3AGZA 3AGYA 1EARA 2HFVA 4J80A 2QLDA 3NXZA 2B26A 3NY0A 3LZ8A 4L3KA 1GMVA 3TJAA 3LA0A 1XAOA
chains in the Genus database with same CATH superfamily
1DTQA 2HQCA 3E01A 2EK6A 4B17A 1C0UB 2DR6A 1Y10A 3RAXA 3HHLA 4OZ1A 1SI9A 3MCOA 4G65A 1IR0A 4LF4J 4OZ3A 3DOLA 3L09A 1JJCB 2IVFB 2F8MA 4CLKA 4DQQA 2V5HG 1FRMA 2X51A 3FEZA 4DCPB 3NAHA 3AGYA 3BDEA 4U7UK 1QY7A 3VCDA 4AE5A 2Z58B 4CO3A 4LIWA 2XMKA 3OW2R 1YQHA 1NCLA 4C4WA 2OD6A 2LXIA 3D4JA 2CPYA 3DI6B 3WBZA 3IRXB 3RZAA 4RW4B 4H4KC 3DRSB 2W2OP 1IQZA 2EKYA 3VQSA 1Z2ZA 1NZAA 3BKFA 4UOCA 3N0VA 1IKYA 2XZTB 1VQOS 4ZVHA 3LPYA 1APSA 1WOPA 2FQQB 3PW2A 3QGPA 1CC8A 2QYGA 3BGRA 1T9VA 2QSFA 4GC7A 4MTPA 2XLJA 2MDAA 2YX7A 2EWHA 2DCUB 4WF9Q 1ZBTA 1UFKA 1FXLA 4BWMA 2A10A 3GIMA 2K7KA 3GIKA 5L9XA 3T1HF 3NOCA 3BR9A 1RJJA 1K0TA 4OX9F 1S6OA 4PQUB 4DUTA 2Z2MA 2W9BA 5E0OA 3A1YG 3RRKA 1C1BA 3UN5A 1RSCA 1WUUA 3JTOA 4KC5A 2CPDA 1UVJA 1QAIA 2ASJA 2MZQA 3LANA 1EQMA 2LMIA 3RBXA 3M2VA 1UWBB 3N5FA 4W90B 3R7SB 3IM9A 5B0EA 3HF5A 5A0YB 1WWHA 4IO9Q 5LMNF 3D6FB 1RTIB 2BOPA 4ZVSB 7AT1B 3MAQA 1HBOB 1VDHA 2MZRA 4C8MA 3OV7A 2WHOA 3P6YC 4F3MA 2GVZA 1BQXA 5CYJA 4QWDA 2G2ZA 5E7OB 2OELA 1Q79A 3A4TA 1TL1A 2AX0A 3M9MB 3KLIA 4O3NA 4J7CA 5K8OA 2OMOA 4ED8A 5KFDA 2RDDA 1MROA 3OTBA 3UR0A 4NXMF 2D9PA 3QO9A 3AJ2A 2L9NA 3R5BA 2CQIA 4DV3F 3I96A 4NZ7A 2MKKA 3GMGA 2MHNA 1U6BA 5A8RA 1U1OA 2HGLA 4G1QB 2DR5A 1WEZA 5D0HA 4DV0F 2JEGA 1HWLA 4I67A 1N36J 3RW7A 4ECSA 3CJKA 1YG0A 3C46A 5ETMA 4X64J 3CCRS 1N0UA 3MI7X 4Q2MA 3NGRA 2RH3A 3M4XA 3ZTPA 4WP8A 4AUKA 4KHRA 1C0UA 1NU4A 1K1SA 3K5PA 3QT6A 4M5IA 5BYRA 2F5GA 2NXJA 1NK6A 4NOHA 2L9WA 5CD4H 3A13A 4JI6J 2VA3A 5E3PA 1YI2S 3HD2A 1RA6A 2ASLA 2I38A 4F04B 4USUA 4YQWA 3KNGA 5D6GA 3OTOF 3NP5A 3KK2B 4DQIA 4PXEA 3KHHA 2OMLA 4KGXB 1J2VA 1H2VZ 1B0VA 3TA1A 3LPEA 2FLPA 2BRLA 4USVA 3OLBA 4RU2A 5CD4A 1HNZF 4Y2IA 3ENVA 1P1LA 3IRXA 4RW4A 3DRSA 3CMES 2Z2LA 3IBFB 1IN0A 1H2UX 2RDJA 2BE9B 2CPZA 4KGVB 2OKQA 1HNXF 4USKA 1U1MA 1HHQA 2QFJA 1RI7A 3MCSA 6AT1B 1X0FA 2NCKL 5DG9A 4URGA 4CCHA 2LLZA 4NCGB 1RKJA 3DLKB 2XM3A 2HG4A 4IOCQ 2ASDA 2UUWA 3P49B 4A8MP 3IR6B 4DF4A 2JLFA 3MEGB 4J9PA 5CXTA 2HVEA 4DQPA 4QQBA 1ZAVA 1JJHA 1S0OA 3HMJG 4QIFA 3PKYA 3T5HA 2ZBQA 2R7RA 5DDQC 3V5RA 4IG3B 1PJ5A 3AOBA 3LGNA 3CIMA 5CHCB 2JSXA 4CYUB 2M88A 1RADB 2OPPB 5A6PA 4RW9B 4DR4J 4PQUA 2CZVC 2YXLA 3CDUA 1DLOB 5ITHA 4LVNP 3HLUA 5MAOA 3LWLA 2VOOA 4K4YA 3OBIA 3ICLA 1U1LA 3G6YA 1RZMA 3FBCA 3PHEA 2HNZB 4EZ9A 3D2WA 1KC8T 2IM1A 1UWBA 4OL8A 2X1GA 3AB2B 2YH1A 4RO0A 1CJUB 5HJXA 2MQ8A 5A0YA 2BJ1A 1XMOJ 3EVMA 2AKWB 1T03B 1RTIA 2GMHA 3VAKA 5BR8F 1HBOA 2VG7B 2QX0A 3EWGA 2HBZB 2DKOB 3VAJA 3HSJA 1YBUA 4R0JA 2VFTA 1XJWB 1J27A 2VB6A 4WU2A 5T41A 2B6AB 4C8YA 1PCAA 4HI2A 2V9KA 3U7JA 3IN5A 3K8VA 3LA0A 2OHDA 3BGUA 2VF3A 3GILA 4JI8F 4X4PA 2YNFA 5AXLA 5F8GA 5IC6B 2JFKA 2NSCA 2NSBA 2B5JA 3D6MB 1QTNB 3QWUA 3IMQJ 2E7VA 2G0CA 2CQHA 2AW0A 4GKJF 3AAWB 2ERRA 2FJAB 3QIPA 1WNEA 3SSQA 5KFEA 3RR7A 3FC9A 1TL7B 4YY3F 1ZAXA 3Q24A 5KFBA 2QA1A 1YVFA 3P8BB 1N54B 2ZKTA 1T9XA 2LVWA 2HWHA 5GMKa 1YSJA 5I3UB 1FKPB 4CIOA 1MN9A 1PSDA 2Z30B 3NS6A 4ZMMA 2IDEA 5C24A 2GJFA 3W3SA 2FHOB 2FGCA 1W25A 2C3OA 1WOOA 2R7SA 1WACA 2DPJA 3KK2A 1PG5B 3M05A 1U09A 1GMWA 3QT5A 2ADBA 2BUNA 3HSDA 2RQ4A 1B3TA 1N6QB 2JLGA 2HHUA 2GQQA 3QJPA 3T41A 4KH1B 4QPTA 3LGHA 5LXYA 5KFJA 3IAM9 3EXCX 3MTJA 2ZHAA 2V34A 4YB5A 2MMYA 1F1BB 2NS1B 5DETA 1YJ9S 4USMA 5H9FK 4MJKA 2DIVA 2OPQB 2G2YA 1H0HB 4NCGA 5KFWA 3DLKA 4ANDA 2BQ3A 1NO8A 3FUYA 2KU7A 5L1JA 1P6TA 1IKXA 2C2OB 1H3DA 5EGYA 3TI0A 4OMFG 1REVB 1U6ZA 3NNAA 4RUAA 2W8KA 5F9NA 2WB4A 1WG4A 2XMAA 3GV5B 4MYTA 1SKWA 5KFAA 2ZDOA 1FI4A 4RL1A 5BXIA 4IG3A 5T7LA 2P6SA 4KPYA 1KQGB 3KHGA 1QVGR 3KOAA 1NJYA 1F5CA 2VUGA 2QIFA 4CYUA 4WFNQ 1TP7A 1FA0A 2OPPA 4RW9A 4CO1A 4IUFA 4RU9A 2F40A 1DLOA 3ENAA 2NXCA 2HFVA 2IPOB 1CS4B 2Z0GA 4CLFA 2C22A 4DR5F 2UUAF 2GX8A 3H59A 5KFPA 2HNZA 1RWOB 3H4BA 1EZZB 3N01A 5J2PB 1RHRB 2O01C 2V8PA 2QLDA 3KUHA 3ZO7A 1JKHB 2X1BA 1XMQJ 1CJUA 4C3KA 2YKOA 4ZLNA 3D54A 3EDRB 1NK5A 4QW9A 1T03A 2HFSA 3MMJA 5HO4A 3KMQA 2VG7A 2ZOMA 1ELOA 4MIWA 2DPIA 1SJQA 1VISA 3QGGA 3G8SA 3KJNB 3HFKA 1DQ9A 5JUMA 2B6AA 4UZCA 3QLHA 4WE1A 2DYAA 2W2MP 2YBVA 5C25B 3MPVA 3MPWA 3IP0A 4F50A 3QGHA 1U1RA 1R89A 1IBLF 3H2UB 1AFIA 2DGQA 5DDOC 4C0BA 5KFGA 3CULA 1NJXA 3I9V9 5B7WA 2OPRB 2BJDA 1Y00A 1RCXB 3ELHA 1IWAA 1TL7A 1SJFA 1UTAA 1K44A 4JI0J 4JI4F 2HZCA 2CA9A 1U6FA 1RTJB 2OSRA 1GXTA 3BF4A 5DGBA 3K0JA 4EK2A 1TK8A 4Y0FA 4JI7J 3KJFB 2UUBF 2EPIA 1QM9A 1QUVA 1PYTA 2OO4A 2D3ZA 5DQHA 5I3UA 1FKPA 2HS0A 3CD5A 2DNNA 3FK4A 1ZZFA 3MOZA 4OI3A 1HQEB 1C0TB 3LH2S 2VPWB 2VH7A 1RU2A 1NPKA 4RNNA 3TZYA 3X1LB 3MAAA 3FJ2A 2VPXB 1TMJA 2HFOA 3TVYA 4JYAF 2DNGA 5KFUA 1XERA 1TKXB 3KK1A 2CJ9A 3NY0A 4X2BA 1RDRA 1NSKL 3DNCA 2FHMA 3QFWA 4PABA 4YP3A 2QSWA 1N6QA 2MHEA 3OHBA 2KYZA 3D67A 4USHA 1HMVA 1AA1B 2IMOA 3T1YF 3LP2B 1V5IB 4CLYA 4FPIA 4PPDA 3DLJA 4K0KF 2DY9A 3SCLE 2YKQA 1VJWA 1RCOB 3R5GA 4CM2A 2FHJD 3V6HA 3W1YC 2OPQA 5F8HA 2XB2D 2CYYA 3PRBA 4OI1A 2ASYA 1RBOB 1UEKA 5HAOA 4NASA 1RQ0A 2AJ4A 2BX6A 4TU7A 2ZH7A 4ZIVA 2AJ1A 1REVA 4Q8FA 4WIQA 1T9UA 3MR5A 2GCFA 2DH9A 5D77A 4Z37A 3TOQA 1EETB 1O51A 3TAQA 3EGNA 3E8OA 2R8HA 2WBMA 5JMNA 1A9NB 4LRCA 2YVSA 4RWXA 1KQKA 1IM6A 4P2FA 4OLPA 2OI2A 2OPSA 3MMBB 1NK4A 4ED2A 5IV4A 3R2DJ 4LRAA 1HLWA 4DR2J 3ZZZA 2DR7A 1NKBA 1R8CA 1WEXA 1CS4A 3VZIA 4KV8B 5AJ3J 4ZOSA 1LEOA 3OFHA 3LP1B 4KGZB 2GO9A 5D8HB 2DRAA 3DRRB 2WCXA 5KT7A 2HHXA 3HM9A 5KFXA 4Y00A 4KE5A 5J2PA 1KN6A 2M3DA 1JKHA 3WC0A 1H74A 3M6UA 4KGMA 4HL9A 4ZPTR 4RLEA 3EE3A 2KH9A 2NPIA 3O1LA 1HNWJ 4PEOA 3T5JA 2MKHA 2HIQA 2DR9A 1YIJS 1FVSA 4OX6A 4OZLA 4WFYA 2PT0A 1P9YA 3RRHA 3CT9A 2Z2YB 1X5PA 5C25A 4H4OB 2CZ4A 2DISA 3BQ2A 2B9WA 1ZZNA 4CZCA 5KFIA 1NK0A 1UA0A 1FKOB 2QL9B 1GTHA 3H5YA 5IFMA 2HHPA 1EHWA 2ZEJA 1U26A 2JH3A 4KR0B 4Y6IA 4V19J 4QIWD 2M7SA 5F0WA 3HD1A 2WVDA 1WKLA 4J9OA 1JNRB 2BKPA 3TUZC 3ISNC 3DLHA 2DITA 2J9DA 1R8BA 4QIVA 2XY6A 1RTJA 4IH7A 1IKWB 1A7GE 1ZM9A 3M32A 1TK5A 2CJQA 1V6HA 1X4EA 4FKXA 3SYZA 4LF7F 1U0HB 3ITHB 5HLFA 3W65A 3BN4A 4LRFA 2ZZTA 2HLUA 4P75A 1HQEA 2AYEA 2OEMA 1RWUA 3D0IE 1C0TA 2MEWA 1CJKB 4N8NA 2WAQD 4DEZA 1NKEA 3H20A 1TQLA 3HVAA 3D3BJ 2Q6BA 3TZZA 5GAHU 3QZ8A 2CQBA 2LDYA 1B64A 2W7PA 1OYDA 3J81U 4DPYA 1K73T 4U95A 1M90T 4NLVA 3LP2A 5HQLA 1NLTA 1H72C 5HN0A 1YTYA 2CPXA 4C11B 1RT2A 4KO0B 1YZ6A 3OUYB 2AGPA 4P6QA 5E3AA 4BC7A 5K8MA 4UOHA 2IVYA 2N7YA 1BUXA 2JVRA 3MEKA 3WQPA 5JVHQ 2RQMA 4B9UA 1F9FA 3TYTA 2J8SA 4NEYA 4EO6A 3H98A 3FMWA 1M5OC 2J7KA 4MKAA 1EETA 3N5BA 3VTIA 4DS5A 2J5AA 4TYBA 4RZRA 5F0UA 2FZCB 2UXDF 5CYMA 4MAKA 4A8SA 2CJBA 4OQJA 3I0SB 3UPFA 5IOLA 1N34F 4OX9J 4O0IA 4F0MA 3MMBA 4NMXA 3OTCA 4CTAB 4FXDA 1Q16B 3MD3A 1VLYA 3W5XA 4X4TA 2GFFA 1WSVA 4KV8A 1UW4A 2IBOA 3TA0A 1VQNS 3MMAA 2GS8A 3LP1A 3GYGA 1JB0C 3CMQA 3DRRA 4LFAF 6FD1A 1QTMA 2FUG9 2Y1LB 2AGOA 2D3OR 4QIEA 4KGKA 3CJ2A 1JLFB 3DOKB 4OI0A 3H90A 5LMNJ 2FLLA 1KTVA 1FDDA 3F0NA 5DO2A 1HW9A 2PEBA 5JJBA 3FSIA 5KG7A 2Y3YA 4LSLB 3DDIA 4CRJA 3T6JA 4YB7A 4IO1A 1U2CA 4PWWA 3M8SA 2NYIA 4NXMJ 3E2EA 4HACB 1ZA2B 1CG2A 1RT4B 3NEKA 4DV3J 2AZ3A 3M8RA 4TKTA 2E7XA 5GVQA 5J1NA 3OVBA 1J5EJ 3WHIA 3G96A 3KNAA 2FIUA 2HNDB 1WELA 2ABYA 3MM8A 2J0WA 5SZTA 2HHTA 2BQUA 2FZKB 1GXUA 1IKWA 1TL5A 4I6WA 1VQMS 3T5LA 4IH6A 1XNQF 1G7CB 3LW5C 2MXYA 4WZQA 4WYWA 3I6PA 5A8KB 1XR7A 1HHTP 4DDFA 4ZLJA 1U0HA 1UWAA 1HYSB 2WVCA 2ZH5A 4RW6B 1WEYA 1PAEX 4O3QA 3HVTB 3J7AN 3ONQA 2K2PA 3GLJA 4CLLA 3LF0A 1K1QA 4ES3A 1CJKA 1CJVB 3KLFA 1ZOTA 3K89A 2V4RA 1S5ZA 3OTOJ 4J9NA 1FDBA 4M8LA 1N8RT 4DL4A 3GFHA 1LWFB 4P7VA 3IM8A 4M5MA 1FHTA 2C3YA 5FLXY 2HQFA 1ZM2A 3AXMA 4A48A 5B0CA 3TVKA 2I9SA 3DRYA 4NA3A 2H1YA 1Q8IA 4OJ3A 4OX8A 1HNXJ 2F4VJ 4WU3A 1NLKL 4KO0A 3OUYA 4B02A 4D3GA 4O4GB 4HDHA 4QBUA 2JNJA 2Y1RI 1N4LA 2W9AA 1X4HA 1BC6A 2Y1IA 2RUGA 4DF8A 2OGUA 1X4FA 2JC1A 1VRTB 1I94F 2AYMA 4AQYF 1T02A 4WPAA 2IDLA 2N3OA 4LF9F 1EJ7L 4NLGA 1GFWB 5ETKA 5DLFA 1DURA 4R5PB 2ZH3A 2UVRA 5G0RB 4RJVA 2BW7A 3NCRA 2HHQA 4F8RA 4X65F 3R5JB 1G4CA 3OVSA 4C98A 4ID8A 3BB5A 3I0SA 2W7OA 1UEUA 4K7QA 2B7BB 4DV4F 1AT1B 4WFAQ 2FDNA 4ZVRB 3TARA 2N82B 5HANA 4CTAA 4ZDNA 1DTTB 5KG6A 4UTGA 5KFLA 1RHKB 4TN2A 5L1IA 1UETA 4FS2A 2RB7A 4CO5A 3PO5A 4DSFA 4DCJB 1U1QA 3KLHB 5D3GA 5KT3A 3N6MA 1HR0F 4KHPF 3PX4A 2NZCA 4I64A 3TVZA 4NE9C 4DU8A 4LSZB 1Q95G 5M2RA 4LUBA 2GMJA 1S10A 1FXDA 2Q79A 3DGPB 3AODA 5BR8J 1R0AB 4BBYA 5C2CA 1Y5LB 4EO8A 3CJQA 2A1BA 2WSFC 2XULA 1RKIA 4OYAA 4L74A 2BQRA 4LSLA 2DBBA 5I4MA 3NWRA 4DU7A 4NLXA 2ZJPQ 4X4NA 3AXKA 1WHWA 3CCWA 4PUOB 4JI8J 2JEJA 3CTRA 4HACA 4DV7F 4DR3F 2HPUA 1X9MA 3L95X 5DM7Q 3J80U 2AJQA 1FK9B 1OY9A 3WZ0A 4GKJJ 2DNMA 2J9EA 4RR5A 5RUBA 3IG1B 4YY3J 1S7HA 2HNDA 3DCAA 2EC0A 2ZE2B 4HT7A 2W01A 1TVRB 3ZZTA 3RU0A 2VDIA 3CJRA 4OHYA 2XMWA 1P8GA 5A8KA 1R8AA 2XSFA 2QFIA 2YPZA 3NRBA 1WC6A 4RW6A 4AL7A 4J9LA 4DL3A 4XO0A 1GTEA 2HAIA 4F4YA 2XG8A 1CJVA 3V6KA 4ZVEA 1HIYA 2C2DA 1WTFA 1FJCA 2UXBF 2XLIA 2BE2B 4F4ZA 4MKVA 1FRIA 4C48A 1KBRA 1E6VB 3ILIA 5F3TA 3TP2A 2BDPA 1LWFA 4F2RA 5F8MA 4A8KA 4NLSA 4P9SA 3EZ5A 4LBHA 3NGKA 4H4KA 5D4NA 4NI2B 3O3LA 3JSRA 4TNOA 3BR8A 5IC4B 1HL6A 2MPUA 1NH8A 2EK1A 3DRXA 5E41A 3HFZB 1S97A 4O4GA 3TANA 1QJHA 1S9GB 1ZTTA 3D6TB 5KG4A 2OIHA 4E98A 1SBRA 1CVJA 3CDEA 4FYDA 1UP1A 1P1TA 2HYIB 3NXZA 1VRTA 1RAIB 4RNHA 4JV5F 3NMRA 2ZM6F 3SZ2A 1HI1A 3QT8A 2N4DA 4PCQA 1GQEA 4R5PA 2LQ9A 1SH0A 3CCQS 2ADCA 5G0RA 3KLVA 5J2QB 4M5LA 3CJ8A 2IM0A 5CAAA 1XMBA 4OJ1A 3IWLA 3Q22A 5CZVA 2ATCB 3FSYA 2UVVA 5MLCV 4ED0A 4OZ0A 3H4DA 1FRJA 3KFWX 4PG8A 2AQ4A 2KFNA 2CJYB 1F9HA 3T3FA 2LEAA 1S0NA 4YUDA 1QLNA 1OPIA 3M8YA 2YKPA 1DTTA 3OD2A 2VQFF 1UW9A 3GSDA 1T0TV 4LIRA 1D9DA 5GAHI 4DR5J 1J5OB 1AROP 2UUAJ 3OL8A 5LL6d 4A46A 4M5GA 5F8IA 3KLHA 1BY9A 5EX0A 5IQQA 1UFWA 2FC8A 2MSTA 1OQ3A 3PTWA 1FEHA 4R25A 4MK8A 3D9BA 4IR1A 3CJ4A 4RWWA 2LXFA 3ZZYA 3OT9A 4PWDA 2NLWA 1WG1A 1U2RA 4WTOB 3EPIA 1AXQA 1R0AA 1UPMB 3H5UA 4ZVOB 3FQLA 1WF1A 2HQGA 3NOGA 2AX1A 4TY9A 3ETMA 4J91A 5DGAA 1VCTA 1FJEB 2HMIB 4Q44A 4PUOA 4QR0A 3K5MA 4OV1A 1RAHB 5HROB 3IBCB 1IBLJ 2ATLA 3SSSA 4JB8B 2WW8A 3MF5A 1XBWA 4DL7A 4QU6A 1WI6A 4RUBA 5D78A 1FNMA 4Y2CA 3HHLC 2JOQA 2UVWA 4XPEA 4USIA 1D9AA 3IG1A 3S7RA 5ETRA 2KM8C 2J0SD 3UQSA 5C5JA 4A4JA 1V9OA 1RK8A 4C8ZA 3A3OB 4ECRA 3EJMA 1TVRA 3KJVA 2MY7A 3CCJS 2YQ1A 2YQ3A 2UUBJ 4X62F 1UMJA 4K8RA 4L73A 3W2WB 4C0HA 4LF5F 4ED3A 2DNKA 2CADA 3TQEA 4L3KA 4ZHRB 1RWNB 1TZ0A 3DLEB 3O5TB 4Q7AA 1UVIA 2VG6B 4N41A 3HT3A 3K59A 4EBCA 4DHVA 3PW7A 1IBKF 3BM7A 4JV0A 3CD0A 2V6AA 4KYZA 3KK3B 5E33A 4JYAJ 2M0GB 1VRUA 3UDEA 2P9CA 2MKSA 2KN4A 1E6VA 4U96A 2KT2A 1KTQA 3MPDA 1LFWA 4DI6A 1ZPWX 4CP5A 1SV5B 4JOUA 5CYQB 3T9ZA 2CNLB 2ZH6A 3RG6A 4NI2A 4RW7A 3T1YJ 3I56S 4H54A 4NPOA 1VBXA 2IFXA 1RHJB 3G86A 4TU9A 2U2FA 2QLWA 3ZTRA 4K0KJ 4J9RA 1FJ7A 4R8UB 2W4PA 4GKKF 1PYOB 1DJ0A 1KONA 3SCIE 1S9GA 2MTLA 4B9VA 4DSJA 3AQOA 2JHEA 4ERDA 5IT9U 1HBUA 3AGZA 3PM9A 2VFVA 3B4DA 1ZAWA 2QT7A 4PZVA 4MFBB 5J2QA 4PYAA 2B56A 4DSLA 2KZZA 1IR2A 2KO1A 4I4BA 2P9GA 3K5OA 1FTCA 4NLRA 2YY3A 4PG4A 4ZVGA 2NYHA 3BH7B 2XZWA 4WJBA 4JI1J 4CO4A 1JLAB 4X4SA 2CQCA 1NKCA 2CPJA 2IY5B 2R7UA 3HI9A 3V6JA 4U7CA 5ETTA 1RT5B 2ROEA 3MPUB 3NL0A 1RP5A 1U4BA 3Q8PB 2HWTA 2A3JA 4DPTA 3ISND 4B9NA 4ZIWA 1RXOB 1VS3A 3MECB 4GVLA 2BJEA 1J5OA 2KHCA 3CJSA 4QU7A 2VBZA 4PG5A 4B3RF 1N0VC 4OYMA 1KHWA 3C66A 4QR1A 2CUYA 3K58A 1LK5A 2KHDA 4B9LA 3K8WA 1PKUA 2BE7D 2ZH2A 1DY3A 7FDRA 4NA1A 4LR8A 1RT7B 2YKMB 4ECQA 3UCZP 1TKTB 2UXCJ 4QIGA 5B0BA 3Q8QB 4DXLA 3Q8UA 4UY8T 3PJWA 4K5RA 2YWEA 2B4VA 4O3OA 2UUCF 5C42B 4BS2A 1UJ6A 1XIQA 1Q7LB 4WTYA 5EUHA 2HMIA 3C3LA 4C8KA 4I69A 3ZXWA 2CKWA 3BKUA 5HROA 4NCAA 1TL3B 3SI8A 5AXKA 2UVUA 4AL5A 3CCMS 3CJ0A 1FNXH 3RAMA 1AFJA 3IBWA 1EIYB 1EP4B 2CAJA 3PW5A 4MIAA 2ZH4A 1SQEA 4U9RA 3A8IA 1DBDA 2PA3A 2DO4A 4K4ZA 4NYOA 3OHAA 1FVQA 5K8PA 3JTNA 4OYZA 1SQFA 1JLQA 3B54A 1YJWS 2BW2A 1UFLA 4LR9A 4LF7J 3W2WA 2XC9A 3EX7B 4P52A 1KLNA 3M2UB 1RWMB 3DLEA 2QLBB 2VG6A 2XYPB 3MHYA 5HMZA 1RT6B 2UU9J 1IR1A 3S6EA 1U24A 3D5MA 2HQIA 2CVIA 3KK3A 4KJIA 1FJGF 3FBEA 2XCPA 1OPZA 3UWTA 2OH2A 3TAPA 4FF4A 2VODA 5AXNA 4PG6A 1UVKA 1SV5A 3M1VB 5KFOA 5CYQA 1KD1T 1IJEB 1DTQB 2IJRA 1YK9A 3I31A 3PFEA 4LR7A 4ZJOA 5AE3A 3TO8A 3BZQA 3D3CJ 4FP9A 4R8UA 1YRUA 5KFHA 2PEHA 4OLOA 3AD9C 5B0AA 4QWAA 4KPCA 3X3UA 5G4DA 4EUVA 3GPAA 1SKRA 2M5YA 3PEHA 2PN6A 2DHHA 4NLOA 4DV5F 4DUYF 1DQ8A 4MFBA 2LXUA 2W4DA 3BYPA 3PACA 4C7QA 1X60A 2UXDJ 2AEFA 2FVPA 1ICEB 2BMBA 1N34J 2MGZA 4ECUA 1KQFB 1PO6A 3EZOA 4NEZA 2GQ2A 2Y8WA 5ETQA 1CQNA 4URSA 3TJAA 1RT5A 5DM6Q 3DU5A 5ETSA 2Y0SD 4QYZJ 3HDSA 4ZP8A 3MDFA 3MECA 1H38A 4CLUA 5IV3A 4ZK7M 4OYWA 1WTBA 1F9EB 2ZJRQ 4P2SA 3PY8A 1KP6A 4LFAJ 4ZJLA 3C14B 5AE2A 2DNPA 5GAGU 4R0EA 5A2QU 5JXSA 3NLCA 1VQYA 1U0SA 2KI2A 4ECWA 1PC5A 1WHYA 1N56A 3BQ1A 3ILJA 1NHUA 5KFRA 4NRTA 1ULRA 1TKTA 2H54B 4ANEA 4HHHA 3UE2A 1GNKA 2CJXB 4ZVFA 4YDXA 4FF2A 2MSSA 3V2UC 2DXDA 3HHKA 2KFYA 2KJWA 5C42A 2E1CA 3EGZA 1UVMA 4ELTA 2ILYA 2G4BA 5LMUJ 4LBPA 4EU0A 4C9DA 3AJ1A 1TL3A 3FGVA 2VG5B 4IH5A 2DK2A 3VGUA 4NYZA 1LQ9A 5AT1B 4OV6A 1S76D 3HSZA 2RU3A 1EP4A 2F8HA 3G2XA 2EFPA 1NHVA 1S9FA 2B9YA 4IG0B 4PRFA 1I6JA 2BVZA 2E5LF 1O8BA 4QCLA 4DR1F 4O3PA 2UV8A 4OHWA 4UQGA 4O23A 1TL1B 4QWCA 4CLZA 5AXMA 1XNQJ 1YKWA 2FLOA 5D0RA 3IGVA 4AFFA 3MZIA 2ZOFA 2M4MA 3M8ZA 1SCJB 4N77A 3QO9B 3I32A 1Z1ZA 2LYVA 2A18A 3EVOA 3F44A 4DOZA 4G3IA 4YN3B 1RA7A 4M94A 3AGXA 4B3SF 4LMZA 1NPPA 2RQCA 2C2ZB 2C3PA 2FD2A 1WC1A 2ZHBA 4CDIA 2W9CB 2QTWA 1VGYA 2DGTA 4M5JA 3SXLA 1N48A 3TWZA 1F2HA 1RT3B 3R5DA 2BV3A 1QSSA 4ZVPB 3M1VA 2BBEA 3W63A 2JRSA 4PXBA 3FCVA 3G8TA 2PMHA 4J90A 2CQGA 3W9HA 4YHHF 3D1QA 1XN9A 4XK8C 4DFJA 1GH8A 2PA8D 4HT5A 3U27A 2RRNA 2CQ3A 2H9ZA 3GSIA 3CCES 4FXWA 2HRYA 1FRKA 1I94J 3PW4A 4IFYB 2KYXA 4NXNF 4LF9J 2H51B 1N5QA 4M5HA 4C8NA 3QAUA 3MR6A 1F6TA 4UY85 1B4SA 1C4AA 1X5OA 3N6NA 3KMSA 2Q66A 1HFEL 3UDCA 3BSOA 1LKZA 1WOSA 3THTA 4F67A 4E2FB 3GONA 4KFBB 4QOTA 4YFUA 4ID5B 2R8JA 1S99A 3CWJA 2X1AA 4DV4J 3CC7S 4FDFA 3OTEA 3C16B 3QJLA 3IFEA 4A8FA 3PRVA 4N5SA 1N5VA 5LSOA 4N76A 4DMZA 1KS2A 2ZBRA 2V8GA 4L72B 4CLPA 1RTHB 2PSZA 4MK9A 3SQGB 4BHQA 4DN0A 1TUVA 3KG4A 1ZTWA 3MUVP 1S12A 4EI2A 3ZZOA 3C14A 1HR0J 2VV5A 1TR0A 4KHPJ 1BHNA 1TU0B 4OZJA 5I3QA 1I3OB 1BWVA 5KOXA 1B99A 1VC0A 3ENQA 3HULA 2VU5A 4GO5X 2EKNA 5L1KA 4HVZA 3LOUA 2VFSA 3MM9A 1S0VA 3RYLA 2FVSA 1MSWD 3FCHA 1G6BA 4I7FB 1S1XB 3KDOA 4ITSA 2OEKA 3DMJB 1KSPA 4PYDA 2AJ0A 3CD6S 1MWZA 4X64F 1WKJA 3W5YA 1CPZA 1N5YA 3R7BB 2F3JA 4F2SA 4DV7J 4DR3J 1WG5A 4ZP6A 3DLBA 3SCJE 2Y9HA 1NBEB 2VG5A 3A8KA 3VAMA 2XGQA 2GAHC 2YWWA 4NL5A 4FKYA 1S4FA 4ZN3A 3AA8A 5D4LA 1M5VC 4N8OA 4ETZA 5KFVA 4UQTA 3M6XA 4IG0A 2KVQE 2HBYB 4L6V3 4MKBA 5KTQA 2V2VA 2QA4G 2HVZA 4LF1A 2VPZB 1X8DA 2L41A 4DJBA 2M8DB 1VQ9S 4XAKA 5ADZA 2JDJA 1YGYA 3GR1A 4X4UA 2YNFB 2AWZA 1NK8A 2B5JB 4FNIA 3BBBA 1ZS6A 1UL3A 4NYPA 2AYGA 2F9DA 1W7WA 3QIPB 3Q8VA 4ED7A 4J9SA 4DSKA 1FWKA 2UXBJ 3KXDA 4QR2A 1OQ6A 2GZOA 2W9CA 2RE1A 1Q81T 2MZJA 4DX5A 2AJFE 1RT3A 1KR4A 1UVLA 3TAMB 3IGNA 4FNHA 3R7NB 2BYCA 3D1HA 1H7XA 2V0NA 3MM5B 4I56A 4J9MA 5C24B 2DRBA 4HYKA 3WX8A 2P2CB 1SUQB 3OR2B 3PKMA 4ED6A 4Y2KA 1SJ3P 2QO3A 3DC2A 3ZTSA 2QJ3A 3Q89A 2R8IA 1KVIA 4JV5J 3D28A 2ZM6J 1M5PC 4IFYA 5DLGA 2M70A 1GXLA 4TLRA 2WOMB 3C5XC 3UCGA 2JEIA 3NAIA 1NB7A 1DHMA 4USTA 3DHWC 3VWSA 3LAKA 3I38A 2GMLA 5F9LA 3B6BA 4DLGA 1NK7A 1L3TA 4LQ9A 4KFBA 2A2DA 1IQTA 4ID5A 1U1NA 2DIUA 1FTRA 3HHLD 1JJ2R 1X7VA 4NLYA 1FDNA 3OFGA 2R7OA 2MQLA 3C16A 1IKXB 2VQFJ 2LU1A 4B3TF 4F4XA 1RTHA 2JZ8A 2RIJA 3SQGA 2XMMA 4B9MA 3NG8A 1MMDA 2DRDA 4KBIA 1MWYA 5KT2A 4NRUA 3R3TA 3IAS9 5T7LB 5GAEU 2SXLA 3M6VA 2O66A 2D3UA 1FX2A 3MMCB 1NJZA 3R6GB 2GJ2A 1HBMB 2PIIA 4W4MA 3P3DA 2N4CA 1KFDA 5C7PA 3VAIA 2RHQB 1VRQC 3EPGA 2E9RX 3N28A 2GIFA 1CULB 3HKZD 1ZA1B 4I7FA 1S1XA 1VLOA 3TW0A 2ZWOA 3DMJA 3GQCA 3PYGA 2DHXA 2MLZA 4YEAA 2CVEA 5BJRA 3I4PA 5HI7A 3AY0A 2RUSA 4LT6A 5J2MB 1TKDA 4Y3CA 1LNQA 1M1GA 1R8HA 4ECZA 1EKRA 4OYOA 1VIOA 2XMUA 3AD8C 3IRWP 3L7UA 4UOFA 1V3ZA 2Z57B 1XNRF 1IBMF 4B08A 3M8QA 2E66A 1FXRA 3BYRA 2I6WA 1Q5VA 5CCLA 2XMTA 1GX5A 4WBFA 4EYHB 4NWBA 2ZBCA 3FFIB 4K5SA 3K5NA 2BEFA 1JLCA 4JI3F 1YJ7A 5CQGA 3QLHB 4WE1B 5FJ4A 4X62J 1SC4B 4DQRA 1NJIT 3HO1A 5GAGI 4LF5J 5HMXA 3GV8B 3QIDA 2WZ1A 2OSQA 1FFSB 3PDNA 4DZDA 1WHVA 1Y5NB 2XS7A 4MT1A 4F7VA 1MG7A 2R9LA 4K50A 1VK3A 4HH1A 2H4YB 3VGVA 4HLBA 4YR2A 3O2IA 2IRUA 4WXOA 3HFVA 2XCAA 2VBXA 4WK3A 2Y0BB 3MPYA 2ZH9A 1HNIB 4DSIA 1S7IA 1TTHB 2D1CA 1YZ7A 2OAUA 5I42A 4CWBA 1NB2A 3D6HB 3TAMA 1R0BG 2BM0A 4CNYA 1OO0B 3UW1A 4U67Q 4DV1J 2VIHA 1PJ7A 2XO7A 1Y5IB 3OSPA 3H8YA 3MM5A 5K5MA 4ED1A 4GKKJ 3PR5B 2R7TA 5IZHA 2HK3A 3PXGa 2M2BA 1FKAF 2DNLA 5LM7E 1SUQA 3OR2A 3A3NB 3MAAB 2XHCA 1BXNA 3V4IB 1U7LA 4NLQA 3RB4A 1S6QB 1N5TA 3KK1B 2Q2GA 5AE1A 2K3IA 1NNDA 4NA2A 4ZLPA 2WOMA 2J7UA 2AZ1A 1K47A 1R6VA 2EXUA 1RBAA 2GHVC 2ZKUA 2KL8A 3GFZA 1HMVB 1Q53A 3SV3A 4ES2A 4RX6A 3G87A 3J81j 4PR6A 1JLBB 3KG0A 3MXHP 4CT9A 3KYLA 1LXNA 4IDKB 2WVEA 4KSEB 5CH7B 1WDDA 1MMLA 2HIYA 3R9LA 1F0XA 1EX8A 5HJYA 4JUZA 3NKYA 1NEEA 2RMLA 4LQ3A 2BKOA 1Q78A 2A2CA 4A8WA 1NDPA 4DV2F 4B3RJ 2BA9A 1VQLS 2EG1A 3SDEB 5E2QA 4PG7A 4ZN1A 3GCWP 1R8PA 2M9KA 3PRDA 2GA7A 3MEDA 2W4CA 2OPSB 4FPRA 2E29A 2VONA 3MMCA 3U02A 1CBKA 2WB1D 1HBMA 1MNEA 1VQ7S 1V3RA 4ZITA 3KKFA 2XS2A 3ZZUA 2WRMA 4ZPDA 2G1DA 1GX6A 4O0NA 1CULA 1KWMA 1T9YA 2K7JA 2H5EA 3LTOA 1SL2A 1WI8A 2L08A 3J7A1 4UUXA 3JSBA 2QA2A 3N79A 2UUCJ 2BZ2A 1JLGB 3ZZPA 1RBLA 3O44A 1LWCB 3KJQB 1L3KA 5CA5A 5J2MA 4KY3A 2H5IB 5CCMA 1P9QC 4O44B 2X3GA 2K06A 1OJ4A 2WK4A 4QYZK 2BABA 2AEJA 2KM8B 2DHGA 2HHWA 2V2KA 2OP5A 4WP9A 3DOMB 2BACA 1B7YB 2XY5A 2QLXA 3QMQA 3SEOA 2J9CA 3DRPB 4BC9A 1VQ6S 3FFIA 4I6YA 3H2LA 2IYGA 1YJVA 4ECXA 4XPCA 4P72A 2KB2A 1SJ1A 1IWGA 3TUPA 2RRBA 3DKDA 4JI5F 4EGLA 1PYSB 3HJFA 1Q5YA 3CCVS 3TEHB 4C8LA 3BEGB 1G1XA 5E3QA 3AA9A 2G2OA 4HKQA 1AYEA 5K9FA 4DV6F 1R27B 1NSPA 3PNIA 2JJ4D 4N47A 3DDNA 3PX0A 4HI1A 1HNIA 1FO1A 2HVDA 2PFDA 4KKOA 1URNA 4U6PA 2Z8QA 3M32B 4E8UA 3LGMA 3W62A 2GGPB 2DVIA 5HLFB 1Q82T 3P45B 5DG7A 2ZNYA 1W2IA 4RNMA 3W8PA 4X66F 3W61A 2CIMA 3RTVA 2DO0A 2B9EA 1B0TA 5DDPC 3V4IA 2LQ5A 1S6QA 1GT8A 3LUYA 2GC8A 1WC0A 3TR5A 1JX4A 4W92B 4QJVA 4DUYJ 3QRPA 3W2VB 1Q86T 1M5KC 2LKZA 1TMMA 2JX2A 1JXLA 2B51A 2D41A 4P2MA 1Y7PA 1NUEA 3GWCA 4ZPAA 2DEIA 3MCMA 3A12A 3T5KA 1Q8KA 1RT2B 1D8ZA 3P5TL 4DFMA 1JLBA 1IVZA 2HHHF 1JLEA 3FNNA 4IDKA 5DS7A 2HLTA 4CO0A 3CB4A 2ZH8A 4Z7CA 1D3WA 3KLEA 4TXSA 2HNYA 4I2QB 2CQ2A 3BBFA 3J7ZT 1VMBA 5K14A 3I55S 1SC6A 1YDLA 3AQPA 4ZCLA 3ILOA 4ED5A 4DR6J 3SDEA 3CPWR 2CXEA 1SC3B 2AHOB 1S79A 4HHJA 5F41A 2HS4A 2E9ZA 2APOA 4IRDA 2Q3PA 3VF0B 5CYMB 1H6KX 2MKCA 4PXDA 2Z56B 4M5NA 3EDQB 2B8QA 2CG4A 2VHGA 3BO3A 1LXJA 3NNCA 3PJ9A 1HARA 2VDHA 2BR0A 1JJ4A 4FS1A 3D0HE 2HGNA 3IWNC 4JI2F 1IXKA 2B0GA 3CMAS 5HVHA 1I1GA 2R8GA 2VASA 1UZDA 1ZPVA 1RHQB 2X1FA 1SJ4P 3MMAB 1IKVA 4G1IA 1JLGA 2LQJA 3KDNA 1LWCA 3TNVA 5LOQA 4PAAA 4IKAA 2MLXA 2EBGA 5HSPA 3LALA 3C6EC 4FBUA 5KFMA 3EXYA 2PMWA 2HK2A 2RQKA 2DR8A 4O44A 3OJSA 3RBZA 4ZS6A 5F8NA 4J9UE 2PC6A 2X3DA 2J6TA 2FVCA 3H7HB 3B82A 4IOBA 3UDVA 4C8OA 2WSCC 1BE4A 3DOMA 4IR9A 3RB3A 2YTCA 4LF8F 2E5LJ 4DR1J 1BMQB 3GU0A 4IQMA 3DRPA 5L9NA 2I1RA 2OEJA 3NGSA 4OI2A 1UZHA 3BKTA 3I5AA 3IXQA 2ZVIA 3CE8A 1RABB 2HHVA 4NLDA 2IC3B 1GK8A 4F4AA 5GAEI 3THVA 2IRXA 4HR2A 4DPWA 2V4JB 5THWA 3N9UC 1FD2A 1FRHA 3K5LA 3HXMA 3JQMA 1Q4RA 2W2NP 4B3SJ 1F3VA 3CVKA 3CJTA 3GYXB 4AXIA 1U48A 2AV5A 4ZPBA 1XTZA 1VK8A 1FRXA 1TV6B 3MM8B 1EQ0A 1F5AA 3RUBL 2XS5A 4WFBQ 3PZPA 1SKSA 4NLWA 2F9JA 3MEEA 3Q2SC 3C19A 3GG1A 2GGPA 3I5CA 1MLAA 2MY8A 4K2JA 4YHHJ 1RTDB 5HQMA 2XI2A 2QYCA 2FB0A 3I0RB 3PYFA 3DLGB 2K1RB 4F26A 2IA6A 3CO9A 1ROFA 3T1AA 2KTQA 2FC9A 1HWIA 3KLFB 1KVJA 2CNOB 5KG1A 2CPEA 4ZCIA 4GVBB 1UPPA 5D0GA 4NXNJ 2RS2A 4P2XA 3BGFA 3BREA 4FVCA 1I5OB 4XTTA 3CC4S 3CXCR 4FN5A 4DCOB 2YNGB 3W2VA 2JC0A 3OXLA 1X9SA 2R42A 2ZBPA 3SBMA 1S57A 2GIRA 3Q2TC 2OTJS 3V6DA 1MWQA 3MURP 4K2XA 3JS9A 1OSCA 1X5TA 2A0FB 2EEYA 3F41A 3GJQB 1FWPA 3ZC4A 2RU9A 2ODXA 3ZFVA 1Y11A 3QJJA 3EGWB 1LOUA 4AT1B 3TUIC 1KNZA 4I2QA 3WC2A 3D68A 2O1PA 5EN1A 3SV4A 1V3SA 2B4OA 2F65A 3R27A 4DZ6A 2BOAA 3L7PA 3MAHA 5KT5A 2XBPA 3NS5A 2ZNZA 5GADU 2FJVA 1X31C 2R2SA 3A8JA 4O3SA 4KT0C 2D74B 2DEJA 2L3MA 3LP0A 2RHSB 3T1HJ 3PIOQ 3U1NA 2DGXA 4ZP9A 4F4WA 3JSMB 2PI4A 2UUTA 2VFUA 4LBIA 2E44A 1FF2A 4L76A 1J5EF 3DYAB 1OSDA 4ATNA 3R6LB 4M5DB 1RGVA 2GW8A 1S9EA 4WK1A 3SQOP 1YRTA 5E3CA 5D3GB 5FDLA 4JBCA 1HKAA 3ISZA 2XLKA 4P7TA 3SMZA 4CO2A 1BD6A 1AUSL 3QYYA 4IQXA 4Y34A 2PDAA 4XDCA 3POTB 1X4CA 2FJDB 2DGVA 3VQTA 2ZH1A 3K57A 4ILMA 1VYAA 2ZC4A 3LWMA 2G9OA 2PE8A 4Y65A 5HMWA 4OYPA 1NSQA 2QMWA 1PBUA 2COLA 3CDAA 4A8XA 1FESA 4DX7A 1U1PA 4CT8A 1FCAA 1NPRA 1Q0NA 2IC3A 3EZUA 1HD1A 1VBKA 2CWXA 2DT9A 4K4TA 3DI6A 2HFNA 2V4JA 1N32F 2ZOGA 2YQ0A 3BV8A 5IM0B 3QATA 3IC1A 5KOWA 2F4VF 1VQ5S 4DV0J 2HQDA 2W24A 2QGFB 2CG8A 1ZM3A 1U2FA 2H5JB 1TV6A 3QGIA 1HD0A 3RW6A 3H2VE 2B7CB 2FYXA 3JB9k 1SL1A 2C2EA 1A6LA 4Q0BB 4Q45A 1U02A 2NUUG 4I2PB 4LFBF 1QE1B 4OHVA 4ZLLA 4LSNB 3J7Z5 3OVAA 3M6WA 5ETLA 3DHXA 1RTDA 3KLGB 3MOJB 5HK4A 1EAYC 4PKDB 3I0RA 3DLGA 3UR3C 4AD6A 2YH0A 3FEXB 2K1RA 1FE4A 1FWLA 2YWFA 4UW2A 2I0XA 4EWTA 4FYYB 4X4QA 4GVBA 2VQEF 3KUGA 2P6TA 1RT1B 1FRLA 3TX8A 2EFVA 1SB6A 1HNZJ 2YNGA 3J81Y 2EFOA 3CDWA 4LFCF 2XYGB 3JSYA 2DGWA 2DNZA 4CI0B 1TUGB 1NRKA 3KHRA 2EVZA 3CGIA 5IXUA 5IQ6A 3UDLA 2NXUA 5B0FA 2CPHA 4ZPVR 3PHTA 4C97A 3AD7C 2QLFB 1U8WA 2HSEB 2J6UA 4GO7X 3TZXA 4UZBA 2UP1A 2VICA 4JP8A 3BSNA 4B3TJ 4XIUA 5DDRC 3OLAA 3BS9A 1Q8LA 2NXEA 7FD1A 1WF2A 2PI5A 1SKUB 1FE0A 1UCNA 2HRTA 4DG1B 1WC4A 3QAEA 2ZZMA 1RACB 4ZVQB 3SFGA 1SQGA 3AHPA 2G13A 3D66A 5DJBA 4PXCA 5L46A 2HFZA 3JSMA 4FYVB 5KFSA 2C3UA 4G1QA 4BCAA 1X0PA 4OI6A 2V94A 1R6YA 3SFUA 3DYAA 1S0MA 2R2TA 2ZITA 2DXEA 4IYQA 4M5DA 4FF3A 5ETPA 2KXNB 3W9IA 5BYQA 1YJNS 3L7OA 3DN9A 2IBKA 2OD4A 1U25A 1KEKA 3DDKA 3EYZA 4K4VA 1SVDA 5J1EB 1R31A 2FHJA 2PO4A 2L48A 3I82A 1XNRJ 4TVAB 1IBMJ 1SXLA 4PWDB 1RAGB 3PEJA 3POTA 4WCEQ 3S01A 4ALZA 1VQKS 1PJ6A 4CQ1A 3U1MA 4O4RA 3GCXP 2FLNA 9ATCB 5KFYA 3VHQA 4JI3J 4J9KA 1HNVB 2IA0A 2LQ8A 2DHAA 2VKZG 4TU8A 2QMXA 2GO8A 3BN7A 4FYWB 4ZPCA 3GIRA 4RBUA 4DX6A 3PYDA 2IMWP 2DH8A 1T94A 3OSNA 4KTQA 4RW8B 1VQPS 1KOHA 3ILLA 1WDTA 3H42A 1SIWB 1CLFA 5IM0A 3KUEA 1JMTA 1K8AT 2VZ9A 1NMEB 1R3NA 3DLLQ 2AYBA 3BQ0A 4N7TA 5KFTA 2HHSA 1N5SA 2DCLA 3JTPA 4GC6A 2IIHA 3D0GE 3OXFA 4Q0BA 3KJVB 2VA2A 4I2PA 1QE1A 3MEGA 4ER8A 2JRRA 1YBTA 4LSNA 3IWXA 4RBTA 8RUCA 4AL6A 3RJMB 3GG0A 5B0GA 2WONB 3G6XA 2HAFA 4OZ2A 3NGUA 2I5JB 2XGPA 3L9ZA 2YNIB 3BSAA 3KLGA 4B9TA 2FGOA 2NZ4A 1XEZA 4OYXA 4ELUA 2QE5A 1UKUA 5FIIA 5KT4A 3QRRA 1VC6A 2H4WB 4G1PA 3U1LA 4J5OA 2E5IA 3GZ7A 2BKNA 2RAQA 3GFYA 4ANCA 5LSLA 1VRUB 2XMVA 1WJ9A 3RBEA 2MQPA 2CJAA 1T9WA 2GJIA 1AUDA 1RT1A 2GAGC 2XO6A 1HWUA 5DQGA 4RW7B 4UUWA 1F5BA 3THPA 5HL7Q 2HFUA 2R4FA 3Q8SB 3KHLA 5J1PA 3W66A 2PMZD 3WX4A 4YOEA 3LZ8A 2HKEA 3HX9A 1S59A 1QDUB 4FYXB 4X4OA 2BJ3A 3RR8A 2F63A 5ETOA 1U49A 2R8KA 1CQMA 3J7YU 4HHUA 1HBUB 1X5SA 3ET6B 4CLSA 1WD6A 4DV2J 3OPKA 4I68A 1DQAA 4ZJQA 4DR7F 4PWUA 5B09A 1ZYQA 4LJMA 4DG1A 2RDIA 3OQ2A 1YJUA 1G3OA 2J8AA 2V50A 3M9NB 2V67A 1YHQS 2YPYA 5A76A 1VOMA 1XQIA 3CCLS 4L3NA 2JEFA 4OZNA 1IBCB 3CCZA 3GIIA 1TL4A 4WXWA 3QPIA 3N6LA 5E5NA 3B78A 1X4BA 4S0MA 3UNGC 3WIUA 1TFYA 2HQ3A 4DL6A 4QWEA 5GMDA 1N52B 1NAQA 1SIZA 4FZVA 2A6OA 3R1HA 2CDRB 3MFHA 2YX1A 3K2YA 3MD1A 5J1EA 2BJ7A 1GAOA 5FD1A 1LW2B 1MN7A 4TY8B 2CFXA 2C2KB 4DFKA 4EYIB 2PGCA 4HEA9 4CNZA 4DWIA 1HNVA 3OFEA 2KG0A 2MKYA 1IUJA 1UVNA 3EVWA 3F73A 2MZSA 2UV8G 5LT5A 1HW8A 5GADI 3T19A 4JI5J 1LK7A 5HVGA 3AKOB 1WSRA 4URQU 3J80Y 4RW8A 5L1LA 3NMAA 1W2BR 4QWBA 3ULHA 3MWBA 3VR1A 4DV6J 1PIEA 3JYTB 2QEXS 4JI4J 3ENWA 3Q86A 2DNRA 2LEPA 2D9OA 5KAKA 1T3NA 3OL9A 1JLQB 4M5KA 3M8PB 4CH0S 2ROGA 4X4RA 3R5CA 3QSIA 3NGDA 4Q8EA 2V2ZA 5LJ3Y 3M8WA 4EMDA 2O3DA 2WONA 3W7BA 5CABA 4YDDB 2DTJA 2I5JA 2V8VA 3F56A 2XWXA 2YNIA 4X66J 5KFFA 4OHZA 4ZA1A 2DHSA 2P9EA 4JI1F 2H65B 2BRKA 2GNKA 1UJ5A 3P4UB 1VR6A 3HCXA 3GP9A 1NM2A 2HWIA 1DAXA 3AFGA 1JQGA 1IM4A 3OXGA 2EW9A 2JLEA 1GEHA 3M30B 1E6YB 3VAFA 2H48B 1S1TB 3HZEA 4MMOA 4KB7A 2ALZA 2EFQA 1T3OA 2ZBIA 1BQMB 5HVFA 4KAIA 3Q23A 3BH6B 1C2PA 2HHHJ 1AB8A 4UOGA 3CNQP 2JVOA 5B0DA 2IRYA 5A8WB 1QVFR 1RAFB 4OZ5A 4IOAQ 1WF0A 3D1OA 2UXCF 1QAXA 3ET6A 5DQIA 3HK2A 4LF2A 5T14A 4JV2A 2HURA 5H9EJ 4ELVA 1L5UA 8AT1B 2CQ1A 4K4WA 2RF2B 2YWGA 2RT3A 4FVMA 4NZ0A 1W26A 2E5GA 2MGZB 1FFGB 1L3SA 2OPRA 4JI2J 2LU2A 5U47A 1D0EA 2QV6A 3ZNJ1 1PILA 2N7CA 2IJNA 4DX8H 2GIQA 4RNOA 1HWJA 2V9WA 3UD4P 1M5HA 3R5AA 3TZWA 2KRBA 2J0QD 1ZH5A 2ZD1B 3PG9A 4NCBA 3JQKA 3K7RA 4IRCA 4B3OB 1F60B 4CH1A 3QNWB 2IAJB 2J76E 3NBPB 1LW2A 2CQ4A 3PFOA 3C6TB 4TY8A 1K9MT 1YX2A 2VL1A 3G8QA 1RAAB 3HZGA 1B70B 2UU9F 4LF8J 3QWPA 3FZ2A 4EBEA 2F8EX 5DZ7A 1RHMB 1JIHA 1TKXA 4RBVA 4NX9A 1BQNB 5FLXU 2JL9A 4J80A 3CJ3A 3FRZA 1HHSA 3M7VA 2MQMA 2JZ5A 3E3XA 1O6XA 2V4QA 2RKIB 3R8YA 1YITS 3MTKA 2OFGX 1GMUA 1TK0A 8ATCB 2DB1A 1H7WA 5IWAF 1S1WB 2BM1A 3JYTA 3I9ZA 2V68A 3EM1A 4RKUC 3A8EA 3CD7A 3G4SS 5C2GA 1HA1A 1PAUB 3Q83A 3GR0A 5EWGA 1F3FA 3M8PA 1OIAA 1LWEB 1XK8A 3SSRA 4BWJA 3FMBA 3UFCX 3W5ZA 5H1SV 2OTLS 1VBYA 1Q8BA 2E1RA 2G0IA 4ZPWR 1EARA 2BJ8A 1QAYA 3W64A 3TQ1A 3RAQA 2W2PP 4DL2A 2EG2A 2PD1A 3G6ES 1H98A 2GVDB 1XWLA 3QT7A 2KKHA 3M30A 1E6YA 4Z7YA 4LF6F 1S1TA 3BPDA 2DGUA 4B3MF 2ZVSA 2XEXA 1NDKA 3G9CA 2HVIA 1BQMA 3PW0A 4E0DA 4RPFA 5CZXA 2Q6CA 2QLJB 2CNKB 2EI5A 3FQKA 3MR7A 3HHDA 1U8SA 4M95A 1MU2B 3NNHA 1IJFB 2C2NA 2ZC3A 1CJTB 4DL5A 1C3GA 2V8HA 3D7SB 5A8WA 1D09B 3GYNA 1S1UB 1SH2A 5IT9Y 2Y1JA 4G6VB 2V69A 1KHVA 1RB0A 1MW7A 1S1VB 5F8JA 2FTRA 1U1KA 3T6BA 1RWPB 2MJNA 2LA6A 4A8YA 1Z4UA 9RUBA 3QZ7A 4H4OA 4OJHA 2RF2A 2J9DE 2HVHA 4WYLA 4DQSA 3GIJA 5LMUF 3TA2A 1FKOA 2ROPA 1KOOA 3P5BP 2VKRA 1NJWA 4J37A 4V19X 4ZKAA 3JXOA 2HBQB 2ZDPA 4Q5VA 3BO2A 4B9SA 5J2NB 3RB6A 2G1HA 2AD9A 3QRQA 3CC2S 2O5DA 1HPZB 1M1KT 4M1KA 1S4EA 1VC5A 1RTZA 2YWHA 3TUJC 2D7SA 1X4GA 5HP1B 2AMCB 1VQ4S 2ZWPA 2ZD1A 3ITHA 4JV1A 3S8SA 5EHHA 4B3OA 1N33F 5KG3A 3GB0A 5HATA 4BDPA 2IAJA 1DZ5A 4CH7A 1RWVB 3NBPA 4DBQA 5K8NA 2KDOA 2OUGA 3C6TA 1M5SA 3A3PB 3MM9B 3LO3A 4HDGA 3J7YI 4DUZF 3OJUA 1TUWA 2HW3A 3ZTOA 2NQPA 3KTQA 2AU0A 2WVFA 1REGX 3HVRA 2FJBB 4WP3A 3ZZ0A 2CQDA 3SCKE 1S77D 2EBEA 2ZHOA 1BQNA 4GMKA 1ITPA 1N5YB 2NXNA 3I4HX 4OHXA 3KWMA 4EBDA 2IHR1 4HTIA 2RKIA 4ZCMA 4CLTA 1FX4A 5B08A 1N32J 3W60A 4A47A 1Y4ZB 4LF4F 2OFHX 1RISA 3VAHA 1XR6A 1FDAA 4C11A 3FBFA 3E51A 5KG5A 2EFGA 1S1WA 1SJRA 3PJXA 5KT6A 4WWSA 2K8GA 2E9TA 2E1AA 1NHKL 1RWKB 3TEGA 4ETXA 4LFBJ 1KLMB 3QBCA 2WSEC 3H25A 4U8VA 1LWEA 1TFWA 2QA4S 3MM6B 3FRYA 2NR0A 3NCQA 1NZ8A 4I6AA 1R43A 2PFFB 1VJQA 1RAOA 4NZ6A 2ALYB 2OLWA 3H40A 4YB1P 1JWWA 2J6SA 2VFRA 2I2YA 2GVDA 2VQEJ 1T9TA 3PCOB 1OMSA 4LRDA 2M8HA 4LRBA 3FSXA 3VGSA 5L39A 3FEYB 4QPXA 4LFCJ 3DXBA 1QD1A 3MFIA 1YJRA 4FF1A 2NREA 1NXIA 3BDPA 2YNHB 3IR7B 2O67A 3US5A 1MU2A 2UZAA 4XDDA 1JLFA 3DOKA 1CJTA 1JNZB 3WDOA 2IYIA 3I87A 3VGTA 1S1UA 4AQYJ 3AT1B 2C42A 2E5JA 4K4XA 1NH7A 2QG9B 1RE1B 4OJGA 2HRUA 3HVWA 1S1VA 1SL0A 4QW8A 1O0PA 1Y0HA 2Z4PA 4IFVB 3JAMU 3VVTA 1EKSA 2FY1A 2B4PA 4X65J 2Z2ZA 1RWWB 1VFJA 4LVOP 3B4MA 1B7FA 3PVXA 5IT0A 1HBNB 2HZAA 1RT4A 2P8IA 3R1LA 1PC4A 3AH6A 4M63A 2C3MA 2MB0B 3NS7B 2LCWA 2ZJQQ 2AEMA 3GTYX 5EX3A 1OWXA 4UT4A 3FKBA 1X4AA 5J2NA 2ACMA 1HWKA 3MUTP 1HI0P 1HPZA 3C8YA 1M1HA 5HP1A 1S49A 3GV7B 1ZETA 4UF4A 2MQNA 1BGXT 1R7IA 1L3UA 2XY7A 4C3LA 4WZMA 1SC1B 5A2QY 1HYSA 4ECVA 1C4CA 1RAJA 4FXVA 3HVTA 1T11A 2C1EB 2IM2A 5K20B 5HMYA 3L4BC 1KVKA 4DLEA 4ILRA 5D0EA 2Q43A 2RVJA 5EWFA 2BJ9A 4MH8A 6FDRA 1UAWA 4GRSA 2C2MB 1N36F 2R7VA 4K59A 4A8QA 5L38A 3OTDA 1V5VA 2JVMA 4WKRA 1H73A 3OL7A 5M2PA 4DPOA 4EEYA 2IVMA 4X84A 3UD5A 3HJVA 3NWGA 3BGLA 3UCUP 2R7WA 2VC1A 2ZUGA 3DXSX 2P5VA 1BLUA 2WTFA 1PGZA 3M8QB 1WKKA 1XAOA 4JI6F 2IJFA 1FT8A 2HZVA 3UI3A 4RUCA 2EFNA 1YJTA 2KVIA 1VIXA 2J0XA 3MUMP 2C2RA 3RB0A 1JLCB 1K0VA 4F0KA 4OFZA 1KLMA 1NDCA 1YBAA 1LFPA 3VV2B 4USJC 3EGVA 3MM6A 3IS9B 3MR3A 2B43A 4W98A 2FHKA 2KT3A 1ACMB 3UNYA 4U8YA 2OJ3A 3QFHA 2RSQA 4H4MB 4O3RA 4KIAA 2VD3A 2KT5A 2QL7B 4DFPA 4WIIA 2KRRA 5I42B 4DPXA 4WFXA 1P27B 1UA1A 2FJXA 3L3CA 4F3QA 1RYSA 1S72S 3V81B 3OR1B 4ZVTB 3GJRB 2YNHA 1S6UA 3TRGA 4TQRA 4HTJA 5GMEA 1VHFA 2F1FA 3LQVA 4PPZA 2CQ0A 4C0OC 4TQSA 2ILZA 3VZHA 2QN6B 4WFZA 3MR2A 3RRGA 2FVRA 2NPFA 4Y28C 3DGPA 1I51B 4DR4F 1YWXA 2ZFHA 2B3TB 3DFEA 2V8DA 2ZZNA 3M2RB 2BXJA 3B8HA 3BJYA 3HHNB 3ZNUA 4X4VA 4DR7J 2KFZA 2CWKA 4DL0C 4IFVA 2I8EA 3CO0P 3JAMY 1FERA 2XMJA 1S6PB 2GHPA 4AXJA 4DN9A 4Q43A 1HBNA 4DS4A 1FK9A 1FEEA 1RLDA 1GMVA 2DXFA 2DNYA 1C1CB 2GV1A 1XMOF 2WW4A 2JWNA 4V1Ak 3VALA 1RLCL 5EWEA 3UO0A 1VHIA 1D1UA 1AZSB 2DNQA 5HQ8A 4P71A 3H0PA 5KFQA 1A0OB 2ZE2A 4MKYA 2IM3A 1X9WA 1B0PA 4YR0A 4J9VA 5D4OA 2W2QP 1WC5A 3PX6A 1WORA 1QSLA 2DD8S 5KFZA 2CRLA 1TKZB 4KRWA 2MQOA 2R7XA 3JQJA 3DGVA 3TX0A 1Q7YT 5D4PA 3G82B 3VAGA 4F4KA 3MEDB 4P74A 4A8OA 3R97A 1RHUB 3Q0AA 3PV8A 3MCNA 5H9EK 2XTJP 1H2TZ 4EFAC 1WC3A 1VBZA 2BE2A 1JK9B 2MZTA 4TLQA 4MK7A 2D3O1 2XSJB 4NLPA 4DV1F 5LJ5Y 1RUSA 1T8EA 2YX4A 2VOPA 2LA4A 5KG0A 2Y8YA 5I3PA 1HQUB 2WVBA 2KXFA 3VVUA 5HBMB 4ECTA 5IS2A 5KG2A 3PR4A 2GHWA 5LXRA 1LW0B 1LV5A 5LSRA 1X4DA 1VQ8S 3UN2A 2CZ9A 2A6MA 1OY8A 1VI7A 5DRKA 3BPSP 4YR3A 2RD5C 3GE9A 1PBAA 3IO1A 2AT1B 3I5BA 2HBRB 3IS9A 2RRAA 2KJVA 2DJWA 1T05B 2R2RA 3PYEA 2XQCA 4F25A 4Y2AA 1VQSA 2E1MC 2CPIA 2XNRA 1YLXA 3FCWA 3CSKA 4YB6A 1QSYA 2AGQA 2G0JA 2E5HA 1OS5A 3FVYA 1IBKJ 2F7VA 3C6UB 4H4MA 3RGIA 1HI8A 3BBCA 1UJ4A 2KZMA 4P10A 3ADAC 3EICA 3P96A 1CEZA 4KKOB 1DRZA 2LECA 4ZP7A 2J7WA 2KG1A 3DM2B 2CJKA 3WIVA 3UN3A 2CQPA 5A6WA 2YKNB 3AOCA 4DPUA 3NGTA 3V81A 5D15A 3OR1A 2QC3A 2GQCA 2LEBA 1MMNA 1O5JA 4K4UA 4MIBA 3HT0A 1EB0A 3C15B 2B9XA 2LFVA 3DU6A 2MZ1A 5EDWA 3CJ5A 3IR5B 3M2RA 3CCTA 4BLGA 1Y3KA 2QMUB 3CUNA 5IT4A 2B8PA 1D8YA 2NUHA 2BANB 4NLTA 1CSJA 1FNOA 4J9QA 1S6PA 2MLYA 4ED4A 3N4WA 2FJEB 2DGSA 2AIRB 1JLEB 3MM7B 3GJTB 1KRPA 1FD8A 1XMQF 2B4UA 1C1CA 2RILA 2R7QA 2MQQA 2R3VA 4RUHA 2LP4A 3KLEB 2HNYB 2YKAA 1AZSA 4AYBD 3EMTA 3BGOP 2C28A 1JXVA 5K14B 1RYRA 5M2UA 2LQBA 4ILLA 4L75A 4Q2LA 3AB4B 2JFDA 4CLWA 2MKIA 3NCPA 3C2PA 5SUHA 2AJ2A 2U1AA 4CM0A 1YRXA 1TKZA 2DGOA 3CDBA 3UVJB 5F3ZA 4OI4A 1KKHA 4OX7A 3SIPB 1S48A 3G82A 1DARA 4ZHRA 1N88A 4P73A 2FJWA 5DZ6A 4ICLB 3O6QA 3HKWA 4OYIA 4PQAA 2MYFA 2FPHX 4NLUA 4KH0B 4I1TA 2X7IA 4JI0F 1XC9A 2RNEA 4D3HA 3RBDA 1IKVB 5H9FJ 2QZ8A 1FFWB 1KDNA 3HP6A 2ACYA 2HS3A 4C3MA 2XSJA 4HH0A 3E01B 3W9JA 4YS2A 4JI7F 4F3OA 4Z2XA 3V4MA 1T7PA 3HHLB 1D9FA 2EC2A 4LREA 1HQUA 3DOLB 3G6VA 1Y3JA 3CCSS 5HBMA 5IWAJ 1JXEA 4C6AA 4ECYA 3GFXA 1LW0A 4U7UD 2MKJA 2W1BA 1AW0A 2POKA 2RJZA 3IA0A 5F8LA 2M52A 2VBYA 3TJ8A 3G71S 4EZ6A 4WKYA 3ETOA 1R0CB 2QL5B 3O8WA 1T05A 2LDIA 4F36A 2KXHA 4MYUA 1QAJA 3M9OB 2FVQA 3PO4A 2V63A 5E3RA 3CIZA 1JLAA 1WHXA 3H5XA 1TELA 2W25A 4IRKA 4RNFA 3C6UA 2V2QA 3HHEA 1SPBP 2CDQA 3MGJA 1FJGJ 1IKYB 3QSYB 2MJUA 2XNQA 2VJVA 2HGMA 4LF6J 3LAMA 4F02A 3AOAA 3H5SA 5ETVA 2W8LA 5KFCA 4ENOA 4DSEA 4I0WA 3MEEB 4NMLA 4FBTA 2RS8A 3BGRB 3Q8YA 3CF5Q 4B3MJ 3DM2A 1URRA 4QZVB 2Q1LA 2DNOA 4OIXA 1QUPA 2VJUA 1U45A 1M0SA 3K17A 2YKNA 4DR6F 3HSGA 1OYEA 1XR5A 2B26A 3AJDA 3FZBA 2DY1A 3CW2C 3C15A 1T95A 1RWXB 2VC0A 1SH3A 1Y9OA 5ETNA 2CPFA 2W9BB 1RT7A 4KQZA 2YKMA 3HPOA 4DR2F 2HEKA 4F0HA 3PIPQ 2N3LA 3R2CJ 1C1BB 1NSAA 2WBRA 3QQCD 2XI3A 2L9DA 3S1TA 3T9NA 1OY6A 4DV5J 2E7WA 2E1PA 5KFKA 5AJ3F 4C2MA 1UEVA 4ZVUB 4ES1A 1RU1A 5KFNA 1KQSR 2YWKA 2BANA 2FZGB 5JVGQ 3V6DB 3M2VB 2D69A 4OYBA 3CEDA 2XHWA 2DNHA 1KFSA 1CC7A 3FBBA 3BSCA 1TAUA 3MM7A 1HQ2A 2XZDB 1F2GA 2XYHB 2CNNB 3UD3P 2K3KA 3GJSB 1L3VA 3FDSA 2GVZB 3KG1A 1NK9A 1U47A 3Q8RB 1HNWF 1LWXA 1Q1KA 4Y2MA 3TJ9A 2AF6A 4QYRA 3KLIB 1GMWD 2FY8A 1BWEA 3W8GA 1DFDA 1MROB 3LP0B 3ZTQA 4ZCKA 3UVJA 5BYSA 1N33J 1RAEB 2DH7A 1TAQA 3M2UA 4ICLA 2R2UA 4N56A 5A8RB 2AP6A 2VBWA 2XWYA 1Z2LA 2VPYB 1RT6A 2H3EB 1ZM4A 2QRRA 4K4SA 4DUZJ 4KHMA 4USWA 4TYAA 3OFFA 3CJKB 3BO4A 3OL6A 2F4FA 1NDLA 2ZUAA 3CCUS 5L8RC 4YMEA 1S9EB 2W7AA 3EUNA 1G2EA 3ZZRA 5DG8A 5FDLB
chains in the Genus database with same CATH topology
3I38A 2Q2GA 1GMWA 3L9ZA 1EB0A 1GMUA 3TJ9A 1NLTA 3TJ8A 1C3GA 1GMWD 3AGXA 3AGZA 3AGYA 1EARA 2HFVA 4J80A 2QLDA 3NXZA 2B26A 3NY0A 3LZ8A 4L3KA 1GMVA 3TJAA 3LA0A 1XAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I38 A;  2Q2G A;  1GMW A;  3L9Z A;  1EB0 A;  1GMU A;  3TJ9 A;  1NLT A;  3TJ8 A;  1C3G A;  1GMW D;  3AGX A;  3AGZ A;  3AGY A;  1EAR A;  2HFV A;  4J80 A;  2QLD A;  3NXZ A;  2B26 A;  3NY0 A;  3LZ8 A;  4L3K A;  1GMV A;  3TJA A;  3LA0 A;  1XAO A; 
#chains in the Genus database with same CATH topology
 1DTQ A;  2HQC A;  3E01 A;  2EK6 A;  4B17 A;  1C0U B;  2DR6 A;  1Y10 A;  3RAX A;  3HHL A;  4OZ1 A;  1SI9 A;  3MCO A;  4G65 A;  1IR0 A;  4LF4 J;  4OZ3 A;  3DOL A;  3L09 A;  1JJC B;  2IVF B;  2F8M A;  4CLK A;  4DQQ A;  2V5H G;  1FRM A;  2X51 A;  3FEZ A;  4DCP B;  3NAH A;  3AGY A;  3BDE A;  4U7U K;  1QY7 A;  3VCD A;  4AE5 A;  2Z58 B;  4CO3 A;  4LIW A;  2XMK A;  3OW2 R;  1YQH A;  1NCL A;  4C4W A;  2OD6 A;  2LXI A;  3D4J A;  2CPY A;  3DI6 B;  3WBZ A;  3IRX B;  3RZA A;  4RW4 B;  4H4K C;  3DRS B;  2W2O P;  1IQZ A;  2EKY A;  3VQS A;  1Z2Z A;  1NZA A;  3BKF A;  4UOC A;  3N0V A;  1IKY A;  2XZT B;  1VQO S;  4ZVH A;  3LPY A;  1APS A;  1WOP A;  2FQQ B;  3PW2 A;  3QGP A;  1CC8 A;  2QYG A;  3BGR A;  1T9V A;  2QSF A;  4GC7 A;  4MTP A;  2XLJ A;  2MDA A;  2YX7 A;  2EWH A;  2DCU B;  4WF9 Q;  1ZBT A;  1UFK A;  1FXL A;  4BWM A;  2A10 A;  3GIM A;  2K7K A;  3GIK A;  5L9X A;  3T1H F;  3NOC A;  3BR9 A;  1RJJ A;  1K0T A;  4OX9 F;  1S6O A;  4PQU B;  4DUT A;  2Z2M A;  2W9B A;  5E0O A;  3A1Y G;  3RRK A;  1C1B A;  3UN5 A;  1RSC A;  1WUU A;  3JTO A;  4KC5 A;  2CPD A;  1UVJ A;  1QAI A;  2ASJ A;  2MZQ A;  3LAN A;  1EQM A;  2LMI A;  3RBX A;  3M2V A;  1UWB B;  3N5F A;  4W90 B;  3R7S B;  3IM9 A;  5B0E A;  3HF5 A;  5A0Y B;  1WWH A;  4IO9 Q;  5LMN F;  3D6F B;  1RTI B;  2BOP A;  4ZVS B;  7AT1 B;  3MAQ A;  1HBO B;  1VDH A;  2MZR A;  4C8M A;  3OV7 A;  2WHO A;  3P6Y C;  4F3M A;  2GVZ A;  1BQX A;  5CYJ A;  4QWD A;  2G2Z A;  5E7O B;  2OEL A;  1Q79 A;  3A4T A;  1TL1 A;  2AX0 A;  3M9M B;  3KLI A;  4O3N A;  4J7C A;  5K8O A;  2OMO A;  4ED8 A;  5KFD A;  2RDD A;  1MRO A;  3OTB A;  3UR0 A;  4NXM F;  2D9P A;  3QO9 A;  3AJ2 A;  2L9N A;  3R5B A;  2CQI A;  4DV3 F;  3I96 A;  4NZ7 A;  2MKK A;  3GMG A;  2MHN A;  1U6B A;  5A8R A;  1U1O A;  2HGL A;  4G1Q B;  2DR5 A;  1WEZ A;  5D0H A;  4DV0 F;  2JEG A;  1HWL A;  4I67 A;  1N36 J;  3RW7 A;  4ECS A;  3CJK A;  1YG0 A;  3C46 A;  5ETM A;  4X64 J;  3CCR S;  1N0U A;  3MI7 X;  4Q2M A;  3NGR A;  2RH3 A;  3M4X A;  3ZTP A;  4WP8 A;  4AUK A;  4KHR A;  1C0U A;  1NU4 A;  1K1S A;  3K5P A;  3QT6 A;  4M5I A;  5BYR A;  2F5G A;  2NXJ A;  1NK6 A;  4NOH A;  2L9W A;  5CD4 H;  3A13 A;  4JI6 J;  2VA3 A;  5E3P A;  1YI2 S;  3HD2 A;  1RA6 A;  2ASL A;  2I38 A;  4F04 B;  4USU A;  4YQW A;  3KNG A;  5D6G A;  3OTO F;  3NP5 A;  3KK2 B;  4DQI A;  4PXE A;  3KHH A;  2OML A;  4KGX B;  1J2V A;  1H2V Z;  1B0V A;  3TA1 A;  3LPE A;  2FLP A;  2BRL A;  4USV A;  3OLB A;  4RU2 A;  5CD4 A;  1HNZ F;  4Y2I A;  3ENV A;  1P1L A;  3IRX A;  4RW4 A;  3DRS A;  3CME S;  2Z2L A;  3IBF B;  1IN0 A;  1H2U X;  2RDJ A;  2BE9 B;  2CPZ A;  4KGV B;  2OKQ A;  1HNX F;  4USK A;  1U1M A;  1HHQ A;  2QFJ A;  1RI7 A;  3MCS A;  6AT1 B;  1X0F A;  2NCK L;  5DG9 A;  4URG A;  4CCH A;  2LLZ A;  4NCG B;  1RKJ A;  3DLK B;  2XM3 A;  2HG4 A;  4IOC Q;  2ASD A;  2UUW A;  3P49 B;  4A8M P;  3IR6 B;  4DF4 A;  2JLF A;  3MEG B;  4J9P A;  5CXT A;  2HVE A;  4DQP A;  4QQB A;  1ZAV A;  1JJH A;  1S0O A;  3HMJ G;  4QIF A;  3PKY A;  3T5H A;  2ZBQ A;  2R7R A;  5DDQ C;  3V5R A;  4IG3 B;  1PJ5 A;  3AOB A;  3LGN A;  3CIM A;  5CHC B;  2JSX A;  4CYU B;  2M88 A;  1RAD B;  2OPP B;  5A6P A;  4RW9 B;  4DR4 J;  4PQU A;  2CZV C;  2YXL A;  3CDU A;  1DLO B;  5ITH A;  4LVN P;  3HLU A;  5MAO A;  3LWL A;  2VOO A;  4K4Y A;  3OBI A;  3ICL A;  1U1L A;  3G6Y A;  1RZM A;  3FBC A;  3PHE A;  2HNZ B;  4EZ9 A;  3D2W A;  1KC8 T;  2IM1 A;  1UWB A;  4OL8 A;  2X1G A;  3AB2 B;  2YH1 A;  4RO0 A;  1CJU B;  5HJX A;  2MQ8 A;  5A0Y A;  2BJ1 A;  1XMO J;  3EVM A;  2AKW B;  1T03 B;  1RTI A;  2GMH A;  3VAK A;  5BR8 F;  1HBO A;  2VG7 B;  2QX0 A;  3EWG A;  2HBZ B;  2DKO B;  3VAJ A;  3HSJ A;  1YBU A;  4R0J A;  2VFT A;  1XJW B;  1J27 A;  2VB6 A;  4WU2 A;  5T41 A;  2B6A B;  4C8Y A;  1PCA A;  4HI2 A;  2V9K A;  3U7J A;  3IN5 A;  3K8V A;  3LA0 A;  2OHD A;  3BGU A;  2VF3 A;  3GIL A;  4JI8 F;  4X4P A;  2YNF A;  5AXL A;  5F8G A;  5IC6 B;  2JFK A;  2NSC A;  2NSB A;  2B5J A;  3D6M B;  1QTN B;  3QWU A;  3IMQ J;  2E7V A;  2G0C A;  2CQH A;  2AW0 A;  4GKJ F;  3AAW B;  2ERR A;  2FJA B;  3QIP A;  1WNE A;  3SSQ A;  5KFE A;  3RR7 A;  3FC9 A;  1TL7 B;  4YY3 F;  1ZAX A;  3Q24 A;  5KFB A;  2QA1 A;  1YVF A;  3P8B B;  1N54 B;  2ZKT A;  1T9X A;  2LVW A;  2HWH A;  5GMK a;  1YSJ A;  5I3U B;  1FKP B;  4CIO A;  1MN9 A;  1PSD A;  2Z30 B;  3NS6 A;  4ZMM A;  2IDE A;  5C24 A;  2GJF A;  3W3S A;  2FHO B;  2FGC A;  1W25 A;  2C3O A;  1WOO A;  2R7S A;  1WAC A;  2DPJ A;  3KK2 A;  1PG5 B;  3M05 A;  1U09 A;  1GMW A;  3QT5 A;  2ADB A;  2BUN A;  3HSD A;  2RQ4 A;  1B3T A;  1N6Q B;  2JLG A;  2HHU A;  2GQQ A;  3QJP A;  3T41 A;  4KH1 B;  4QPT A;  3LGH A;  5LXY A;  5KFJ A;  3IAM 9;  3EXC X;  3MTJ A;  2ZHA A;  2V34 A;  4YB5 A;  2MMY A;  1F1B B;  2NS1 B;  5DET A;  1YJ9 S;  4USM A;  5H9F K;  4MJK A;  2DIV A;  2OPQ B;  2G2Y A;  1H0H B;  4NCG A;  5KFW A;  3DLK A;  4AND A;  2BQ3 A;  1NO8 A;  3FUY A;  2KU7 A;  5L1J A;  1P6T A;  1IKX A;  2C2O B;  1H3D A;  5EGY A;  3TI0 A;  4OMF G;  1REV B;  1U6Z A;  3NNA A;  4RUA A;  2W8K A;  5F9N A;  2WB4 A;  1WG4 A;  2XMA A;  3GV5 B;  4MYT A;  1SKW A;  5KFA A;  2ZDO A;  1FI4 A;  4RL1 A;  5BXI A;  4IG3 A;  5T7L A;  2P6S A;  4KPY A;  1KQG B;  3KHG A;  1QVG R;  3KOA A;  1NJY A;  1F5C A;  2VUG A;  2QIF A;  4CYU A;  4WFN Q;  1TP7 A;  1FA0 A;  2OPP A;  4RW9 A;  4CO1 A;  4IUF A;  4RU9 A;  2F40 A;  1DLO A;  3ENA A;  2NXC A;  2HFV A;  2IPO B;  1CS4 B;  2Z0G A;  4CLF A;  2C22 A;  4DR5 F;  2UUA F;  2GX8 A;  3H59 A;  5KFP A;  2HNZ A;  1RWO B;  3H4B A;  1EZZ B;  3N01 A;  5J2P B;  1RHR B;  2O01 C;  2V8P A;  2QLD A;  3KUH A;  3ZO7 A;  1JKH B;  2X1B A;  1XMQ J;  1CJU A;  4C3K A;  2YKO A;  4ZLN A;  3D54 A;  3EDR B;  1NK5 A;  4QW9 A;  1T03 A;  2HFS A;  3MMJ A;  5HO4 A;  3KMQ A;  2VG7 A;  2ZOM A;  1ELO A;  4MIW A;  2DPI A;  1SJQ A;  1VIS A;  3QGG A;  3G8S A;  3KJN B;  3HFK A;  1DQ9 A;  5JUM A;  2B6A A;  4UZC A;  3QLH A;  4WE1 A;  2DYA A;  2W2M P;  2YBV A;  5C25 B;  3MPV A;  3MPW A;  3IP0 A;  4F50 A;  3QGH A;  1U1R A;  1R89 A;  1IBL F;  3H2U B;  1AFI A;  2DGQ A;  5DDO C;  4C0B A;  5KFG A;  3CUL A;  1NJX A;  3I9V 9;  5B7W A;  2OPR B;  2BJD A;  1Y00 A;  1RCX B;  3ELH A;  1IWA A;  1TL7 A;  1SJF A;  1UTA A;  1K44 A;  4JI0 J;  4JI4 F;  2HZC A;  2CA9 A;  1U6F A;  1RTJ B;  2OSR A;  1GXT A;  3BF4 A;  5DGB A;  3K0J A;  4EK2 A;  1TK8 A;  4Y0F A;  4JI7 J;  3KJF B;  2UUB F;  2EPI A;  1QM9 A;  1QUV A;  1PYT A;  2OO4 A;  2D3Z A;  5DQH A;  5I3U A;  1FKP A;  2HS0 A;  3CD5 A;  2DNN A;  3FK4 A;  1ZZF A;  3MOZ A;  4OI3 A;  1HQE B;  1C0T B;  3LH2 S;  2VPW B;  2VH7 A;  1RU2 A;  1NPK A;  4RNN A;  3TZY A;  3X1L B;  3MAA A;  3FJ2 A;  2VPX B;  1TMJ A;  2HFO A;  3TVY A;  4JYA F;  2DNG A;  5KFU A;  1XER A;  1TKX B;  3KK1 A;  2CJ9 A;  3NY0 A;  4X2B A;  1RDR A;  1NSK L;  3DNC A;  2FHM A;  3QFW A;  4PAB A;  4YP3 A;  2QSW A;  1N6Q A;  2MHE A;  3OHB A;  2KYZ A;  3D67 A;  4USH A;  1HMV A;  1AA1 B;  2IMO A;  3T1Y F;  3LP2 B;  1V5I B;  4CLY A;  4FPI A;  4PPD A;  3DLJ A;  4K0K F;  2DY9 A;  3SCL E;  2YKQ A;  1VJW A;  1RCO B;  3R5G A;  4CM2 A;  2FHJ D;  3V6H A;  3W1Y C;  2OPQ A;  5F8H A;  2XB2 D;  2CYY A;  3PRB A;  4OI1 A;  2ASY A;  1RBO B;  1UEK A;  5HAO A;  4NAS A;  1RQ0 A;  2AJ4 A;  2BX6 A;  4TU7 A;  2ZH7 A;  4ZIV A;  2AJ1 A;  1REV A;  4Q8F A;  4WIQ A;  1T9U A;  3MR5 A;  2GCF A;  2DH9 A;  5D77 A;  4Z37 A;  3TOQ A;  1EET B;  1O51 A;  3TAQ A;  3EGN A;  3E8O A;  2R8H A;  2WBM A;  5JMN A;  1A9N B;  4LRC A;  2YVS A;  4RWX A;  1KQK A;  1IM6 A;  4P2F A;  4OLP A;  2OI2 A;  2OPS A;  3MMB B;  1NK4 A;  4ED2 A;  5IV4 A;  3R2D J;  4LRA A;  1HLW A;  4DR2 J;  3ZZZ A;  2DR7 A;  1NKB A;  1R8C A;  1WEX A;  1CS4 A;  3VZI A;  4KV8 B;  5AJ3 J;  4ZOS A;  1LEO A;  3OFH A;  3LP1 B;  4KGZ B;  2GO9 A;  5D8H B;  2DRA A;  3DRR B;  2WCX A;  5KT7 A;  2HHX A;  3HM9 A;  5KFX A;  4Y00 A;  4KE5 A;  5J2P A;  1KN6 A;  2M3D A;  1JKH A;  3WC0 A;  1H74 A;  3M6U A;  4KGM A;  4HL9 A;  4ZPT R;  4RLE A;  3EE3 A;  2KH9 A;  2NPI A;  3O1L A;  1HNW J;  4PEO A;  3T5J A;  2MKH A;  2HIQ A;  2DR9 A;  1YIJ S;  1FVS A;  4OX6 A;  4OZL A;  4WFY A;  2PT0 A;  1P9Y A;  3RRH A;  3CT9 A;  2Z2Y B;  1X5P A;  5C25 A;  4H4O B;  2CZ4 A;  2DIS A;  3BQ2 A;  2B9W A;  1ZZN A;  4CZC A;  5KFI A;  1NK0 A;  1UA0 A;  1FKO B;  2QL9 B;  1GTH A;  3H5Y A;  5IFM A;  2HHP A;  1EHW A;  2ZEJ A;  1U26 A;  2JH3 A;  4KR0 B;  4Y6I A;  4V19 J;  4QIW D;  2M7S A;  5F0W A;  3HD1 A;  2WVD A;  1WKL A;  4J9O A;  1JNR B;  2BKP A;  3TUZ C;  3ISN C;  3DLH A;  2DIT A;  2J9D A;  1R8B A;  4QIV A;  2XY6 A;  1RTJ A;  4IH7 A;  1IKW B;  1A7G E;  1ZM9 A;  3M32 A;  1TK5 A;  2CJQ A;  1V6H A;  1X4E A;  4FKX A;  3SYZ A;  4LF7 F;  1U0H B;  3ITH B;  5HLF A;  3W65 A;  3BN4 A;  4LRF A;  2ZZT A;  2HLU A;  4P75 A;  1HQE A;  2AYE A;  2OEM A;  1RWU A;  3D0I E;  1C0T A;  2MEW A;  1CJK B;  4N8N A;  2WAQ D;  4DEZ A;  1NKE A;  3H20 A;  1TQL A;  3HVA A;  3D3B J;  2Q6B A;  3TZZ A;  5GAH U;  3QZ8 A;  2CQB A;  2LDY A;  1B64 A;  2W7P A;  1OYD A;  3J81 U;  4DPY A;  1K73 T;  4U95 A;  1M90 T;  4NLV A;  3LP2 A;  5HQL A;  1NLT A;  1H72 C;  5HN0 A;  1YTY A;  2CPX A;  4C11 B;  1RT2 A;  4KO0 B;  1YZ6 A;  3OUY B;  2AGP A;  4P6Q A;  5E3A A;  4BC7 A;  5K8M A;  4UOH A;  2IVY A;  2N7Y A;  1BUX A;  2JVR A;  3MEK A;  3WQP A;  5JVH Q;  2RQM A;  4B9U A;  1F9F A;  3TYT A;  2J8S A;  4NEY A;  4EO6 A;  3H98 A;  3FMW A;  1M5O C;  2J7K A;  4MKA A;  1EET A;  3N5B A;  3VTI A;  4DS5 A;  2J5A A;  4TYB A;  4RZR A;  5F0U A;  2FZC B;  2UXD F;  5CYM A;  4MAK A;  4A8S A;  2CJB A;  4OQJ A;  3I0S B;  3UPF A;  5IOL A;  1N34 F;  4OX9 J;  4O0I A;  4F0M A;  3MMB A;  4NMX A;  3OTC A;  4CTA B;  4FXD A;  1Q16 B;  3MD3 A;  1VLY A;  3W5X A;  4X4T A;  2GFF A;  1WSV A;  4KV8 A;  1UW4 A;  2IBO A;  3TA0 A;  1VQN S;  3MMA A;  2GS8 A;  3LP1 A;  3GYG A;  1JB0 C;  3CMQ A;  3DRR A;  4LFA F;  6FD1 A;  1QTM A;  2FUG 9;  2Y1L B;  2AGO A;  2D3O R;  4QIE A;  4KGK A;  3CJ2 A;  1JLF B;  3DOK B;  4OI0 A;  3H90 A;  5LMN J;  2FLL A;  1KTV A;  1FDD A;  3F0N A;  5DO2 A;  1HW9 A;  2PEB A;  5JJB A;  3FSI A;  5KG7 A;  2Y3Y A;  4LSL B;  3DDI A;  4CRJ A;  3T6J A;  4YB7 A;  4IO1 A;  1U2C A;  4PWW A;  3M8S A;  2NYI A;  4NXM J;  3E2E A;  4HAC B;  1ZA2 B;  1CG2 A;  1RT4 B;  3NEK A;  4DV3 J;  2AZ3 A;  3M8R A;  4TKT A;  2E7X A;  5GVQ A;  5J1N A;  3OVB A;  1J5E J;  3WHI A;  3G96 A;  3KNA A;  2FIU A;  2HND B;  1WEL A;  2ABY A;  3MM8 A;  2J0W A;  5SZT A;  2HHT A;  2BQU A;  2FZK B;  1GXU A;  1IKW A;  1TL5 A;  4I6W A;  1VQM S;  3T5L A;  4IH6 A;  1XNQ F;  1G7C B;  3LW5 C;  2MXY A;  4WZQ A;  4WYW A;  3I6P A;  5A8K B;  1XR7 A;  1HHT P;  4DDF A;  4ZLJ A;  1U0H A;  1UWA A;  1HYS B;  2WVC A;  2ZH5 A;  4RW6 B;  1WEY A;  1PAE X;  4O3Q A;  3HVT B;  3J7A N;  3ONQ A;  2K2P A;  3GLJ A;  4CLL A;  3LF0 A;  1K1Q A;  4ES3 A;  1CJK A;  1CJV B;  3KLF A;  1ZOT A;  3K89 A;  2V4R A;  1S5Z A;  3OTO J;  4J9N A;  1FDB A;  4M8L A;  1N8R T;  4DL4 A;  3GFH A;  1LWF B;  4P7V A;  3IM8 A;  4M5M A;  1FHT A;  2C3Y A;  5FLX Y;  2HQF A;  1ZM2 A;  3AXM A;  4A48 A;  5B0C A;  3TVK A;  2I9S A;  3DRY A;  4NA3 A;  2H1Y A;  1Q8I A;  4OJ3 A;  4OX8 A;  1HNX J;  2F4V J;  4WU3 A;  1NLK L;  4KO0 A;  3OUY A;  4B02 A;  4D3G A;  4O4G B;  4HDH A;  4QBU A;  2JNJ A;  2Y1R I;  1N4L A;  2W9A A;  1X4H A;  1BC6 A;  2Y1I A;  2RUG A;  4DF8 A;  2OGU A;  1X4F A;  2JC1 A;  1VRT B;  1I94 F;  2AYM A;  4AQY F;  1T02 A;  4WPA A;  2IDL A;  2N3O A;  4LF9 F;  1EJ7 L;  4NLG A;  1GFW B;  5ETK A;  5DLF A;  1DUR A;  4R5P B;  2ZH3 A;  2UVR A;  5G0R B;  4RJV A;  2BW7 A;  3NCR A;  2HHQ A;  4F8R A;  4X65 F;  3R5J B;  1G4C A;  3OVS A;  4C98 A;  4ID8 A;  3BB5 A;  3I0S A;  2W7O A;  1UEU A;  4K7Q A;  2B7B B;  4DV4 F;  1AT1 B;  4WFA Q;  2FDN A;  4ZVR B;  3TAR A;  2N82 B;  5HAN A;  4CTA A;  4ZDN A;  1DTT B;  5KG6 A;  4UTG A;  5KFL A;  1RHK B;  4TN2 A;  5L1I A;  1UET A;  4FS2 A;  2RB7 A;  4CO5 A;  3PO5 A;  4DSF A;  4DCJ B;  1U1Q A;  3KLH B;  5D3G A;  5KT3 A;  3N6M A;  1HR0 F;  4KHP F;  3PX4 A;  2NZC A;  4I64 A;  3TVZ A;  4NE9 C;  4DU8 A;  4LSZ B;  1Q95 G;  5M2R A;  4LUB A;  2GMJ A;  1S10 A;  1FXD A;  2Q79 A;  3DGP B;  3AOD A;  5BR8 J;  1R0A B;  4BBY A;  5C2C A;  1Y5L B;  4EO8 A;  3CJQ A;  2A1B A;  2WSF C;  2XUL A;  1RKI A;  4OYA A;  4L74 A;  2BQR A;  4LSL A;  2DBB A;  5I4M A;  3NWR A;  4DU7 A;  4NLX A;  2ZJP Q;  4X4N A;  3AXK A;  1WHW A;  3CCW A;  4PUO B;  4JI8 J;  2JEJ A;  3CTR A;  4HAC A;  4DV7 F;  4DR3 F;  2HPU A;  1X9M A;  3L95 X;  5DM7 Q;  3J80 U;  2AJQ A;  1FK9 B;  1OY9 A;  3WZ0 A;  4GKJ J;  2DNM A;  2J9E A;  4RR5 A;  5RUB A;  3IG1 B;  4YY3 J;  1S7H A;  2HND A;  3DCA A;  2EC0 A;  2ZE2 B;  4HT7 A;  2W01 A;  1TVR B;  3ZZT A;  3RU0 A;  2VDI A;  3CJR A;  4OHY A;  2XMW A;  1P8G A;  5A8K A;  1R8A A;  2XSF A;  2QFI A;  2YPZ A;  3NRB A;  1WC6 A;  4RW6 A;  4AL7 A;  4J9L A;  4DL3 A;  4XO0 A;  1GTE A;  2HAI A;  4F4Y A;  2XG8 A;  1CJV A;  3V6K A;  4ZVE A;  1HIY A;  2C2D A;  1WTF A;  1FJC A;  2UXB F;  2XLI A;  2BE2 B;  4F4Z A;  4MKV A;  1FRI A;  4C48 A;  1KBR A;  1E6V B;  3ILI A;  5F3T A;  3TP2 A;  2BDP A;  1LWF A;  4F2R A;  5F8M A;  4A8K A;  4NLS A;  4P9S A;  3EZ5 A;  4LBH A;  3NGK A;  4H4K A;  5D4N A;  4NI2 B;  3O3L A;  3JSR A;  4TNO A;  3BR8 A;  5IC4 B;  1HL6 A;  2MPU A;  1NH8 A;  2EK1 A;  3DRX A;  5E41 A;  3HFZ B;  1S97 A;  4O4G A;  3TAN A;  1QJH A;  1S9G B;  1ZTT A;  3D6T B;  5KG4 A;  2OIH A;  4E98 A;  1SBR A;  1CVJ A;  3CDE A;  4FYD A;  1UP1 A;  1P1T A;  2HYI B;  3NXZ A;  1VRT A;  1RAI B;  4RNH A;  4JV5 F;  3NMR A;  2ZM6 F;  3SZ2 A;  1HI1 A;  3QT8 A;  2N4D A;  4PCQ A;  1GQE A;  4R5P A;  2LQ9 A;  1SH0 A;  3CCQ S;  2ADC A;  5G0R A;  3KLV A;  5J2Q B;  4M5L A;  3CJ8 A;  2IM0 A;  5CAA A;  1XMB A;  4OJ1 A;  3IWL A;  3Q22 A;  5CZV A;  2ATC B;  3FSY A;  2UVV A;  5MLC V;  4ED0 A;  4OZ0 A;  3H4D A;  1FRJ A;  3KFW X;  4PG8 A;  2AQ4 A;  2KFN A;  2CJY B;  1F9H A;  3T3F A;  2LEA A;  1S0N A;  4YUD A;  1QLN A;  1OPI A;  3M8Y A;  2YKP A;  1DTT A;  3OD2 A;  2VQF F;  1UW9 A;  3GSD A;  1T0T V;  4LIR A;  1D9D A;  5GAH I;  4DR5 J;  1J5O B;  1ARO P;  2UUA J;  3OL8 A;  5LL6 d;  4A46 A;  4M5G A;  5F8I A;  3KLH A;  1BY9 A;  5EX0 A;  5IQQ A;  1UFW A;  2FC8 A;  2MST A;  1OQ3 A;  3PTW A;  1FEH A;  4R25 A;  4MK8 A;  3D9B A;  4IR1 A;  3CJ4 A;  4RWW A;  2LXF A;  3ZZY A;  3OT9 A;  4PWD A;  2NLW A;  1WG1 A;  1U2R A;  4WTO B;  3EPI A;  1AXQ A;  1R0A A;  1UPM B;  3H5U A;  4ZVO B;  3FQL A;  1WF1 A;  2HQG A;  3NOG A;  2AX1 A;  4TY9 A;  3ETM A;  4J91 A;  5DGA A;  1VCT A;  1FJE B;  2HMI B;  4Q44 A;  4PUO A;  4QR0 A;  3K5M A;  4OV1 A;  1RAH B;  5HRO B;  3IBC B;  1IBL J;  2ATL A;  3SSS A;  4JB8 B;  2WW8 A;  3MF5 A;  1XBW A;  4DL7 A;  4QU6 A;  1WI6 A;  4RUB A;  5D78 A;  1FNM A;  4Y2C A;  3HHL C;  2JOQ A;  2UVW A;  4XPE A;  4USI A;  1D9A A;  3IG1 A;  3S7R A;  5ETR A;  2KM8 C;  2J0S D;  3UQS A;  5C5J A;  4A4J A;  1V9O A;  1RK8 A;  4C8Z A;  3A3O B;  4ECR A;  3EJM A;  1TVR A;  3KJV A;  2MY7 A;  3CCJ S;  2YQ1 A;  2YQ3 A;  2UUB J;  4X62 F;  1UMJ A;  4K8R A;  4L73 A;  3W2W B;  4C0H A;  4LF5 F;  4ED3 A;  2DNK A;  2CAD A;  3TQE A;  4L3K A;  4ZHR B;  1RWN B;  1TZ0 A;  3DLE B;  3O5T B;  4Q7A A;  1UVI A;  2VG6 B;  4N41 A;  3HT3 A;  3K59 A;  4EBC A;  4DHV A;  3PW7 A;  1IBK F;  3BM7 A;  4JV0 A;  3CD0 A;  2V6A A;  4KYZ A;  3KK3 B;  5E33 A;  4JYA J;  2M0G B;  1VRU A;  3UDE A;  2P9C A;  2MKS A;  2KN4 A;  1E6V A;  4U96 A;  2KT2 A;  1KTQ A;  3MPD A;  1LFW A;  4DI6 A;  1ZPW X;  4CP5 A;  1SV5 B;  4JOU A;  5CYQ B;  3T9Z A;  2CNL B;  2ZH6 A;  3RG6 A;  4NI2 A;  4RW7 A;  3T1Y J;  3I56 S;  4H54 A;  4NPO A;  1VBX A;  2IFX A;  1RHJ B;  3G86 A;  4TU9 A;  2U2F A;  2QLW A;  3ZTR A;  4K0K J;  4J9R A;  1FJ7 A;  4R8U B;  2W4P A;  4GKK F;  1PYO B;  1DJ0 A;  1KON A;  3SCI E;  1S9G A;  2MTL A;  4B9V A;  4DSJ A;  3AQO A;  2JHE A;  4ERD A;  5IT9 U;  1HBU A;  3AGZ A;  3PM9 A;  2VFV A;  3B4D A;  1ZAW A;  2QT7 A;  4PZV A;  4MFB B;  5J2Q A;  4PYA A;  2B56 A;  4DSL A;  2KZZ A;  1IR2 A;  2KO1 A;  4I4B A;  2P9G A;  3K5O A;  1FTC A;  4NLR A;  2YY3 A;  4PG4 A;  4ZVG A;  2NYH A;  3BH7 B;  2XZW A;  4WJB A;  4JI1 J;  4CO4 A;  1JLA B;  4X4S A;  2CQC A;  1NKC A;  2CPJ A;  2IY5 B;  2R7U A;  3HI9 A;  3V6J A;  4U7C A;  5ETT A;  1RT5 B;  2ROE A;  3MPU B;  3NL0 A;  1RP5 A;  1U4B A;  3Q8P B;  2HWT A;  2A3J A;  4DPT A;  3ISN D;  4B9N A;  4ZIW A;  1RXO B;  1VS3 A;  3MEC B;  4GVL A;  2BJE A;  1J5O A;  2KHC A;  3CJS A;  4QU7 A;  2VBZ A;  4PG5 A;  4B3R F;  1N0V C;  4OYM A;  1KHW A;  3C66 A;  4QR1 A;  2CUY A;  3K58 A;  1LK5 A;  2KHD A;  4B9L A;  3K8W A;  1PKU A;  2BE7 D;  2ZH2 A;  1DY3 A;  7FDR A;  4NA1 A;  4LR8 A;  1RT7 B;  2YKM B;  4ECQ A;  3UCZ P;  1TKT B;  2UXC J;  4QIG A;  5B0B A;  3Q8Q B;  4DXL A;  3Q8U A;  4UY8 T;  3PJW A;  4K5R A;  2YWE A;  2B4V A;  4O3O A;  2UUC F;  5C42 B;  4BS2 A;  1UJ6 A;  1XIQ A;  1Q7L B;  4WTY A;  5EUH A;  2HMI A;  3C3L A;  4C8K A;  4I69 A;  3ZXW A;  2CKW A;  3BKU A;  5HRO A;  4NCA A;  1TL3 B;  3SI8 A;  5AXK A;  2UVU A;  4AL5 A;  3CCM S;  3CJ0 A;  1FNX H;  3RAM A;  1AFJ A;  3IBW A;  1EIY B;  1EP4 B;  2CAJ A;  3PW5 A;  4MIA A;  2ZH4 A;  1SQE A;  4U9R A;  3A8I A;  1DBD A;  2PA3 A;  2DO4 A;  4K4Z A;  4NYO A;  3OHA A;  1FVQ A;  5K8P A;  3JTN A;  4OYZ A;  1SQF A;  1JLQ A;  3B54 A;  1YJW S;  2BW2 A;  1UFL A;  4LR9 A;  4LF7 J;  3W2W A;  2XC9 A;  3EX7 B;  4P52 A;  1KLN A;  3M2U B;  1RWM B;  3DLE A;  2QLB B;  2VG6 A;  2XYP B;  3MHY A;  5HMZ A;  1RT6 B;  2UU9 J;  1IR1 A;  3S6E A;  1U24 A;  3D5M A;  2HQI A;  2CVI A;  3KK3 A;  4KJI A;  1FJG F;  3FBE A;  2XCP A;  1OPZ A;  3UWT A;  2OH2 A;  3TAP A;  4FF4 A;  2VOD A;  5AXN A;  4PG6 A;  1UVK A;  1SV5 A;  3M1V B;  5KFO A;  5CYQ A;  1KD1 T;  1IJE B;  1DTQ B;  2IJR A;  1YK9 A;  3I31 A;  3PFE A;  4LR7 A;  4ZJO A;  5AE3 A;  3TO8 A;  3BZQ A;  3D3C J;  4FP9 A;  4R8U A;  1YRU A;  5KFH A;  2PEH A;  4OLO A;  3AD9 C;  5B0A A;  4QWA A;  4KPC A;  3X3U A;  5G4D A;  4EUV A;  3GPA A;  1SKR A;  2M5Y A;  3PEH A;  2PN6 A;  2DHH A;  4NLO A;  4DV5 F;  4DUY F;  1DQ8 A;  4MFB A;  2LXU A;  2W4D A;  3BYP A;  3PAC A;  4C7Q A;  1X60 A;  2UXD J;  2AEF A;  2FVP A;  1ICE B;  2BMB A;  1N34 J;  2MGZ A;  4ECU A;  1KQF B;  1PO6 A;  3EZO A;  4NEZ A;  2GQ2 A;  2Y8W A;  5ETQ A;  1CQN A;  4URS A;  3TJA A;  1RT5 A;  5DM6 Q;  3DU5 A;  5ETS A;  2Y0S D;  4QYZ J;  3HDS A;  4ZP8 A;  3MDF A;  3MEC A;  1H38 A;  4CLU A;  5IV3 A;  4ZK7 M;  4OYW A;  1WTB A;  1F9E B;  2ZJR Q;  4P2S A;  3PY8 A;  1KP6 A;  4LFA J;  4ZJL A;  3C14 B;  5AE2 A;  2DNP A;  5GAG U;  4R0E A;  5A2Q U;  5JXS A;  3NLC A;  1VQY A;  1U0S A;  2KI2 A;  4ECW A;  1PC5 A;  1WHY A;  1N56 A;  3BQ1 A;  3ILJ A;  1NHU A;  5KFR A;  4NRT A;  1ULR A;  1TKT A;  2H54 B;  4ANE A;  4HHH A;  3UE2 A;  1GNK A;  2CJX B;  4ZVF A;  4YDX A;  4FF2 A;  2MSS A;  3V2U C;  2DXD A;  3HHK A;  2KFY A;  2KJW A;  5C42 A;  2E1C A;  3EGZ A;  1UVM A;  4ELT A;  2ILY A;  2G4B A;  5LMU J;  4LBP A;  4EU0 A;  4C9D A;  3AJ1 A;  1TL3 A;  3FGV A;  2VG5 B;  4IH5 A;  2DK2 A;  3VGU A;  4NYZ A;  1LQ9 A;  5AT1 B;  4OV6 A;  1S76 D;  3HSZ A;  2RU3 A;  1EP4 A;  2F8H A;  3G2X A;  2EFP A;  1NHV A;  1S9F A;  2B9Y A;  4IG0 B;  4PRF A;  1I6J A;  2BVZ A;  2E5L F;  1O8B A;  4QCL A;  4DR1 F;  4O3P A;  2UV8 A;  4OHW A;  4UQG A;  4O23 A;  1TL1 B;  4QWC A;  4CLZ A;  5AXM A;  1XNQ J;  1YKW A;  2FLO A;  5D0R A;  3IGV A;  4AFF A;  3MZI A;  2ZOF A;  2M4M A;  3M8Z A;  1SCJ B;  4N77 A;  3QO9 B;  3I32 A;  1Z1Z A;  2LYV A;  2A18 A;  3EVO A;  3F44 A;  4DOZ A;  4G3I A;  4YN3 B;  1RA7 A;  4M94 A;  3AGX A;  4B3S F;  4LMZ A;  1NPP A;  2RQC A;  2C2Z B;  2C3P A;  2FD2 A;  1WC1 A;  2ZHB A;  4CDI A;  2W9C B;  2QTW A;  1VGY A;  2DGT A;  4M5J A;  3SXL A;  1N48 A;  3TWZ A;  1F2H A;  1RT3 B;  3R5D A;  2BV3 A;  1QSS A;  4ZVP B;  3M1V A;  2BBE A;  3W63 A;  2JRS A;  4PXB A;  3FCV A;  3G8T A;  2PMH A;  4J90 A;  2CQG A;  3W9H A;  4YHH F;  3D1Q A;  1XN9 A;  4XK8 C;  4DFJ A;  1GH8 A;  2PA8 D;  4HT5 A;  3U27 A;  2RRN A;  2CQ3 A;  2H9Z A;  3GSI A;  3CCE S;  4FXW A;  2HRY A;  1FRK A;  1I94 J;  3PW4 A;  4IFY B;  2KYX A;  4NXN F;  4LF9 J;  2H51 B;  1N5Q A;  4M5H A;  4C8N A;  3QAU A;  3MR6 A;  1F6T A;  4UY8 5;  1B4S A;  1C4A A;  1X5O A;  3N6N A;  3KMS A;  2Q66 A;  1HFE L;  3UDC A;  3BSO A;  1LKZ A;  1WOS A;  3THT A;  4F67 A;  4E2F B;  3GON A;  4KFB B;  4QOT A;  4YFU A;  4ID5 B;  2R8J A;  1S99 A;  3CWJ A;  2X1A A;  4DV4 J;  3CC7 S;  4FDF A;  3OTE A;  3C16 B;  3QJL A;  3IFE A;  4A8F A;  3PRV A;  4N5S A;  1N5V A;  5LSO A;  4N76 A;  4DMZ A;  1KS2 A;  2ZBR A;  2V8G A;  4L72 B;  4CLP A;  1RTH B;  2PSZ A;  4MK9 A;  3SQG B;  4BHQ A;  4DN0 A;  1TUV A;  3KG4 A;  1ZTW A;  3MUV P;  1S12 A;  4EI2 A;  3ZZO A;  3C14 A;  1HR0 J;  2VV5 A;  1TR0 A;  4KHP J;  1BHN A;  1TU0 B;  4OZJ A;  5I3Q A;  1I3O B;  1BWV A;  5KOX A;  1B99 A;  1VC0 A;  3ENQ A;  3HUL A;  2VU5 A;  4GO5 X;  2EKN A;  5L1K A;  4HVZ A;  3LOU A;  2VFS A;  3MM9 A;  1S0V A;  3RYL A;  2FVS A;  1MSW D;  3FCH A;  1G6B A;  4I7F B;  1S1X B;  3KDO A;  4ITS A;  2OEK A;  3DMJ B;  1KSP A;  4PYD A;  2AJ0 A;  3CD6 S;  1MWZ A;  4X64 F;  1WKJ A;  3W5Y A;  1CPZ A;  1N5Y A;  3R7B B;  2F3J A;  4F2S A;  4DV7 J;  4DR3 J;  1WG5 A;  4ZP6 A;  3DLB A;  3SCJ E;  2Y9H A;  1NBE B;  2VG5 A;  3A8K A;  3VAM A;  2XGQ A;  2GAH C;  2YWW A;  4NL5 A;  4FKY A;  1S4F A;  4ZN3 A;  3AA8 A;  5D4L A;  1M5V C;  4N8O A;  4ETZ A;  5KFV A;  4UQT A;  3M6X A;  4IG0 A;  2KVQ E;  2HBY B;  4L6V 3;  4MKB A;  5KTQ A;  2V2V A;  2QA4 G;  2HVZ A;  4LF1 A;  2VPZ B;  1X8D A;  2L41 A;  4DJB A;  2M8D B;  1VQ9 S;  4XAK A;  5ADZ A;  2JDJ A;  1YGY A;  3GR1 A;  4X4U A;  2YNF B;  2AWZ A;  1NK8 A;  2B5J B;  4FNI A;  3BBB A;  1ZS6 A;  1UL3 A;  4NYP A;  2AYG A;  2F9D A;  1W7W A;  3QIP B;  3Q8V A;  4ED7 A;  4J9S A;  4DSK A;  1FWK A;  2UXB J;  3KXD A;  4QR2 A;  1OQ6 A;  2GZO A;  2W9C A;  2RE1 A;  1Q81 T;  2MZJ A;  4DX5 A;  2AJF E;  1RT3 A;  1KR4 A;  1UVL A;  3TAM B;  3IGN A;  4FNH A;  3R7N B;  2BYC A;  3D1H A;  1H7X A;  2V0N A;  3MM5 B;  4I56 A;  4J9M A;  5C24 B;  2DRB A;  4HYK A;  3WX8 A;  2P2C B;  1SUQ B;  3OR2 B;  3PKM A;  4ED6 A;  4Y2K A;  1SJ3 P;  2QO3 A;  3DC2 A;  3ZTS A;  2QJ3 A;  3Q89 A;  2R8I A;  1KVI A;  4JV5 J;  3D28 A;  2ZM6 J;  1M5P C;  4IFY A;  5DLG A;  2M70 A;  1GXL A;  4TLR A;  2WOM B;  3C5X C;  3UCG A;  2JEI A;  3NAI A;  1NB7 A;  1DHM A;  4UST A;  3DHW C;  3VWS A;  3LAK A;  3I38 A;  2GML A;  5F9L A;  3B6B A;  4DLG A;  1NK7 A;  1L3T A;  4LQ9 A;  4KFB A;  2A2D A;  1IQT A;  4ID5 A;  1U1N A;  2DIU A;  1FTR A;  3HHL D;  1JJ2 R;  1X7V A;  4NLY A;  1FDN A;  3OFG A;  2R7O A;  2MQL A;  3C16 A;  1IKX B;  2VQF J;  2LU1 A;  4B3T F;  4F4X A;  1RTH A;  2JZ8 A;  2RIJ A;  3SQG A;  2XMM A;  4B9M A;  3NG8 A;  1MMD A;  2DRD A;  4KBI A;  1MWY A;  5KT2 A;  4NRU A;  3R3T A;  3IAS 9;  5T7L B;  5GAE U;  2SXL A;  3M6V A;  2O66 A;  2D3U A;  1FX2 A;  3MMC B;  1NJZ A;  3R6G B;  2GJ2 A;  1HBM B;  2PII A;  4W4M A;  3P3D A;  2N4C A;  1KFD A;  5C7P A;  3VAI A;  2RHQ B;  1VRQ C;  3EPG A;  2E9R X;  3N28 A;  2GIF A;  1CUL B;  3HKZ D;  1ZA1 B;  4I7F A;  1S1X A;  1VLO A;  3TW0 A;  2ZWO A;  3DMJ A;  3GQC A;  3PYG A;  2DHX A;  2MLZ A;  4YEA A;  2CVE A;  5BJR A;  3I4P A;  5HI7 A;  3AY0 A;  2RUS A;  4LT6 A;  5J2M B;  1TKD A;  4Y3C A;  1LNQ A;  1M1G A;  1R8H A;  4ECZ A;  1EKR A;  4OYO A;  1VIO A;  2XMU A;  3AD8 C;  3IRW P;  3L7U A;  4UOF A;  1V3Z A;  2Z57 B;  1XNR F;  1IBM F;  4B08 A;  3M8Q A;  2E66 A;  1FXR A;  3BYR A;  2I6W A;  1Q5V A;  5CCL A;  2XMT A;  1GX5 A;  4WBF A;  4EYH B;  4NWB A;  2ZBC A;  3FFI B;  4K5S A;  3K5N A;  2BEF A;  1JLC A;  4JI3 F;  1YJ7 A;  5CQG A;  3QLH B;  4WE1 B;  5FJ4 A;  4X62 J;  1SC4 B;  4DQR A;  1NJI T;  3HO1 A;  5GAG I;  4LF5 J;  5HMX A;  3GV8 B;  3QID A;  2WZ1 A;  2OSQ A;  1FFS B;  3PDN A;  4DZD A;  1WHV A;  1Y5N B;  2XS7 A;  4MT1 A;  4F7V A;  1MG7 A;  2R9L A;  4K50 A;  1VK3 A;  4HH1 A;  2H4Y B;  3VGV A;  4HLB A;  4YR2 A;  3O2I A;  2IRU A;  4WXO A;  3HFV A;  2XCA A;  2VBX A;  4WK3 A;  2Y0B B;  3MPY A;  2ZH9 A;  1HNI B;  4DSI A;  1S7I A;  1TTH B;  2D1C A;  1YZ7 A;  2OAU A;  5I42 A;  4CWB A;  1NB2 A;  3D6H B;  3TAM A;  1R0B G;  2BM0 A;  4CNY A;  1OO0 B;  3UW1 A;  4U67 Q;  4DV1 J;  2VIH A;  1PJ7 A;  2XO7 A;  1Y5I B;  3OSP A;  3H8Y A;  3MM5 A;  5K5M A;  4ED1 A;  4GKK J;  3PR5 B;  2R7T A;  5IZH A;  2HK3 A;  3PXG a;  2M2B A;  1FKA F;  2DNL A;  5LM7 E;  1SUQ A;  3OR2 A;  3A3N B;  3MAA B;  2XHC A;  1BXN A;  3V4I B;  1U7L A;  4NLQ A;  3RB4 A;  1S6Q B;  1N5T A;  3KK1 B;  2Q2G A;  5AE1 A;  2K3I A;  1NND A;  4NA2 A;  4ZLP A;  2WOM A;  2J7U A;  2AZ1 A;  1K47 A;  1R6V A;  2EXU A;  1RBA A;  2GHV C;  2ZKU A;  2KL8 A;  3GFZ A;  1HMV B;  1Q53 A;  3SV3 A;  4ES2 A;  4RX6 A;  3G87 A;  3J81 j;  4PR6 A;  1JLB B;  3KG0 A;  3MXH P;  4CT9 A;  3KYL A;  1LXN A;  4IDK B;  2WVE A;  4KSE B;  5CH7 B;  1WDD A;  1MML A;  2HIY A;  3R9L A;  1F0X A;  1EX8 A;  5HJY A;  4JUZ A;  3NKY A;  1NEE A;  2RML A;  4LQ3 A;  2BKO A;  1Q78 A;  2A2C A;  4A8W A;  1NDP A;  4DV2 F;  4B3R J;  2BA9 A;  1VQL S;  2EG1 A;  3SDE B;  5E2Q A;  4PG7 A;  4ZN1 A;  3GCW P;  1R8P A;  2M9K A;  3PRD A;  2GA7 A;  3MED A;  2W4C A;  2OPS B;  4FPR A;  2E29 A;  2VON A;  3MMC A;  3U02 A;  1CBK A;  2WB1 D;  1HBM A;  1MNE A;  1VQ7 S;  1V3R A;  4ZIT A;  3KKF A;  2XS2 A;  3ZZU A;  2WRM A;  4ZPD A;  2G1D A;  1GX6 A;  4O0N A;  1CUL A;  1KWM A;  1T9Y A;  2K7J A;  2H5E A;  3LTO A;  1SL2 A;  1WI8 A;  2L08 A;  3J7A 1;  4UUX A;  3JSB A;  2QA2 A;  3N79 A;  2UUC J;  2BZ2 A;  1JLG B;  3ZZP A;  1RBL A;  3O44 A;  1LWC B;  3KJQ B;  1L3K A;  5CA5 A;  5J2M A;  4KY3 A;  2H5I B;  5CCM A;  1P9Q C;  4O44 B;  2X3G A;  2K06 A;  1OJ4 A;  2WK4 A;  4QYZ K;  2BAB A;  2AEJ A;  2KM8 B;  2DHG A;  2HHW A;  2V2K A;  2OP5 A;  4WP9 A;  3DOM B;  2BAC A;  1B7Y B;  2XY5 A;  2QLX A;  3QMQ A;  3SEO A;  2J9C A;  3DRP B;  4BC9 A;  1VQ6 S;  3FFI A;  4I6Y A;  3H2L A;  2IYG A;  1YJV A;  4ECX A;  4XPC A;  4P72 A;  2KB2 A;  1SJ1 A;  1IWG A;  3TUP A;  2RRB A;  3DKD A;  4JI5 F;  4EGL A;  1PYS B;  3HJF A;  1Q5Y A;  3CCV S;  3TEH B;  4C8L A;  3BEG B;  1G1X A;  5E3Q A;  3AA9 A;  2G2O A;  4HKQ A;  1AYE A;  5K9F A;  4DV6 F;  1R27 B;  1NSP A;  3PNI A;  2JJ4 D;  4N47 A;  3DDN A;  3PX0 A;  4HI1 A;  1HNI A;  1FO1 A;  2HVD A;  2PFD A;  4KKO A;  1URN A;  4U6P A;  2Z8Q A;  3M32 B;  4E8U A;  3LGM A;  3W62 A;  2GGP B;  2DVI A;  5HLF B;  1Q82 T;  3P45 B;  5DG7 A;  2ZNY A;  1W2I A;  4RNM A;  3W8P A;  4X66 F;  3W61 A;  2CIM A;  3RTV A;  2DO0 A;  2B9E A;  1B0T A;  5DDP C;  3V4I A;  2LQ5 A;  1S6Q A;  1GT8 A;  3LUY A;  2GC8 A;  1WC0 A;  3TR5 A;  1JX4 A;  4W92 B;  4QJV A;  4DUY J;  3QRP A;  3W2V B;  1Q86 T;  1M5K C;  2LKZ A;  1TMM A;  2JX2 A;  1JXL A;  2B51 A;  2D41 A;  4P2M A;  1Y7P A;  1NUE A;  3GWC A;  4ZPA A;  2DEI A;  3MCM A;  3A12 A;  3T5K A;  1Q8K A;  1RT2 B;  1D8Z A;  3P5T L;  4DFM A;  1JLB A;  1IVZ A;  2HHH F;  1JLE A;  3FNN A;  4IDK A;  5DS7 A;  2HLT A;  4CO0 A;  3CB4 A;  2ZH8 A;  4Z7C A;  1D3W A;  3KLE A;  4TXS A;  2HNY A;  4I2Q B;  2CQ2 A;  3BBF A;  3J7Z T;  1VMB A;  5K14 A;  3I55 S;  1SC6 A;  1YDL A;  3AQP A;  4ZCL A;  3ILO A;  4ED5 A;  4DR6 J;  3SDE A;  3CPW R;  2CXE A;  1SC3 B;  2AHO B;  1S79 A;  4HHJ A;  5F41 A;  2HS4 A;  2E9Z A;  2APO A;  4IRD A;  2Q3P A;  3VF0 B;  5CYM B;  1H6K X;  2MKC A;  4PXD A;  2Z56 B;  4M5N A;  3EDQ B;  2B8Q A;  2CG4 A;  2VHG A;  3BO3 A;  1LXJ A;  3NNC A;  3PJ9 A;  1HAR A;  2VDH A;  2BR0 A;  1JJ4 A;  4FS1 A;  3D0H E;  2HGN A;  3IWN C;  4JI2 F;  1IXK A;  2B0G A;  3CMA S;  5HVH A;  1I1G A;  2R8G A;  2VAS A;  1UZD A;  1ZPV A;  1RHQ B;  2X1F A;  1SJ4 P;  3MMA B;  1IKV A;  4G1I A;  1JLG A;  2LQJ A;  3KDN A;  1LWC A;  3TNV A;  5LOQ A;  4PAA A;  4IKA A;  2MLX A;  2EBG A;  5HSP A;  3LAL A;  3C6E C;  4FBU A;  5KFM A;  3EXY A;  2PMW A;  2HK2 A;  2RQK A;  2DR8 A;  4O44 A;  3OJS A;  3RBZ A;  4ZS6 A;  5F8N A;  4J9U E;  2PC6 A;  2X3D A;  2J6T A;  2FVC A;  3H7H B;  3B82 A;  4IOB A;  3UDV A;  4C8O A;  2WSC C;  1BE4 A;  3DOM A;  4IR9 A;  3RB3 A;  2YTC A;  4LF8 F;  2E5L J;  4DR1 J;  1BMQ B;  3GU0 A;  4IQM A;  3DRP A;  5L9N A;  2I1R A;  2OEJ A;  3NGS A;  4OI2 A;  1UZH A;  3BKT A;  3I5A A;  3IXQ A;  2ZVI A;  3CE8 A;  1RAB B;  2HHV A;  4NLD A;  2IC3 B;  1GK8 A;  4F4A A;  5GAE I;  3THV A;  2IRX A;  4HR2 A;  4DPW A;  2V4J B;  5THW A;  3N9U C;  1FD2 A;  1FRH A;  3K5L A;  3HXM A;  3JQM A;  1Q4R A;  2W2N P;  4B3S J;  1F3V A;  3CVK A;  3CJT A;  3GYX B;  4AXI A;  1U48 A;  2AV5 A;  4ZPB A;  1XTZ A;  1VK8 A;  1FRX A;  1TV6 B;  3MM8 B;  1EQ0 A;  1F5A A;  3RUB L;  2XS5 A;  4WFB Q;  3PZP A;  1SKS A;  4NLW A;  2F9J A;  3MEE A;  3Q2S C;  3C19 A;  3GG1 A;  2GGP A;  3I5C A;  1MLA A;  2MY8 A;  4K2J A;  4YHH J;  1RTD B;  5HQM A;  2XI2 A;  2QYC A;  2FB0 A;  3I0R B;  3PYF A;  3DLG B;  2K1R B;  4F26 A;  2IA6 A;  3CO9 A;  1ROF A;  3T1A A;  2KTQ A;  2FC9 A;  1HWI A;  3KLF B;  1KVJ A;  2CNO B;  5KG1 A;  2CPE A;  4ZCI A;  4GVB B;  1UPP A;  5D0G A;  4NXN J;  2RS2 A;  4P2X A;  3BGF A;  3BRE A;  4FVC A;  1I5O B;  4XTT A;  3CC4 S;  3CXC R;  4FN5 A;  4DCO B;  2YNG B;  3W2V A;  2JC0 A;  3OXL A;  1X9S A;  2R42 A;  2ZBP A;  3SBM A;  1S57 A;  2GIR A;  3Q2T C;  2OTJ S;  3V6D A;  1MWQ A;  3MUR P;  4K2X A;  3JS9 A;  1OSC A;  1X5T A;  2A0F B;  2EEY A;  3F41 A;  3GJQ B;  1FWP A;  3ZC4 A;  2RU9 A;  2ODX A;  3ZFV A;  1Y11 A;  3QJJ A;  3EGW B;  1LOU A;  4AT1 B;  3TUI C;  1KNZ A;  4I2Q A;  3WC2 A;  3D68 A;  2O1P A;  5EN1 A;  3SV4 A;  1V3S A;  2B4O A;  2F65 A;  3R27 A;  4DZ6 A;  2BOA A;  3L7P A;  3MAH A;  5KT5 A;  2XBP A;  3NS5 A;  2ZNZ A;  5GAD U;  2FJV A;  1X31 C;  2R2S A;  3A8J A;  4O3S A;  4KT0 C;  2D74 B;  2DEJ A;  2L3M A;  3LP0 A;  2RHS B;  3T1H J;  3PIO Q;  3U1N A;  2DGX A;  4ZP9 A;  4F4W A;  3JSM B;  2PI4 A;  2UUT A;  2VFU A;  4LBI A;  2E44 A;  1FF2 A;  4L76 A;  1J5E F;  3DYA B;  1OSD A;  4ATN A;  3R6L B;  4M5D B;  1RGV A;  2GW8 A;  1S9E A;  4WK1 A;  3SQO P;  1YRT A;  5E3C A;  5D3G B;  5FDL A;  4JBC A;  1HKA A;  3ISZ A;  2XLK A;  4P7T A;  3SMZ A;  4CO2 A;  1BD6 A;  1AUS L;  3QYY A;  4IQX A;  4Y34 A;  2PDA A;  4XDC A;  3POT B;  1X4C A;  2FJD B;  2DGV A;  3VQT A;  2ZH1 A;  3K57 A;  4ILM A;  1VYA A;  2ZC4 A;  3LWM A;  2G9O A;  2PE8 A;  4Y65 A;  5HMW A;  4OYP A;  1NSQ A;  2QMW A;  1PBU A;  2COL A;  3CDA A;  4A8X A;  1FES A;  4DX7 A;  1U1P A;  4CT8 A;  1FCA A;  1NPR A;  1Q0N A;  2IC3 A;  3EZU A;  1HD1 A;  1VBK A;  2CWX A;  2DT9 A;  4K4T A;  3DI6 A;  2HFN A;  2V4J A;  1N32 F;  2ZOG A;  2YQ0 A;  3BV8 A;  5IM0 B;  3QAT A;  3IC1 A;  5KOW A;  2F4V F;  1VQ5 S;  4DV0 J;  2HQD A;  2W24 A;  2QGF B;  2CG8 A;  1ZM3 A;  1U2F A;  2H5J B;  1TV6 A;  3QGI A;  1HD0 A;  3RW6 A;  3H2V E;  2B7C B;  2FYX A;  3JB9 k;  1SL1 A;  2C2E A;  1A6L A;  4Q0B B;  4Q45 A;  1U02 A;  2NUU G;  4I2P B;  4LFB F;  1QE1 B;  4OHV A;  4ZLL A;  4LSN B;  3J7Z 5;  3OVA A;  3M6W A;  5ETL A;  3DHX A;  1RTD A;  3KLG B;  3MOJ B;  5HK4 A;  1EAY C;  4PKD B;  3I0R A;  3DLG A;  3UR3 C;  4AD6 A;  2YH0 A;  3FEX B;  2K1R A;  1FE4 A;  1FWL A;  2YWF A;  4UW2 A;  2I0X A;  4EWT A;  4FYY B;  4X4Q A;  4GVB A;  2VQE F;  3KUG A;  2P6T A;  1RT1 B;  1FRL A;  3TX8 A;  2EFV A;  1SB6 A;  1HNZ J;  2YNG A;  3J81 Y;  2EFO A;  3CDW A;  4LFC F;  2XYG B;  3JSY A;  2DGW A;  2DNZ A;  4CI0 B;  1TUG B;  1NRK A;  3KHR A;  2EVZ A;  3CGI A;  5IXU A;  5IQ6 A;  3UDL A;  2NXU A;  5B0F A;  2CPH A;  4ZPV R;  3PHT A;  4C97 A;  3AD7 C;  2QLF B;  1U8W A;  2HSE B;  2J6U A;  4GO7 X;  3TZX A;  4UZB A;  2UP1 A;  2VIC A;  4JP8 A;  3BSN A;  4B3T J;  4XIU A;  5DDR C;  3OLA A;  3BS9 A;  1Q8L A;  2NXE A;  7FD1 A;  1WF2 A;  2PI5 A;  1SKU B;  1FE0 A;  1UCN A;  2HRT A;  4DG1 B;  1WC4 A;  3QAE A;  2ZZM A;  1RAC B;  4ZVQ B;  3SFG A;  1SQG A;  3AHP A;  2G13 A;  3D66 A;  5DJB A;  4PXC A;  5L46 A;  2HFZ A;  3JSM A;  4FYV B;  5KFS A;  2C3U A;  4G1Q A;  4BCA A;  1X0P A;  4OI6 A;  2V94 A;  1R6Y A;  3SFU A;  3DYA A;  1S0M A;  2R2T A;  2ZIT A;  2DXE A;  4IYQ A;  4M5D A;  4FF3 A;  5ETP A;  2KXN B;  3W9I A;  5BYQ A;  1YJN S;  3L7O A;  3DN9 A;  2IBK A;  2OD4 A;  1U25 A;  1KEK A;  3DDK A;  3EYZ A;  4K4V A;  1SVD A;  5J1E B;  1R31 A;  2FHJ A;  2PO4 A;  2L48 A;  3I82 A;  1XNR J;  4TVA B;  1IBM J;  1SXL A;  4PWD B;  1RAG B;  3PEJ A;  3POT A;  4WCE Q;  3S01 A;  4ALZ A;  1VQK S;  1PJ6 A;  4CQ1 A;  3U1M A;  4O4R A;  3GCX P;  2FLN A;  9ATC B;  5KFY A;  3VHQ A;  4JI3 J;  4J9K A;  1HNV B;  2IA0 A;  2LQ8 A;  2DHA A;  2VKZ G;  4TU8 A;  2QMX A;  2GO8 A;  3BN7 A;  4FYW B;  4ZPC A;  3GIR A;  4RBU A;  4DX6 A;  3PYD A;  2IMW P;  2DH8 A;  1T94 A;  3OSN A;  4KTQ A;  4RW8 B;  1VQP S;  1KOH A;  3ILL A;  1WDT A;  3H42 A;  1SIW B;  1CLF A;  5IM0 A;  3KUE A;  1JMT A;  1K8A T;  2VZ9 A;  1NME B;  1R3N A;  3DLL Q;  2AYB A;  3BQ0 A;  4N7T A;  5KFT A;  2HHS A;  1N5S A;  2DCL A;  3JTP A;  4GC6 A;  2IIH A;  3D0G E;  3OXF A;  4Q0B A;  3KJV B;  2VA2 A;  4I2P A;  1QE1 A;  3MEG A;  4ER8 A;  2JRR A;  1YBT A;  4LSN A;  3IWX A;  4RBT A;  8RUC A;  4AL6 A;  3RJM B;  3GG0 A;  5B0G A;  2WON B;  3G6X A;  2HAF A;  4OZ2 A;  3NGU A;  2I5J B;  2XGP A;  3L9Z A;  2YNI B;  3BSA A;  3KLG A;  4B9T A;  2FGO A;  2NZ4 A;  1XEZ A;  4OYX A;  4ELU A;  2QE5 A;  1UKU A;  5FII A;  5KT4 A;  3QRR A;  1VC6 A;  2H4W B;  4G1P A;  3U1L A;  4J5O A;  2E5I A;  3GZ7 A;  2BKN A;  2RAQ A;  3GFY A;  4ANC A;  5LSL A;  1VRU B;  2XMV A;  1WJ9 A;  3RBE A;  2MQP A;  2CJA A;  1T9W A;  2GJI A;  1AUD A;  1RT1 A;  2GAG C;  2XO6 A;  1HWU A;  5DQG A;  4RW7 B;  4UUW A;  1F5B A;  3THP A;  5HL7 Q;  2HFU A;  2R4F A;  3Q8S B;  3KHL A;  5J1P A;  3W66 A;  2PMZ D;  3WX4 A;  4YOE A;  3LZ8 A;  2HKE A;  3HX9 A;  1S59 A;  1QDU B;  4FYX B;  4X4O A;  2BJ3 A;  3RR8 A;  2F63 A;  5ETO A;  1U49 A;  2R8K A;  1CQM A;  3J7Y U;  4HHU A;  1HBU B;  1X5S A;  3ET6 B;  4CLS A;  1WD6 A;  4DV2 J;  3OPK A;  4I68 A;  1DQA A;  4ZJQ A;  4DR7 F;  4PWU A;  5B09 A;  1ZYQ A;  4LJM A;  4DG1 A;  2RDI A;  3OQ2 A;  1YJU A;  1G3O A;  2J8A A;  2V50 A;  3M9N B;  2V67 A;  1YHQ S;  2YPY A;  5A76 A;  1VOM A;  1XQI A;  3CCL S;  4L3N A;  2JEF A;  4OZN A;  1IBC B;  3CCZ A;  3GII A;  1TL4 A;  4WXW A;  3QPI A;  3N6L A;  5E5N A;  3B78 A;  1X4B A;  4S0M A;  3UNG C;  3WIU A;  1TFY A;  2HQ3 A;  4DL6 A;  4QWE A;  5GMD A;  1N52 B;  1NAQ A;  1SIZ A;  4FZV A;  2A6O A;  3R1H A;  2CDR B;  3MFH A;  2YX1 A;  3K2Y A;  3MD1 A;  5J1E A;  2BJ7 A;  1GAO A;  5FD1 A;  1LW2 B;  1MN7 A;  4TY8 B;  2CFX A;  2C2K B;  4DFK A;  4EYI B;  2PGC A;  4HEA 9;  4CNZ A;  4DWI A;  1HNV A;  3OFE A;  2KG0 A;  2MKY A;  1IUJ A;  1UVN A;  3EVW A;  3F73 A;  2MZS A;  2UV8 G;  5LT5 A;  1HW8 A;  5GAD I;  3T19 A;  4JI5 J;  1LK7 A;  5HVG A;  3AKO B;  1WSR A;  4URQ U;  3J80 Y;  4RW8 A;  5L1L A;  3NMA A;  1W2B R;  4QWB A;  3ULH A;  3MWB A;  3VR1 A;  4DV6 J;  1PIE A;  3JYT B;  2QEX S;  4JI4 J;  3ENW A;  3Q86 A;  2DNR A;  2LEP A;  2D9O A;  5KAK A;  1T3N A;  3OL9 A;  1JLQ B;  4M5K A;  3M8P B;  4CH0 S;  2ROG A;  4X4R A;  3R5C A;  3QSI A;  3NGD A;  4Q8E A;  2V2Z A;  5LJ3 Y;  3M8W A;  4EMD A;  2O3D A;  2WON A;  3W7B A;  5CAB A;  4YDD B;  2DTJ A;  2I5J A;  2V8V A;  3F56 A;  2XWX A;  2YNI A;  4X66 J;  5KFF A;  4OHZ A;  4ZA1 A;  2DHS A;  2P9E A;  4JI1 F;  2H65 B;  2BRK A;  2GNK A;  1UJ5 A;  3P4U B;  1VR6 A;  3HCX A;  3GP9 A;  1NM2 A;  2HWI A;  1DAX A;  3AFG A;  1JQG A;  1IM4 A;  3OXG A;  2EW9 A;  2JLE A;  1GEH A;  3M30 B;  1E6Y B;  3VAF A;  2H48 B;  1S1T B;  3HZE A;  4MMO A;  4KB7 A;  2ALZ A;  2EFQ A;  1T3O A;  2ZBI A;  1BQM B;  5HVF A;  4KAI A;  3Q23 A;  3BH6 B;  1C2P A;  2HHH J;  1AB8 A;  4UOG A;  3CNQ P;  2JVO A;  5B0D A;  2IRY A;  5A8W B;  1QVF R;  1RAF B;  4OZ5 A;  4IOA Q;  1WF0 A;  3D1O A;  2UXC F;  1QAX A;  3ET6 A;  5DQI A;  3HK2 A;  4LF2 A;  5T14 A;  4JV2 A;  2HUR A;  5H9E J;  4ELV A;  1L5U A;  8AT1 B;  2CQ1 A;  4K4W A;  2RF2 B;  2YWG A;  2RT3 A;  4FVM A;  4NZ0 A;  1W26 A;  2E5G A;  2MGZ B;  1FFG B;  1L3S A;  2OPR A;  4JI2 J;  2LU2 A;  5U47 A;  1D0E A;  2QV6 A;  3ZNJ 1;  1PIL A;  2N7C A;  2IJN A;  4DX8 H;  2GIQ A;  4RNO A;  1HWJ A;  2V9W A;  3UD4 P;  1M5H A;  3R5A A;  3TZW A;  2KRB A;  2J0Q D;  1ZH5 A;  2ZD1 B;  3PG9 A;  4NCB A;  3JQK A;  3K7R A;  4IRC A;  4B3O B;  1F60 B;  4CH1 A;  3QNW B;  2IAJ B;  2J76 E;  3NBP B;  1LW2 A;  2CQ4 A;  3PFO A;  3C6T B;  4TY8 A;  1K9M T;  1YX2 A;  2VL1 A;  3G8Q A;  1RAA B;  3HZG A;  1B70 B;  2UU9 F;  4LF8 J;  3QWP A;  3FZ2 A;  4EBE A;  2F8E X;  5DZ7 A;  1RHM B;  1JIH A;  1TKX A;  4RBV A;  4NX9 A;  1BQN B;  5FLX U;  2JL9 A;  4J80 A;  3CJ3 A;  3FRZ A;  1HHS A;  3M7V A;  2MQM A;  2JZ5 A;  3E3X A;  1O6X A;  2V4Q A;  2RKI B;  3R8Y A;  1YIT S;  3MTK A;  2OFG X;  1GMU A;  1TK0 A;  8ATC B;  2DB1 A;  1H7W A;  5IWA F;  1S1W B;  2BM1 A;  3JYT A;  3I9Z A;  2V68 A;  3EM1 A;  4RKU C;  3A8E A;  3CD7 A;  3G4S S;  5C2G A;  1HA1 A;  1PAU B;  3Q83 A;  3GR0 A;  5EWG A;  1F3F A;  3M8P A;  1OIA A;  1LWE B;  1XK8 A;  3SSR A;  4BWJ A;  3FMB A;  3UFC X;  3W5Z A;  5H1S V;  2OTL S;  1VBY A;  1Q8B A;  2E1R A;  2G0I A;  4ZPW R;  1EAR A;  2BJ8 A;  1QAY A;  3W64 A;  3TQ1 A;  3RAQ A;  2W2P P;  4DL2 A;  2EG2 A;  2PD1 A;  3G6E S;  1H98 A;  2GVD B;  1XWL A;  3QT7 A;  2KKH A;  3M30 A;  1E6Y A;  4Z7Y A;  4LF6 F;  1S1T A;  3BPD A;  2DGU A;  4B3M F;  2ZVS A;  2XEX A;  1NDK A;  3G9C A;  2HVI A;  1BQM A;  3PW0 A;  4E0D A;  4RPF A;  5CZX A;  2Q6C A;  2QLJ B;  2CNK B;  2EI5 A;  3FQK A;  3MR7 A;  3HHD A;  1U8S A;  4M95 A;  1MU2 B;  3NNH A;  1IJF B;  2C2N A;  2ZC3 A;  1CJT B;  4DL5 A;  1C3G A;  2V8H A;  3D7S B;  5A8W A;  1D09 B;  3GYN A;  1S1U B;  1SH2 A;  5IT9 Y;  2Y1J A;  4G6V B;  2V69 A;  1KHV A;  1RB0 A;  1MW7 A;  1S1V B;  5F8J A;  2FTR A;  1U1K A;  3T6B A;  1RWP B;  2MJN A;  2LA6 A;  4A8Y A;  1Z4U A;  9RUB A;  3QZ7 A;  4H4O A;  4OJH A;  2RF2 A;  2J9D E;  2HVH A;  4WYL A;  4DQS A;  3GIJ A;  5LMU F;  3TA2 A;  1FKO A;  2ROP A;  1KOO A;  3P5B P;  2VKR A;  1NJW A;  4J37 A;  4V19 X;  4ZKA A;  3JXO A;  2HBQ B;  2ZDP A;  4Q5V A;  3BO2 A;  4B9S A;  5J2N B;  3RB6 A;  2G1H A;  2AD9 A;  3QRQ A;  3CC2 S;  2O5D A;  1HPZ B;  1M1K T;  4M1K A;  1S4E A;  1VC5 A;  1RTZ A;  2YWH A;  3TUJ C;  2D7S A;  1X4G A;  5HP1 B;  2AMC B;  1VQ4 S;  2ZWP A;  2ZD1 A;  3ITH A;  4JV1 A;  3S8S A;  5EHH A;  4B3O A;  1N33 F;  5KG3 A;  3GB0 A;  5HAT A;  4BDP A;  2IAJ A;  1DZ5 A;  4CH7 A;  1RWV B;  3NBP A;  4DBQ A;  5K8N A;  2KDO A;  2OUG A;  3C6T A;  1M5S A;  3A3P B;  3MM9 B;  3LO3 A;  4HDG A;  3J7Y I;  4DUZ F;  3OJU A;  1TUW A;  2HW3 A;  3ZTO A;  2NQP A;  3KTQ A;  2AU0 A;  2WVF A;  1REG X;  3HVR A;  2FJB B;  4WP3 A;  3ZZ0 A;  2CQD A;  3SCK E;  1S77 D;  2EBE A;  2ZHO A;  1BQN A;  4GMK A;  1ITP A;  1N5Y B;  2NXN A;  3I4H X;  4OHX A;  3KWM A;  4EBD A;  2IHR 1;  4HTI A;  2RKI A;  4ZCM A;  4CLT A;  1FX4 A;  5B08 A;  1N32 J;  3W60 A;  4A47 A;  1Y4Z B;  4LF4 F;  2OFH X;  1RIS A;  3VAH A;  1XR6 A;  1FDA A;  4C11 A;  3FBF A;  3E51 A;  5KG5 A;  2EFG A;  1S1W A;  1SJR A;  3PJX A;  5KT6 A;  4WWS A;  2K8G A;  2E9T A;  2E1A A;  1NHK L;  1RWK B;  3TEG A;  4ETX A;  4LFB J;  1KLM B;  3QBC A;  2WSE C;  3H25 A;  4U8V A;  1LWE A;  1TFW A;  2QA4 S;  3MM6 B;  3FRY A;  2NR0 A;  3NCQ A;  1NZ8 A;  4I6A A;  1R43 A;  2PFF B;  1VJQ A;  1RAO A;  4NZ6 A;  2ALY B;  2OLW A;  3H40 A;  4YB1 P;  1JWW A;  2J6S A;  2VFR A;  2I2Y A;  2GVD A;  2VQE J;  1T9T A;  3PCO B;  1OMS A;  4LRD A;  2M8H A;  4LRB A;  3FSX A;  3VGS A;  5L39 A;  3FEY B;  4QPX A;  4LFC J;  3DXB A;  1QD1 A;  3MFI A;  1YJR A;  4FF1 A;  2NRE A;  1NXI A;  3BDP A;  2YNH B;  3IR7 B;  2O67 A;  3US5 A;  1MU2 A;  2UZA A;  4XDD A;  1JLF A;  3DOK A;  1CJT A;  1JNZ B;  3WDO A;  2IYI A;  3I87 A;  3VGT A;  1S1U A;  4AQY J;  3AT1 B;  2C42 A;  2E5J A;  4K4X A;  1NH7 A;  2QG9 B;  1RE1 B;  4OJG A;  2HRU A;  3HVW A;  1S1V A;  1SL0 A;  4QW8 A;  1O0P A;  1Y0H A;  2Z4P A;  4IFV B;  3JAM U;  3VVT A;  1EKS A;  2FY1 A;  2B4P A;  4X65 J;  2Z2Z A;  1RWW B;  1VFJ A;  4LVO P;  3B4M A;  1B7F A;  3PVX A;  5IT0 A;  1HBN B;  2HZA A;  1RT4 A;  2P8I A;  3R1L A;  1PC4 A;  3AH6 A;  4M63 A;  2C3M A;  2MB0 B;  3NS7 B;  2LCW A;  2ZJQ Q;  2AEM A;  3GTY X;  5EX3 A;  1OWX A;  4UT4 A;  3FKB A;  1X4A A;  5J2N A;  2ACM A;  1HWK A;  3MUT P;  1HI0 P;  1HPZ A;  3C8Y A;  1M1H A;  5HP1 A;  1S49 A;  3GV7 B;  1ZET A;  4UF4 A;  2MQN A;  1BGX T;  1R7I A;  1L3U A;  2XY7 A;  4C3L A;  4WZM A;  1SC1 B;  5A2Q Y;  1HYS A;  4ECV A;  1C4C A;  1RAJ A;  4FXV A;  3HVT A;  1T11 A;  2C1E B;  2IM2 A;  5K20 B;  5HMY A;  3L4B C;  1KVK A;  4DLE A;  4ILR A;  5D0E A;  2Q43 A;  2RVJ A;  5EWF A;  2BJ9 A;  4MH8 A;  6FDR A;  1UAW A;  4GRS A;  2C2M B;  1N36 F;  2R7V A;  4K59 A;  4A8Q A;  5L38 A;  3OTD A;  1V5V A;  2JVM A;  4WKR A;  1H73 A;  3OL7 A;  5M2P A;  4DPO A;  4EEY A;  2IVM A;  4X84 A;  3UD5 A;  3HJV A;  3NWG A;  3BGL A;  3UCU P;  2R7W A;  2VC1 A;  2ZUG A;  3DXS X;  2P5V A;  1BLU A;  2WTF A;  1PGZ A;  3M8Q B;  1WKK A;  1XAO A;  4JI6 F;  2IJF A;  1FT8 A;  2HZV A;  3UI3 A;  4RUC A;  2EFN A;  1YJT A;  2KVI A;  1VIX A;  2J0X A;  3MUM P;  2C2R A;  3RB0 A;  1JLC B;  1K0V A;  4F0K A;  4OFZ A;  1KLM A;  1NDC A;  1YBA A;  1LFP A;  3VV2 B;  4USJ C;  3EGV A;  3MM6 A;  3IS9 B;  3MR3 A;  2B43 A;  4W98 A;  2FHK A;  2KT3 A;  1ACM B;  3UNY A;  4U8Y A;  2OJ3 A;  3QFH A;  2RSQ A;  4H4M B;  4O3R A;  4KIA A;  2VD3 A;  2KT5 A;  2QL7 B;  4DFP A;  4WII A;  2KRR A;  5I42 B;  4DPX A;  4WFX A;  1P27 B;  1UA1 A;  2FJX A;  3L3C A;  4F3Q A;  1RYS A;  1S72 S;  3V81 B;  3OR1 B;  4ZVT B;  3GJR B;  2YNH A;  1S6U A;  3TRG A;  4TQR A;  4HTJ A;  5GME A;  1VHF A;  2F1F A;  3LQV A;  4PPZ A;  2CQ0 A;  4C0O C;  4TQS A;  2ILZ A;  3VZH A;  2QN6 B;  4WFZ A;  3MR2 A;  3RRG A;  2FVR A;  2NPF A;  4Y28 C;  3DGP A;  1I51 B;  4DR4 F;  1YWX A;  2ZFH A;  2B3T B;  3DFE A;  2V8D A;  2ZZN A;  3M2R B;  2BXJ A;  3B8H A;  3BJY A;  3HHN B;  3ZNU A;  4X4V A;  4DR7 J;  2KFZ A;  2CWK A;  4DL0 C;  4IFV A;  2I8E A;  3CO0 P;  3JAM Y;  1FER A;  2XMJ A;  1S6P B;  2GHP A;  4AXJ A;  4DN9 A;  4Q43 A;  1HBN A;  4DS4 A;  1FK9 A;  1FEE A;  1RLD A;  1GMV A;  2DXF A;  2DNY A;  1C1C B;  2GV1 A;  1XMO F;  2WW4 A;  2JWN A;  4V1A k;  3VAL A;  1RLC L;  5EWE A;  3UO0 A;  1VHI A;  1D1U A;  1AZS B;  2DNQ A;  5HQ8 A;  4P71 A;  3H0P A;  5KFQ A;  1A0O B;  2ZE2 A;  4MKY A;  2IM3 A;  1X9W A;  1B0P A;  4YR0 A;  4J9V A;  5D4O A;  2W2Q P;  1WC5 A;  3PX6 A;  1WOR A;  1QSL A;  2DD8 S;  5KFZ A;  2CRL A;  1TKZ B;  4KRW A;  2MQO A;  2R7X A;  3JQJ A;  3DGV A;  3TX0 A;  1Q7Y T;  5D4P A;  3G82 B;  3VAG A;  4F4K A;  3MED B;  4P74 A;  4A8O A;  3R97 A;  1RHU B;  3Q0A A;  3PV8 A;  3MCN A;  5H9E K;  2XTJ P;  1H2T Z;  4EFA C;  1WC3 A;  1VBZ A;  2BE2 A;  1JK9 B;  2MZT A;  4TLQ A;  4MK7 A;  2D3O 1;  2XSJ B;  4NLP A;  4DV1 F;  5LJ5 Y;  1RUS A;  1T8E A;  2YX4 A;  2VOP A;  2LA4 A;  5KG0 A;  2Y8Y A;  5I3P A;  1HQU B;  2WVB A;  2KXF A;  3VVU A;  5HBM B;  4ECT A;  5IS2 A;  5KG2 A;  3PR4 A;  2GHW A;  5LXR A;  1LW0 B;  1LV5 A;  5LSR A;  1X4D A;  1VQ8 S;  3UN2 A;  2CZ9 A;  2A6M A;  1OY8 A;  1VI7 A;  5DRK A;  3BPS P;  4YR3 A;  2RD5 C;  3GE9 A;  1PBA A;  3IO1 A;  2AT1 B;  3I5B A;  2HBR B;  3IS9 A;  2RRA A;  2KJV A;  2DJW A;  1T05 B;  2R2R A;  3PYE A;  2XQC A;  4F25 A;  4Y2A A;  1VQS A;  2E1M C;  2CPI A;  2XNR A;  1YLX A;  3FCW A;  3CSK A;  4YB6 A;  1QSY A;  2AGQ A;  2G0J A;  2E5H A;  1OS5 A;  3FVY A;  1IBK J;  2F7V A;  3C6U B;  4H4M A;  3RGI A;  1HI8 A;  3BBC A;  1UJ4 A;  2KZM A;  4P10 A;  3ADA C;  3EIC A;  3P96 A;  1CEZ A;  4KKO B;  1DRZ A;  2LEC A;  4ZP7 A;  2J7W A;  2KG1 A;  3DM2 B;  2CJK A;  3WIV A;  3UN3 A;  2CQP A;  5A6W A;  2YKN B;  3AOC A;  4DPU A;  3NGT A;  3V81 A;  5D15 A;  3OR1 A;  2QC3 A;  2GQC A;  2LEB A;  1MMN A;  1O5J A;  4K4U A;  4MIB A;  3HT0 A;  1EB0 A;  3C15 B;  2B9X A;  2LFV A;  3DU6 A;  2MZ1 A;  5EDW A;  3CJ5 A;  3IR5 B;  3M2R A;  3CCT A;  4BLG A;  1Y3K A;  2QMU B;  3CUN A;  5IT4 A;  2B8P A;  1D8Y A;  2NUH A;  2BAN B;  4NLT A;  1CSJ A;  1FNO A;  4J9Q A;  1S6P A;  2MLY A;  4ED4 A;  3N4W A;  2FJE B;  2DGS A;  2AIR B;  1JLE B;  3MM7 B;  3GJT B;  1KRP A;  1FD8 A;  1XMQ F;  2B4U A;  1C1C A;  2RIL A;  2R7Q A;  2MQQ A;  2R3V A;  4RUH A;  2LP4 A;  3KLE B;  2HNY B;  2YKA A;  1AZS A;  4AYB D;  3EMT A;  3BGO P;  2C28 A;  1JXV A;  5K14 B;  1RYR A;  5M2U A;  2LQB A;  4ILL A;  4L75 A;  4Q2L A;  3AB4 B;  2JFD A;  4CLW A;  2MKI A;  3NCP A;  3C2P A;  5SUH A;  2AJ2 A;  2U1A A;  4CM0 A;  1YRX A;  1TKZ A;  2DGO A;  3CDB A;  3UVJ B;  5F3Z A;  4OI4 A;  1KKH A;  4OX7 A;  3SIP B;  1S48 A;  3G82 A;  1DAR A;  4ZHR A;  1N88 A;  4P73 A;  2FJW A;  5DZ6 A;  4ICL B;  3O6Q A;  3HKW A;  4OYI A;  4PQA A;  2MYF A;  2FPH X;  4NLU A;  4KH0 B;  4I1T A;  2X7I A;  4JI0 F;  1XC9 A;  2RNE A;  4D3H A;  3RBD A;  1IKV B;  5H9F J;  2QZ8 A;  1FFW B;  1KDN A;  3HP6 A;  2ACY A;  2HS3 A;  4C3M A;  2XSJ A;  4HH0 A;  3E01 B;  3W9J A;  4YS2 A;  4JI7 F;  4F3O A;  4Z2X A;  3V4M A;  1T7P A;  3HHL B;  1D9F A;  2EC2 A;  4LRE A;  1HQU A;  3DOL B;  3G6V A;  1Y3J A;  3CCS S;  5HBM A;  5IWA J;  1JXE A;  4C6A A;  4ECY A;  3GFX A;  1LW0 A;  4U7U D;  2MKJ A;  2W1B A;  1AW0 A;  2POK A;  2RJZ A;  3IA0 A;  5F8L A;  2M52 A;  2VBY A;  3TJ8 A;  3G71 S;  4EZ6 A;  4WKY A;  3ETO A;  1R0C B;  2QL5 B;  3O8W A;  1T05 A;  2LDI A;  4F36 A;  2KXH A;  4MYU A;  1QAJ A;  3M9O B;  2FVQ A;  3PO4 A;  2V63 A;  5E3R A;  3CIZ A;  1JLA A;  1WHX A;  3H5X A;  1TEL A;  2W25 A;  4IRK A;  4RNF A;  3C6U A;  2V2Q A;  3HHE A;  1SPB P;  2CDQ A;  3MGJ A;  1FJG J;  1IKY B;  3QSY B;  2MJU A;  2XNQ A;  2VJV A;  2HGM A;  4LF6 J;  3LAM A;  4F02 A;  3AOA A;  3H5S A;  5ETV A;  2W8L A;  5KFC A;  4ENO A;  4DSE A;  4I0W A;  3MEE B;  4NML A;  4FBT A;  2RS8 A;  3BGR B;  3Q8Y A;  3CF5 Q;  4B3M J;  3DM2 A;  1URR A;  4QZV B;  2Q1L A;  2DNO A;  4OIX A;  1QUP A;  2VJU A;  1U45 A;  1M0S A;  3K17 A;  2YKN A;  4DR6 F;  3HSG A;  1OYE A;  1XR5 A;  2B26 A;  3AJD A;  3FZB A;  2DY1 A;  3CW2 C;  3C15 A;  1T95 A;  1RWX B;  2VC0 A;  1SH3 A;  1Y9O A;  5ETN A;  2CPF A;  2W9B B;  1RT7 A;  4KQZ A;  2YKM A;  3HPO A;  4DR2 F;  2HEK A;  4F0H A;  3PIP Q;  2N3L A;  3R2C J;  1C1B B;  1NSA A;  2WBR A;  3QQC D;  2XI3 A;  2L9D A;  3S1T A;  3T9N A;  1OY6 A;  4DV5 J;  2E7W A;  2E1P A;  5KFK A;  5AJ3 F;  4C2M A;  1UEV A;  4ZVU B;  4ES1 A;  1RU1 A;  5KFN A;  1KQS R;  2YWK A;  2BAN A;  2FZG B;  5JVG Q;  3V6D B;  3M2V B;  2D69 A;  4OYB A;  3CED A;  2XHW A;  2DNH A;  1KFS A;  1CC7 A;  3FBB A;  3BSC A;  1TAU A;  3MM7 A;  1HQ2 A;  2XZD B;  1F2G A;  2XYH B;  2CNN B;  3UD3 P;  2K3K A;  3GJS B;  1L3V A;  3FDS A;  2GVZ B;  3KG1 A;  1NK9 A;  1U47 A;  3Q8R B;  1HNW F;  1LWX A;  1Q1K A;  4Y2M A;  3TJ9 A;  2AF6 A;  4QYR A;  3KLI B;  1GMW D;  2FY8 A;  1BWE A;  3W8G A;  1DFD A;  1MRO B;  3LP0 B;  3ZTQ A;  4ZCK A;  3UVJ A;  5BYS A;  1N33 J;  1RAE B;  2DH7 A;  1TAQ A;  3M2U A;  4ICL A;  2R2U A;  4N56 A;  5A8R B;  2AP6 A;  2VBW A;  2XWY A;  1Z2L A;  2VPY B;  1RT6 A;  2H3E B;  1ZM4 A;  2QRR A;  4K4S A;  4DUZ J;  4KHM A;  4USW A;  4TYA A;  3OFF A;  3CJK B;  3BO4 A;  3OL6 A;  2F4F A;  1NDL A;  2ZUA A;  3CCU S;  5L8R C;  4YME A;  1S9E B;  2W7A A;  3EUN A;  1G2E A;  3ZZR A;  5DG8 A;  5FDL B; 
#chains in the Genus database with same CATH homology
 3I38 A;  2Q2G A;  1GMW A;  3L9Z A;  1EB0 A;  1GMU A;  3TJ9 A;  1NLT A;  3TJ8 A;  1C3G A;  1GMW D;  3AGX A;  3AGZ A;  3AGY A;  1EAR A;  2HFV A;  4J80 A;  2QLD A;  3NXZ A;  2B26 A;  3NY0 A;  3LZ8 A;  4L3K A;  1GMV A;  3TJA A;  3LA0 A;  1XAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...