1EB9A

Structure determinants of substrate specificity of hydroxynitrile lyase from manihot esculenta
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
262
structure length
262
Chain Sequence
PISKMVTAHFVLIHTICHGAWIWHKLKPALERAGHKVTALDMAASGIDPRQIEQINSFDEYSEPLLTFLEKLPQGEKVIIVGESCAGLNIAIAADRYVDKIAAGVFHNSLLPDTVHSPSYTVEKLLESFPDARDTEYFTFTNITGETITTMKLGFVLLRENLFTKCTDGEYELAKMVMRKGSLFQNVLAQRPKFTEKGYGSIKKVYIWTDQDKIFLPDFQRWQIANYKPDKVYQVQGGDHKLQLTKTEEVAHILQEVADAYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure Determinants of Substrate Specificity of Hydroxynitrile Lyase from Manihot Esculenta.
pubmed doi rcsb
source organism Manihot esculenta
molecule tags Lyase
molecule keywords HYDROXYNITRILE LYASE
total genus 94
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2001-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1eb9A00
1K63A 5AM3A 3ZLVA 5IKXA 4HTAA 4I3FA 2C0QA 5ALNA 5JAHA 2DHDA 1YR2A 2RONA 4E11A 1XZDA 3G7NA 3WA6A 1XZHA 2JGEA 4P9NA 1Y37A 3DS8A 1N1MA 4FFWA 1FFEA 5JATA 1JU4A 4WDQA 1JFRA 4X00A 1E5TA 4GDMA 1SOMA 3RM3A 4LYEA 1ZD2P 5LZ7A 2XMRA 4Y2PA 1A8QA 3TGLA 3G02A 1XZKA 2DHCA 1F0PA 3I1IA 3WK4A 4BC0A 2RIPA 1BROA 2CUTA 3EIOA 2HA5A 1TQHA 2XQGA 2BGRA 3PF9A 3QMWA 2OPHA 1H2XA 2XUKA 1QIIA 1UOOA 3R3YA 4MEBA 5LZ5A 2RI6A 2XE4A 1A8SA 4QE3A 2HHAA 1AC5A 5AI6A 4G8CA 5HF5A 2V97A 4PQEA 1VOTA 3QMMA 1LGYA 5HF6A 1BN7A 4L72A 2PSFA 5FOQA 4B0PA 3DKRA 3WK8A 4B9EA 4HS9A 4G8DA 1CUBA 2V96A 1QFSA 1ZI6A 1EA5A 4HVTA 2B9VA 1FFAA 5DNWA 2WTNA 5YASA 5I9IA 5CMLA 2XUAA 3JW8A 4L9AA 1PFQA 5C81A 2BUCA 3ICVA 3GROA 3WIBA 5K3EA 4JH0A 5JD5A 4X95A 3BE8A 5AIAA 5KBYA 1XZIA 4UBMA 1ZI8A 3WMRA 4DNQA 2X5XA 3R3ZA 1CUFA 5AK6A 5LKRA 1MT3A 2HU8A 1J1IA 5HF9A 2C4HA 5JADA 4GLBA 1VE6A 5AI5A 3WL8A 2DQYA 2RHWA 4K6GA 3R41A 5AKIA 1CR6A 3D7RA 1K4YA 1GQRA 2YASA 5AKYA 1EDBA 3C45A 3F98A 4FLFA 3SWWA 1CUAA 3DQZA 1LZKA 3KSRA 3FYTA 1ACLA 4KE9A 2PSHA 5T4EA 1DTEA 3FLBA 3IA2A 4EY8A 3V1LA 3I2IA 4UFPA 2PBLA 4W9RA 5A2GA 1GPNA 3C6BA 4DMCA 3WI7A 4C4XA 4F21A 1MNAA 3WWCA 1QLWA 5E4TA 2BUBA 1BE0A 3LIIA 5AK4A 4ETWA 2XUPA 2HA2A 4Q3OA 1K8QA 3G8YA 4IH9A 3PUIA 1DWOA 1XZMA 3BF8A 4X93A 4QEKA 2R11A 1X2EA 3A6ZA 4KE7A 1RWQA 4EUSA 3F9CA 1ISPA 2VT6A 5ALHA 3V9AA 3WJ2A 2VF2A 5AIBA 1QO9A 1MX5A 4RE6A 2EDAA 2DHEA 5J3JA 1QIHA 3S8YA 4Y2TA 4YPVA 4KAAA 2OCIA 3LIPA 2FUKA 4UBNA 1GQSA 3E1GA 2FJ0A 4UFOA 3VVLA 1THGA 2QOEA 2P8SA 5ALSA 2ZYRA 3EQ8A 2OAEA 3EQ7A 5E2IA 5C8XA 4B0OA 1LPPA 4OU5A 1YAJA 1O6GA 4AZ3A 1WB6A 2HRQA 2IX9A 3WKEA 1HL7A 4F0JA 2XUIA 4ZI5A 1BCSA 1A7UA 4H7FA 3H2GA 3LLCA 2VTVA 5I8PA 4N8EA 5CT8A 4B6GA 3C43A 1ZOIA 5JD4A 2ZYIA 3BJMA 4AN1A 2ONCA 2LIPA 1ZGBA 1UT6A 4U2EA 3HACA 2OGTA 3JYHA 1W1IA 3PI6A 4WFKA 4WY8A 5SYMA 3BIXA 4AN0A 2I03A 1CUWA 4BB0A 1CRLA 3DDUA 5K3AA 2VJBA 3Q8WA 4IQ4A 1SFRA 3QVMA 3PE6A 2VSQA 2Y1KA 1NU8A 3BDIA 2YH2A 4MJ3A 3B3QA 4N8SA 4C87A 1R9NA 1CQZA 5D7BA 1IUOA 4K2AA 3KDAA 1DT3A 4F5ZA 4AO7A 3BWXA 1H2ZA 1N8SA 4J7AA 4FLMA 4L3WA 4EY5A 2I78A 3FLEA 5AKJA 3IURA 1XROA 3HC7A 3H1BA 2WLSA 3CN7A 3ZI7A 5K3DA 3AUKA 1CUUA 5EHZA 4W1QA 4BC1A 2WJ3A 1EH5A 3HSSA 3DYIA 4BVLA 2O7RA 5DJ5A 1P0PA 2IIVA 3I6ZA 1T4MA 2OCLA 5HKAA 5ISMA 3JWEA 4BYMA 4B7ZA 2WJ6A 3C6ZA 5CT9A 5AP9A 3HLKA 3C70A 5AKEA 3BDVA 2EEPA 4AO6A 2XQIA 4HRYA 1CUHA 4AX4A 3H18A 2H9YA 3AIMA 1QOZA 1F0NA 2G4LA 3H04A 2QZPA 4KJXA 1UK9A 4C01A 4KE6A 2XMBA 5AJHA 4C6HA 2AJCA 5CXXA 1U2EA 4A16A 1FSSA 2H7YA 2GBGA 2WIDA 4EA6A 1MX9A 1N5MA 4QNNA 4XX1A 4QDTA 4BE9A 3BJRA 1G4HA 1MN6A 3ESAA 4Z49A 3W05A 2QS9A 3STYA 1BRTA 5T4BA 4U2BA 5AKZA 4PO3X 2H7CA 2WFLA 5HZGA 2OLEA 4WDRA 5HFNA 5T4FA 1NU6A 2WIKA 5AOAA 1EB9A 5CH3A 3OG9A 3SC2A 1MU0A 4FWBA 5FPQA 1YS2X 3HRHA 4Y2SA 1EXWA 3A70A 3ANTA 5ALUA 1EI9A 3T52A 1QIMA 3O0DA 3DOIA 2OGZA 1W52X 2GBCA 1XZFA 2Y2UA 3M83A 2RGUA 4L0CA 1UK6A 4BCBA 1BEZA 4ITVA 1CUCA 4BVJA 3DL4A 1PJAA 5FLKA 2UZ0A 3WK5A 2J4CA 3QPCA 3OPMA 3KXPA 4IHAA 2NW6A 1YSCA 2W22A 1CEXA 4KYVA 3WL7A 5DYWA 4BCDA 4O08A 1ODSA 4H35A 1J2EA 3K6KA 3O4JA 4ARBA 1VXRA 3R3VA 1U4NA 1U8EA 3WYNA 4BZWA 1EINA 4GEGA 5ALJA 1X2BA 3CCBA 4FDMA 1C7JA 4MYDA 3E4DA 3L1JA 2DCMA 1J07A 3PF8A 3AFIA 4QDOA 1EK2A 4DSAA 2WU3A 3RLIA 5DTIA 1LPBB 5ALMA 4X7BA 5FKJA 1XQYA 2XMQA 2HRRA 3FWHA 1W4LA 2WIFA 4M0FA 1YASA 1MJ5A 2X76A 3N0TA 4H7HA 3EBLA 2AJ8A 1GT6A 4UBJA 2GYVA 3R3UA 1J06A 4QWWA 4H7KA 2OCGA 5JANA 2YXPX 3W9UA 5CH5A 5ALXA 1QTIA 1MAHA 4EY4A 3DNMA 1Q83A 1XRMA 2AJDA 3F97A 2YYSA 3ZPXA 4M0MA 4CG1A 2Z3WA 3UUEA 1XRQA 3HEAA 3M3DA 3V48A 1DQZA 3IUQA 2JGMA 4HXEB 3IIIA 1Q84A 3IUNA 2Y2VA 3C87A 1HQDA 3KWFA 1DINA 4QLAA 5AHXA 2B20A 5JALA 4LXIA 1AZWA 1D07A 2DFPA 3UUFA 5ALOA 3DKKA 3CXUA 4D9JA 5C8ZA 1CUEA 2AXEA 5LIPA 2PU7A 1DWQA 1AQLA 1AURA 4AMZA 1ZI9A 5EHXA 4OUKX 2B4KA 4OB6A 5AI0A 2ES4A 4Y2RA 1TCBA 1WM1A 4BAGA 1K5PA 5HK9A 5FRDA 4XWGA 1XZGA 3HABA 3STVA 3H1AA 4J03A 2G5PA 3A2MA 1BN6A 1LPAB 1QIDA 3QZUA 2OQVA 5ALYA 1UXOA 3OOSA 3ICWA 4Q1VA 4QWMA 2ZYHA 3M82A 2CMFA 1G5FA 4UHCA 3G9TA 1H22A 2D5LA 2BCEA 5BWCA 4C89A 1H2WA 3MVEA 3K2IA 1PV1A 2CJPA 3BIWA 2AJBA 1XZJA 4Y2VA 3VDXA 1AMNA 5JD6A 1E89A 2ZSIA 1P0MA 1R4ZA 3CCCA 5D3KA 3IBTA 2HU5A 4FOLA 3YASA 3HXKA 4QDUA 4G8BA 3D59A 4QA9A 5IH7A 1G42A 3PFBA 4Q3LA 3OURA 2QJRA 2JGFA 3ANSA 1E3QA 5A62A 4Y2QA 1LNSA 4ZREA 5ALEA 4JEIA 5KWIA 5CXUA 1SC9A 4DNOA 2HM7A 4LIPD 4OSEA 4X91A 1A8UA 4CCYA 5EGNA 1XKTA 3NOXA 1CV2A 1BCRA 4ZWNA 3WKDA 1DU4A 2GZRA 3NUZA 4KRXA 5AKHA 2J4FA 5BOVA 5ALLA 3D5EA 2PSEA 2V98A 1CUDA 2WUDA 2BUAA 2C0PA 4UBLA 4BRSA 5C7YA 5JAUA 2VAXA 1LPNA 1YB6A 1L7QA 2HADA 5AM4A 1E8DA 2DQZA 7YASA 1S8OA 4W1RA 3AZPA 1ZJ5A 1TAHA 1VXOA 3D2AA 3D0KA 4U2FA 2OQIA 3F96A 2IITA 4BCCA 4MQMA 3QPAA 5CT6A 2GYUA 3OM8A 5K3FA 1LLFA 1QO7A 4EHBA 1R88A 5ALKA 4DMKA 1CQWA 2PVSA 1UK7A 4W63A 4B83A 1FFCA 2WSLA 4H77A 2XQJA 4N5HX 4TPKA 4A5SA 3GUUA 3STTA 3U0VA 4C4YA 4BP9A 1JJBA 2QKYA 5DLPA 4Y2JA 2JGIA 2H7XA 5HQ3B 5D6OA 5HCUA 4DM7A 3VJLA 4HXGA 3FVRA 3MUOA 2GBFA 2WIJA 3ILSA 4CCYB 4X6UA 4YX9A 4YASA 1MO2A 1NX9A 1IMJA 1F6WA 3Q0TA 1AUOA 2G63A 4FHZA 5D3ZA 4X92A 4KRYA 5DYYA 5FV4A 3R3WA 3R3XA 2VAVA 2XMGA 4DNPA 1E66A 4U2CA 4X85A 4G4IA 2J3QA 4NZZA 3ESDA 1C7IA 4MWTA 4RPCA 1KEZA 2Z3ZA 4LXGA 1VJ5A 3W2TA 1U65A 1MTZA 3VISA 5JASA 2WJ4A 1R50A 1DT5A 3C8DA 3EQ9A 1B41A 2QMQA 4J0DA 1LBSA 2XQKA 2O2IA 5EIEA 1Q0ZA 4H0CA 3AILA 3HJUA 1LPMA 1ETHA 5JARA 3C8HA 1DX6A 3O4GA 1YB7A 1YA8A 2HFKA 3G9ZA 2WKWA 5T4HA 2OGSA 5CH8A 2VJCA 2XUFA 3AINA 1WB5A 4G9GA 1JI3A 1JJIA 3G9XA 3BF7A 1HBJA 3R0VA 2XUDA 3OC0A 4KEAA 4X3CA 2WM2A 3RARA 4H7IA 1MAAA 4P93A 3AIOA 5CBKA 3W04A 3HYSA 4N8DA 4FNGA 5I7UA 3T4UA 4Q05A 4Y9SA 1KU0A 4PSUA 4EZIA 3I1YA 4WFIA 2W6CX 5ALZA 2DSNA 3O9VA 5ALRA 3I6MA 4DMFA 4E15A 2G5TA 5CURA 4B9AA 3S2ZA 3STXA 3D2CA 5CT5A 4WJLA 2RHTA 2WQZA 1CUIA 3VJMA 3H17A 1QIGA 2ACEA 4EB0A 1FFBA 1LBTA 4KAJA 1MNQA 3WL6A 1QIKA 2VATA 3GFFA 5A7FA 1TRHA 3WZLA 4JNCA 4CG2A 2PM8A 2XUJA 5ALGA 4P92A 1DWPA 3ZLUA 5LP1A 1ZD3A 5ALPA 2XMSA 5ALQA 1A88A 1TIBA 1XZBA 4G4GA 1XZCA 5DNUA 1EK1A 1AKNA 2O2GA 1EDEA 2WILA 1CUYA 4LKOA 4XJVA 5DWDA 1OILA 3DYVA 4FBMA 3GBSA 3OTQA 4HXFB 3WKCA 5FUMA 4UBIA 3G0DA 4MQLA 3FYUA 3LP5A 2C58A 3TEJA 4KACA 2HDWA 3WJ1A 3RK4A 1C4XA 2WTMA 4OU4A 3DJYA 2WHRA 5HKBA 2XQFA 2Y6VA 3WWEA 2WG0A 1EVQA 1ACJA 2XMCA 2V9ZA 4MWSA 1JKMA 5JIBA 2WG2A 3GELA 5AH0A 2JBWA 4ZGBA 1W76A 1SCQA 5FP0A 2XMDA 2WHPB 1Y7HA 3TRDA 4X94A 1I6WA 3W06A 5AICA 1CIJA 2VT7A 3D2BA 4B80A 4GXNA 3TJMA 1CUXA 1ZGCA 3KWJA 4FLEA 1L7AA 4C88A 2GBIA 4WCVA 1KU6A 4BAUA 1Z68A 3I2HA 3G0CA 5JAOA 4K6HA 1XLWA 5AM2A 4IO0A 5LYYA 3KOOA 3STUA 1CUZA 2JEZA 4GECA 4XIIA 2AJLI 3WA7A 3FBWA 5FXMA 1IUPA 1USWA 3NWOA 3VXKA 1XQWA 2RAUA 4B84A 1TCCA 3FYUB 4OD0A 4G5XA 4PF1A 3O9MA 4QDXA 4ROTA 3AJAA 4Y2YA 4E14A 4CG3A 5CTAA 3WK6A 4EY7A 1UKAA 3FVTA 3PDCA 1XLVA 3WWPA 3I28A 3B12A 1QJ4A 4N5IX 6YASA 4F60A 1FJ2A 1QGED 4Y2UA 5ALVA 1VE7A 2VEOA 1GPKA 4OYYA 2BFNA 2WIGA 2WHPA 1VLQA 4LXHA 1Q0RA 4BBZA 5EIHA 5CRIA 3F8SA 1CUJA 2VJAA 5FPPA 4TGLA 2JIDA 1E8MA 4DNFA 3I2JA 4NVRA 2EDCA 4E46A 1ODTC 4BTVA 2PUHA 2DR0A 2Y6UA 2HL6A 4UBOA 4CIBA 4MYSA 4UHFA 4G9EA 2PSJA 5JZBA 4BDTA 1XZLA 3SX4A 4FTWA 2OAGA 5EFZA 3IUJA 1BS9A 1UZAA 3R40A 5IVIA 3EF3A 2XUQA 2QTBA 1BEEA 1Y7IA 2Z5GA 1HDEA 1SCKA 3I2GA 4OB7A 2HA3A 3O4HA 4FBLA 1H23A 1IUNA 5LZ2A 5ESRA 2I3ZA 3WQHA 5DNVA 3DEAA 3BXPA 2JGLA 2WFZA 1JMKC 1ZIYA 1ZJ4A 4JYPA 5E4YA 2OCKA 1XQXA 1YS1X 3FSGA 4UHDA 3QITA 2BAGA 3ESBA 4K5QA 2HA7A 4PSDA 1LPSA 2HFJA 1HLGA 1GXSA 1TKRA 3AZOA 4PV7A 5AK3A 1XZEA 4PNZA 5KREA 4WY5A 3WK7A 4V2IA 3H19A 1YAHA 1CLEA 2K2QB 5AKXA 1CPYA 3MUNA 2HU7A 5EHQA 2ZYSA 1CUVA 3G0BA 1WHTA 5F4ZA 2WUFA 5A71A 4B81A 2ACKA 3QYJA 3WK9A 1E8NA 1GZ7A 5A7HA 3HI4A 4PW0A 1H2YA 1RP1A 3WIOA 4OPMA 4DTCA 2O2HA 2BGNA 2ZJFA 3WWDA 3WZMA 4BRZA 1T2NA 1R1DA 5AK5A 2QXUA 4DSZA 1SCIA 1K6EA 5E4JA 3IVMA 1IZ7A 4IH4A 2J3DA 1HKHA 4J0JA 5A6VA 5IVDA 4KE8A 1OCEA 3WL5A 3VKFA 1BU8A 3D4LA 5H3HA 2QR5A 1RYYA 2ZSHA 5DYTA 2HIHA 2QRUA 5JAPA 2O7VA 4GW3A 1F8UA 1XRLA 4U2GA 2QUAA 1UKBA 4RNCA 3GZJA 4A23A 1AX9A 3H2HA 2WFLB 4YK7A 4J3JA 4WFJA 4AZ0A 3G9UA 2OG1A 1WOMA 3FCXA 3P2MA 1EX9A 4CIAA 3IB3A 4DLNA 4GBGA 1R9MA 1WB4A 3O4IA 1QE3A 2PKYX 1QIJA 2D0DA 1EB8A 1JU3A 5JZSA 2JGJA 2XLCA 4G1FA 1VZ3A 3DLTA 4Y7DA 5LZ9A 3FLAA 2WUEA 1CUGA 4UBKA 2XLBA 3D3NA 2PPLA 3PFCA 2ZJ6A 5KWJA 4AMYA 1JMYA 4Q3KA 1ODCA 5IVHA 4FNMA 3DOHA 3DD5A 4U2DA 3NGMA 3PICA 3IULA 3V1MA 1UFOA 3O95A 2PL5A 3UMJA 3BL8A 3CN9A 2QVBA 1QFMA 4J0KA 1QIFA 4GWLA 2GYWA 3VJKA 2B61A 4AQDA 1VZ2A 2X8BA 4UUQA 5AM1A 1WPXA 5ALDA 1XFDA 2FX5A 3B5EA 1VA5A 1ZD4A 1LZLA 1W75A 3DCNA 5BV7A 4J0GA 3H2KA 1WCYA 1L7RA 3KD2A 4Q34A 4J0HA 3RKSA 2WHQA 5FDFA 1EVEA 2C7BA 5EHNA 4DIUA 3LCRA 4OB8A 4DYHA 3V1KA 5LZ8A 1TK3A 1IZ8A 2WU4A 4J0IA 5AKKA 5AM5A 4UPDA 1MPXA 4FFVA 2PU5A 4DMHA 2Z8XA 3AIKA 2Z8ZA 1ORWA 2HA0A 2Q0XA 1UK8A 1QZ3A 3F67A 2VQ6A 3SK0A 2QJWA 1WPRA 1ZIXA 4S0XA 3FOBA 4JUIA 2WG1A 5JYCA 2OXEA 2PUJA 5ALFA 3V1NA 1XLUA 2E3JA 3VVMA 4HAIA 3FNBA 4H7DA 3C5WP 5AI9A 4NMWA 1WHSA 4BDSA 1XQVA 1GKLA 4BAZA 2HA6A 4AO8A 4ARAA 3C6YA 4EY6A 1IVYA 3H2IA 1JT2A 4CI9A 4TVKA 4UHHA 4BZZA 1FFDA 4HZGA 1XRPA 2QUBA 3C6XA 3WLAA 4OYLA 4X71A 4FMPA 1QONA 4BTLA 5K5EA 1EHYA 2XUHA 3H0CA 3I2KA 4CFSA 2C5FA 2C5GA 4I4CA 5AOBA 3ZV7A 4J0CA 3IUMA 4X97A 4MXDA 4QDZA 1DQYA 4GI1A 1ZICA 1AGYA 3FAKA 3K9BA 2BKLA 4RE5A 1OXMA 3N2ZB 4ZXFA 4BATA 1CVLA 3G0GA 2CKMA 3I2FA 4X6YA 3GA7A 4GHWA 2QT9A 2XUGA 4P08A 2I3DA 3E0XA 4MEAA 4QLOA 1CUSA 1LPOA 2ROQA 2XB6A 1XRRA 3M81A 3E3AA 4KAFA 4B85A 1X70A 2XDWA 5AI4A 4BP8A 3FCYA 4H7JA 3W9BA 3WKBA 3MGAA 4INZA 4H18A 4C4ZA 1VA4A 4Q82A 1UOPA 4UFNA 1GPLA 3A2LA 2XI4A 4Y2XA 2QM0A 3LS2A 5HFAA 3I6YA 1YCDA 2PSDA 1CFJA 3IDAA 2GZSA 2XUOA 3WWOA 4DGQA 2JEYA 4HRXA 2WUGA 3U1TA 5ALIA 2FJPA 3L1IA 2VJDA 2JF0A 4FKBA 2H1IA 5ALWA 2JGKA 5HK8A 3DL7A 1MX1A 2ZVDA 3H2JA 5C8VA 1QIEA 4UHBA 4ZRDA 4KR0A 1UOQA 3QM1A 2ECFA 3X3HA 5LKAA 1YA4A 2CEKA 5DTJA 4CCWA 5A7GA 2PX6A 4XVCA 5AO9A 1HPLA 3FYUC 4IH1A 2CB9A 3QPDA 1ZD5A 4OCZA 4B82A 4LYDA 4H7EA 3PUHA 3QBJA 4LHEA 2ORYA 1M33A 2VA9A 4K6KA 5ALTA 5CT4A 4BE4A 5LLSA 5AKLA 3A2NA 4X6XA 4ZV7A 4JYMA 4UHEA 3STWA 1QTRA 4X90A 5CW2A 1ORVA 4ZV9A 2CZQA 4M0EA 2XT0A 5K3FB 1VKHA 2QXTA 4G4JA 4W1PA 2ZJ7A 4I19A 5K3BA 4NS4A 4PSCA 3ZWQA 5JZ9A 3WKAA 5IVKA 1THTA 4W1SA 1DX4A 5BWBA 3FSGD 5AOCA 1B6GA 3QMVA 1TCAA 4RGYA 1N5RA 3L1HA 4EBBA 1GKKA 1O6FA 1GGVA 1XKLA 1P0QA 5HQ3A 1R3DA 3ED1A 4BVKA 5AM0A 1XZAA 3C5VA 5LZ4A 1JJFA 3HZOA 5K3CA 3ZLTA 2BJHA 4QZVA 1UWCA 1EDDA 5HF8A 4AB1A 2WFMA 5EIAA 3QH4A 5AI8A 5EI5A 3WYDA 3ESCA 5SYNA 1G66A 1W6RA 1XRNA 4AXBA 2XMZA 3G0IA 1P0IA 3AZQA 2HA4A 2R8BA 1UKCA 5AKGA 2CBGA
chains in the Genus database with same CATH superfamily
1XN4A 2P90A 5IP5A 3SQXA 1XP5A 5BSWA 4BGVA 2FOIA 1YF3A 3GD5A 4L3OA 4I3FA 3TRJA 1RAFA 2DE0X 2FZGA 1WU7A 3MSXA 4CLRA 4EPRA 5IF9A 5JAHA 4YHHB 1CB7A 2H17A 5JEDA 3KE9A 5C18A 1PN3A 2DQKA 2XE6A 2Q8PA 4XPIA 2IPXA 1I33A 3PUVA 2X14A 4LNUB 1UCFA 1XZDA 3G7NA 4MVXA 4QUEA 1SQ0A 2QG9A 4ZEXA 4CEHA 4P4NA 2CSXA 2H1HA 4KR2A 1XZHA 2JGEA 4P9NA 2GMWA 3ASUA 4R2IA 1KOGA 1Y34E 3ZHUA 5IAJA 4D8TA 2E2WA 2YZMA 2BMVA 2VTKA 2P41A 1EGQA 3BMOB 2HCTA 1EGVB 3G3EA 1N1MA 5CHYA 2J45A 3BREA 4MPTA 3UEOA 4DLWA 5MDHA 4HFJA 3ZW7A 1JU4A 2X7XA 2P4EA 1JE1A 4R8MA 4HF7A 4BFTA 4GDMA 2CV2A 3T9AA 1NN3A 2P62A 3DPIA 4WZZA 4ZVOA 5CB0A 1DAKA 1M54A 4LYEA 1PT7A 2JD0A 5FI0B 3HY6A 3TINA 3N74A 4QATA 2WJIA 5TGZA 1SVKA 3B1KA 1FL9A 1Q92A 1M2VB 3TQTA 4Y9UA 4C4OA 3AM1A 5EUCA 2GDZA 2I67A 3AGPA 2DHCA 1C7QA 1Z33A 2BFPA 4W82A 1Z06A 2WVGA 2QV0A 2ZIUB 1L3IA 2EL9A 4KI0A 4O4JB 3T99A 3ZH9B 4MVJF 3RRFA 5B1EA 3MGGA 2HA5A 1FU4A 2HYIC 3CSDA 3WQSB 3H8WA 4BTEA 2BGRA 3SQOA 2O6HA 4YQZA 5BR4A 1EFDN 5LL6P 3AWDA 2KHZA 4Q1BA 1FP1D 4BFWA 1H2XA 2IXDA 2XH8A 4X1KB 4EP1A 2ZIAA 2Z2IA 4YALA 3S1LA 3IC5A 1MZPA 1ZESA 5K3SA 2AW3A 1UOOA 1X9GA 5DHSA 1Q12A 3ADKA 5JR3A 1IY0A 2I80A 2FPGB 2G3YA 2FE4A 3R3YA 4KQMA 1UZNA 4TWBA 2RI6A 1J0EA 3MMZA 4QE3A 4X0EA 2OD9A 1OWPA 4XPZA 2HHAA 4DT1A 5KSOA 1JL3A 5JS8A 3LF2A 4PTYA 4KTVE 4RK6A 3SBDA 1K0FA 3K96A 4LK3A 3HN2A 4MUEA 3K4PA 3LC0A 5DTMA 4CIXA 4H1TA 5LA6A 1CNMA 5T57A 5A06A 1EVIA 3MT0A 4LOJA 3HCEA 2KI5A 2GEJA 1G2IA 3P0RA 1DE0A 4B0PA 1VLVA 3H42B 3OEYA 3DKRA 2W2LA 3WK8A 4B9EA 4HS9A 1UBLS 3WLIA 1SXGA 4A9AA 5L4SA 1KO4A 1VLMA 1GNSA 5IN5A 2QX8A 3QVXA 2ZUWA 1CUBA 4JBNA 1H2AS 4WFQA 3B7GA 4LPKA 1JPVA 4TQUS 5JPIA 1EZ1A 1QFSA 1QC5A 2V96A 4D4GA 1M0EA 1OAKA 3ABRB 4M86A 3ZBUA 1KI1A 1ZSYA 5DNWA 4J6EA 3HP4A 5LP6A 1DAGA 4IMIB 1N2BA 3G5TA 5CX1B 3E1SA 4O4HF 2IDKA 3RNOA 1FMFA 1PFQA 5C81A 1M1ZA 4MK4A 1I2AA 4TLEA 2BUCA 3C5HA 3ICVA 5CIQA 4ABYA 3FOZA 4MH0R 1E63A 3QXSA 4JH0A 1JDBC 1H2RS 1KSFX 3EFOA 4KO3S 4X95A 4EG6A 4EYGA 1XZIA 3NWEA 5KBYA 3THWB 3K9QO 3WMRA 1IN4A 4ZZ3A 4PE5B 2FPRA 3L3BA 2VPPA 3PNBA 4N1AA 5LDHA 1LDMA 2BCJQ 2X5XA 2X6QA 3BRWA 2AE1A 3DEHA 4IILA 1A8PA 3KNZA 1RP7A 2ZCUA 2QE6A 2ZWVA 1MT3A 3PNVA 3P9RA 2HU8A 3NC4A 1DVRA 5HF9A 2EIXA 2PGLA 1WXQA 3OC6A 4NQRA 3VZQA 1VE6A 1QG2A 4MR9B 1ZCBA 2R1UA 3VSBA 2VDJA 2YUTA 3JR7A 5J5CA 1SCUA 2C2OA 3NM6B 3QBTA 3SXJA 2BDUA 3CA8A 3ROFA 4HEQA 2AFVA 3NH6A 4PXAA 3L84A 1Q5PA 1CSEE 2QHXA 2QK4A 2FFBA 4GQBA 4BNUA 1DRUA 3D6HA 1P75A 2ZI9A 5AKIA 3P9NA 5FTMA 4HAOA 1YE5A 1GPUA 4BJ3A 1G59A 4RGQA 1K89A 5A1TA 4AWBA 2VP4A 2V59A 2HDHA 2MSEB 4IX1A 2IE0A 4KV7A 3PEWA 5DHFA 4FWTA 3G8CA 1Z6AA 1XYYA 2V9PA 3L93A 2FX3A 2DECA 3ROMA 4OQMA 4WRRA 3F98A 3SDSA 1E1NA 1R5NA 1V2GA 2J6CA 3LK7A 1YBFA 4IS2A 5DN9A 5GONF 1GPYA 1IOZA 2B37A 1LZKA 2VCHA 3LBNA 4CDGA 2XYPA 5EIBC 2QTLA 3D6AA 1ACLA 2OSVA 3VSDA 1U6JA 4I2NA 1KMIY 4Y7CA 1GZVA 4YP1A 5KTKA 5H1YA 2EW8A 3EIEA 2B7LA 1MXHA 3FZYA 3TQQA 1QDLB 2J0UB 2Z2XA 3IA2A 3O9ZA 4EK9A 1DCKA 4F72A 1AN0A 4JP1A 2H4HA 4OXNA 4EUNA 1KMQA 5KNBD 3UQZA 3KRTA 2HO4A 3IYLW 1EGHA 1X6VA 3T41A 2ZIXB 1O77A 4CG0A 1KPIA 1P2UA 4JSYA 5REQA 4FSXA 3C6BA 4KPUB 1HEIA 1RYZA 3RPEA 2EP8A 4C4XA 5DPMA 3K70B 3LW8A 3UENA 3LQYA 1S3FA 5C0OE 2VKTA 4ZGWA 2IPLA 4KGZA 5IF3A 5AXAA 4K26A 1UFVA 1QLWA 2A1TS 2ZSFA 1QGDA 3IMKA 3ZCRA 2C5BA 2B2CA 3PFKA 1LBIA 3IP5A 4N5NA 2BYTA 2MR5A 5FBRB 3NHKA 1L1FA 5FA6A 1BE0A 4Q6BA 3FSEA 3LIIA 5B53A 3DWGA 1SPBS 1F51E 4ETWA 4BZXA 1L8XA 5DK6A 1UM9A 2XUPA 1U0EA 3I73A 3M1LA 3MJTA 4P2GA 4E4YA 4G1BA 4EM6A 4QDJA 3GEPA 3MUEA 4U5QA 3ZDRA 3GMTA 3QLJA 3ZDAA 1SBQA 4G1EB 3UMCA 1SUDA 3PUIA 4UEQA 3P52A 5ARCA 2ZI5A 4CR8A 1NW4A 3PYMA 1IMOA 1HFJA 2ANBA 2FEXA 3BF8A 2ZDQA 5ETJA 3TIFA 4QRDA 1X2EA 4BNVA 4RK1A 2QX9A 4HUQB 2FHSA 5C4MA 3FFTA 1GTSA 3Q1LA 1DARA 3CBQA 4IIDA 2JLBA 4YQEA 3F9CA 1OXKB 4H0NA 1O95C 2E37A 4Q1DA 5ABPA 4KG7A 2DH5A 1YL6A 4OHBA 3O3MB 4I50A 1OGIA 2XR1A 2J0VA 2XEDA 4IXMA 5AW7A 1V5FA 2JCGA 4ZVNA 1GSAA 3WNQA 2RH8A 3PDJA 4EAQA 1BHJA 4EJ0A 3WJ2A 1RZVA 3VSAA 3LWBA 4Q7MB 4P33A 2M2IA 2X2FA 1CQIA 1QO9A 3FJOA 1MX5A 2O0MA 1E9EA 1BXRA 1UPBA 2FWBA 3I64A 3ZJUA 1OI4A 2O14A 3NEPX 5J3JA 1QIHA 3ILVA 2VI5A 1Y1RA 5CK5A 2ERYA 5AXDA 3QPWA 3Q9LA 2HKIA 3ITKA 1IBRA 1JAIA 3LIPA 4UBNA 2YZ2A 5E9QA 5KZMB 3K16A 3E1GA 4UFOA 2XBLA 3VVLA 1E3WA 5CGQB 4LYGA 1ECGA 2QOEA 1CNEA 2ZYRA 3L7LA 5LYJB 4RHCA 1Y48E 2OAEA 1CJVC 2G04A 2ID7A 3IIJA 3DR3A 1C0PA 3HG7A 1YBMA 1CJCA 4TTIA 5FI3A 3ZJTA 2QV7A 1LPPA 1U11A 5H81A 5DI3B 1KA9H 2WHYA 4GLOA 2ATIA 4FOTA 3U39A 1GO2A 1OI2A 3BXFA 4JODA 2BFDA 2H1VA 2HRQA 2POCA 3JYNA 4DUGD 3CLTD 2EOAA 3OCZA 4X6LA 2VKQA 4ZI7B 4JJ4A 2NTYC 2OMKA 2Q29A 2WF6A 1V47A 2FLVA 3DZHA 4HQRA 4RORA 2HRCA 2GZ1A 4UU0A 3V7NA 4JL6A 2PCLA 3PZRA 2YFQA 1PJSA 4LXXA 2B94A 4L07A 4MUAA 4YC7A 4FEGA 1VJGA 4L9RA 3RS9A 3TLAA 5A5FA 2YQ4A 3N7AA 3UV3A 4COKA 3OUUA 2EATA 1MJHA 1I94B 1E7RA 3FIJA 4YMIA 4ENWA 1FS5A 1ZOIA 4MWGA 2GPWA 3EAFA 4OI1A 4CRWB 3DCIA 5C2JB 2ZIZA 3ZGNA 1Z88A 2LIPA 2A0YA 4HKTA 3CS3A 3IQEA 4QFCA 1EBFA 3R0JA 4U2EA 4NFHA 3ZZMA 2Y1FA 3AI1A 1XGKA 2B1GA 2CHQA 3JYHA 1K9SA 1OVGA 1SO8A 1EX6A 1PL8A 1XDDA 3W8FA 2I2WA 4PTLA 1CHNA 2O2JA 1FW8A 1DG9A 3UO8B 3KX2A 2B69A 2F1HA 4BB0A 1PX0A 3QXJA 4MS3A 5B3JC 3ZDZB 1VJDA 2LTAA 3OT1A 3PYLA 4MKFA 4ER3A 3UK7A 4WKCA 2VPTA 5DBIA 2J3HA 1KBOA 3A26A 3TZLA 1HYQA 2AN1A 4Y6SA 2D54A 3QVMA 4JQCA 1HL3A 1HG0A 1ZG3A 2NZXA 1XCLA 2PGAA 2R65A 2WWFA 2VSQA 2Y1KA 4RH0A 2G7MC 4RGBA 2NTEA 4Q4HB 3KHTA 4BFVA 4YCSA 3MS7A 1JJVA 4IWYA 4MJ3A 4CMJA 1XO1A 3ED5A 1JX6A 3TRFA 3UK1A 1WV0A 2VL7A 4O5AA 3WMWA 2H6EA 2VUSA 1BCRB 1IUOA 1NONA 1UXHA 5DCLA 3C98A 1L2TA 3BWXA 3H83A 3FNQA 7GPBA 3ZN2A 1N8SA 4J7AA 1HSZA 3KKZA 4L3WA 1P9LA 5FIUA 3V2UA 4EY5A 5I7EA 1BX1A 1DRKA 3MWGA 3AU9A 1GTL1 2ATVA 3CUKA 2A9RA 2R7MA 4XLLA 3HRKA 3QY0A 4JNKA 3ZQJA 4G0UA 4QX6A 1QS0A 4RPHA 4UD6A 1L5GB 3BILA 3L7CA 1GILA 3CN7A 2G4CA 2PBRA 1OH8A 4RBNA 4A6PA 5A9SA 5CA0B 2HHLA 4I9UA 3ZEIA 5L40A 4OFWA 2VHZA 2X77A 4EYOA 4ZEVA 5EHZA 1FUYB 1E2HA 1I4TD 1QFJA 2W6ZA 2X41A 3G85A 3IUEA 4MWEA 4Y6LA 2QN7A 1EH5A 3DOFA 3SE7A 3ZHYA 4AD8A 4BOYA 2JLRA 1FB5A 1RXIA 2H4FA 2PA3A 5E7QA 4I55B 2A4MA 3TECE 3P4YA 4DRXB 1NA5A 1UBRS 1BH2A 1BNCA 2G28A 2WDZA 3PNYA 1RJ9A 2OCLA 4YT2A 4GS5A 2VWGA 1H2EA 3HU5A 4TXNA 4C5AA 5HKAA 4KDCA 3JWEA 5ISMA 2CLOB 2ZTVA 2YVUA 1G6KA 2ZXEA 4E2FA 4R6XA 4UNRA 4XM2A 5AP9A 2IOHA 2IEBA 3BULA 2ZAIA 2JVIA 5DX8A 1AHPA 1PW5A 4HJXA 1TE2A 4BL5A 4TRRA 3ZV3A 1NHWA 2GS9A 1R7RA 4BFXA 1R6AA 2O2EA 2CK3D 4Q48A 4DLLA 5A3SA 1AT1A 3WYFA 1P31A 5CDGA 4UW9A 2FPSA 3MJCA 4XCQA 2IZ0A 4PCLA 3U4MA 3OF3A 1EESA 3AIMA 4BWVA 2GARA 3I0NA 1QHYA 4RCZA 1FU8A 1VP3A 4H3VA 2XGSA 4MA5A 4MB6A 4LGVA 3QX3A 3OMXA 1KY5A 4FS3A 3ZY5A 1UK9A 1SH7A 5GGYA 1T2UA 1WUYA 4MRMB 4KE6A 1D5CA 1FDVA 4RW0A 4WW0A 3WSVA 5FWYB 5B3KA 3UOGA 5AJHA 1ENOA 1K1EA 2YBEA 5FF9A 2P5UA 4WJKB 4PAOA 2OUKA 4FIDA 1MBZA 3U1VA 4KX3A 1FSSA 2Y0BA 1E77A 1OWLA 2NYAA 1TLLA 4Y6PA 4IV8A 2GBGA 4HLQB 1TD9A 4LJLA 3L6CA 5JV5A 3R8XA 2L0XA 4NBVA 2FZWA 3QU4A 1FVFA 5I8WA 1KDTA 3EIHA 4IBOA 1M8GA 1NT2A 2CL0X 5KNLA 4IZOA 4LC1A 3S40A 4EYQA 2OAQ1 2FMHA 1TO2E 2XY4A 4D4MA 3KKKA 4BE9A 1NE7A 1C8LA 3RGGA 1QRAA 2H51A 3MINA 1G4HA 3ON5A 3IVXA 3QJGA 2GT1A 4OQXA 4UXIA 3MGCA 1ZRSA 2H4WA 5H9VA 3CRW1 4D46A 1C3LA 3W05A 2QS9A 3IQDB 4Y0NA 3UAWA 3STYA 1BRTA 4BRWA 2JLXA 2ZRDA 3PEVA 4CTMA 3KOYA 2Z04A 4MDEA 2WFLA 5AW8A 3BJEA 1IEVA 2DFLA 2DY1A 1NU6A 2WIKA 3KOWA 1IY2A 4NESA 5DGCA 4MQUA 5FTWA 1U04A 1LWNA 3P4UA 1YFLA 3OG9A 4C08A 1MU0A 3GI1A 1W2WB 4FWBA 4AS2A 2PQMA 1FQWA 3DR5A 3EXFA 3P2IA 4CM9A 4ZT3A 4MP8A 3PC6A 4D45A 2CMKA 1O5IA 4IQFA 2IH4A 2CDNA 2BI7A 2WYIA 1YS2X 3HWWA 4NULA 5JCZA 3L8DA 3U4IA 4HFMA 5AW0A 3TIVA 1ISMA 2FVXA 2MHCA 4GAEA 4M3NA 3CVUA 1EA7A 2A59A 1EXWA 3FMOB 2X8JB 3EK2A 5EMNA 3T52A 3G2OA 4O2RA 3NDJA 3PC7A 1ZUNA 1UC4B 2MWMA 2OGZA 1GZHB 3THXA 2FMUA 4FMCF 3UKOA 3HUFA 4C76A 5FLEX 5EJ5A 1W52X 2CK3A 1P8JA 1NNI1 2GPTA 1KDOA 2IUTA 2Y2UA 3AOGA 3DDOA 4WKNA 2C2ZA 4X44A 4BCBA 2IYTA 2AH5A 1JSXA 4QJ3A 1Y9ZA 1WB9A 3OCCA 4I1PA 4HTFB 3AR4A 1AZTA 1FUKA 4P98A 1D2HA 4LNHA 3WK5A 2G72A 4IDOA 4C14A 5GV7A 4YAIA 3Q2OA 2W48A 3UT5B 1CJTC 1M73E 2ZBVA 3EVGA 3QXGA 5BW5A 3F5FA 3URMA 4IIEA 3T7KA 3ZY3A 1Y7TA 2E18A 3SS9X 2BGUA 2IU4A 5DW3A 5A2QA 1TQ6A 4L3VA 3O2JA 1O3YA 2NQ8A 2Y93A 3AONB 3D02A 4PHCA 2LVBA 3OPMA 4RF5A 4A2PA 4EB6B 1GFZA 2GBLC 5E1DA 3W8DA 4I9GA 2B83A 5TMDA 4EQ6B 4MUMA 2HLNA 2PUGA 1YKSA 5JG7A 1YOVB 3L7MA 4O08A 1ODSA 4PZDA 3RYFA 5JJIA 5C5DA 3IDZA 3ZLJA 3K6KA 3OFND 3IVAA 3UMMA 3A27A 3RSZA 3SEZA 2P9QA 5TB5A 3R1IA 2WUWE 4CKBA 1QR6A 3DE7X 4ZOAA 2ZUCA 5DRTA 3IE1A 1UJCA 4WZBE 2FW6A 5ALJA 3JYLA 4TMFA 5ERGB 4QULA 1VBMA 4KOEC 5JE8A 1JLKA 2W93A 4YDSA 3AKCA 1FMCA 4RSGA 4GMFA 3J7TA 1NBHA 2XB4A 3ZJYA 4GWGA 1TYZA 2BRUA 2QZ4A 5DIFA 3GLFB 4LE0A 2IVFA 3KYIB 3CUUA 1ZUWA 1P3DA 3OIGA 2C61A 4S1PA 1L1RA 2G77B 5HKKA 3V32A 5KYYB 4ECEA 3G1WA 1PNVA 4NV1A 3M4ZA 4ZCPA 2DCMA 3LX8A 1N92A 4LJAA 4MGZR 2QM8A 1LI5A 3UAYA 2A9FA 4Q93A 3VU9A 4C7KA 3AFIA 2FJUA 3KLMX 2H9AA 4QDOA 1E62A 1GD1O 2O05A 2PQ6A 4MIKA 1KIMA 2ZE8A 1U0BB 2FUG6 2QL6A 4O2AB 3DBIA 4DR3B 1VIYA 1VPDA 4BZQA 4CEIB 4FB5A 2M32A 1NQAO 5DTIA 1TUEA 2IZ5A 2IDJA 1LPBB 3JQGB 3EZGA 2ZUFA 4ZAZA 2GPNA 5IJWA 5FKJA 3RSHA 5F5NA 4PIVA 4OKIA 1K98A 1M8PA 2QSJA 1XNGA 3FWHA 3H8JA 3HUEA 3LX6A 5IK2A 2PXHA 1L5HA 3VKWA 3VPAA 3W5UA 1V35A 3OE1A 3D3QA 1JXMA 4BKQA 1CF2O 1YD7A 2WIFA 3M4NA 1LRJA 1MJ5A 4F6LA 1T91A 2D1FA 1EKXA 1JKFA 3V4SA 2A0XA 2QVCA 2QMUA 3RT1A 3CNEA 1OIVA 1FQOA 2K6GA 4TT3D 4F3CA 4D3YA 4ZYZA 2G70A 2KSQA 5KKAA 4XWWA 1HLDA 1RXEA 1D2RA 3IV6A 2IIBA 1NATA 4H7KA 3ZJ4A 2RGRA 2Z43A 4BQPA 4H1WA 2GKOA 3VUFA 4LA4A 4PQFA 3SF8A 1HNNA 1J49A 4E0BA 3J80A 5CXQA 5AVUA 5JSKA 1B6TA 1ONPA 2ZDHA 4Z8YA 2CCKA 1U6IA 2GUGA 4RVDA 3NKVA 3TBHA 1I30A 3NBQA 1B23P 1HZZA 5DP1A 2GFHA 4NYJR 3UKJA 3MJRA 5E0OA 13PKA 2IEYA 2X40A 3AFHA 4L8FA 4RMJA 3SC4A 4EKDA 3T61A 4EJFA 4G36A 1SURA 3I9LA 4MKRA 2LZ0A 3UIEA 4AZWA 3EEBA 3WGUA 3K8ZA 1Y6QA 2OORC 1ISIA 4AROA 2J9ZB 2AJDA 3H2YA 3HVKA 4OREX 1TRKA 3EVNA 1O4VA 2FVYA 3JD1A 3OWOA 1NM5A 3NFRA 4WLNA 5EXXA 4CG1A 3DUWA 3TWOA 5TS3A 4F9EA 1DBSA 4XEHA 2Z3WA 4ACBA 3LY8A 3LFUA 3NCTA 2VF7A 2BFCB 4MVJG 3SDBA 3HEAA 2F3RA 3M3DA 3Q7RA 1F5SA 1QUFA 1YCFA 2V7QA 3ESRA 4TKUB 4ZAWA 1TLFA 3DBLB 2Q6VA 3OQJA 3VHXB 3FH0A 4AKEA 4XUEA 1KO8A 3AB7A 1NFQA 4D8YA 3FVQA 2YC2C 2OVFA 1TUBA 1VBKA 4A0FA 1VHLA 2IUSA 2UUOA 4WZBA 4PG7A 2IYEA 3FA2A 4GT1A 3TMYA 1H4TA 3Q3EA 3I5XA 1PG0A 3IOEA 4YUZA 3WB1A 3A04A 3SNHA 1ZVVA 2OBMA 5KYTA 3BL6A 3DGEC 1VL0A 1Y81A 4XGNA 2P30A 2I91A 4RAOA 5JUWA 2FQWA 2AKEA 5LIRA 4B3RB 3HGTA 1AZWA 4LXIA 4CQNA 1L7BA 3PE4A 4FZ5A 4Z4QA 1XR3A 1V8OA 5SICE 4XW2A 5GOTA 3DMGA 1T4GA 3DKKA 3AW8A 2DJIA 3ND8A 4F1JA 1RWXA 4D9JA 3HBFA 1CUEA 3MIZA 3OH8A 1GUYA 5LIPA 3LLUA 4XDZA 2GILA 1AQLA 1ZJWA 5CDSA 2VDWB 2JIZD 1Z5NA 5DWVA 4EGQA 2NVBA 1C3EA 2XQVA 4AZVA 4LFBB 2SHKA 4YLEA 4G3XA 4LV5B 2K7FA 4CFZA 4OUKX 3SE0A 3EHEA 3EGDA 1AKUA 3NONA 5IPFA 4NYIQ 1XNQB 4EKYA 4U4AA 3KQNA 1PQYA 1PKEA 1JB9A 1UODA 3H3FA 4LBYA 3NO4A 5KNBH 4BO2A 3FWNA 1A5ZA 1A3CA 2AUTA 3IAUA 2Q6OA 4J07A 4D99A 2BMWA 2JI4A 3K5PA 1XJWA 3STVA 4D81A 1WRBA 5AVRA 2DR2A 1V7ZA 1HMPA 4LVNA 3ZX4A 1LPAB 3ZNOA 1X74A 4LF6B 2W70A 1M7BA 2Z6UA 2W00A 5TEVA 1D6SA 4NENA 1CF9A 4P4TA 2FXIA 4RHFA 4TMVA 1E92A 3FYCA 2GPJA 3OOSA 1M34E 4HI0E 4G0ZA 4U2KA 2FZEA 4I1RA 4QWMA 5AR1A 4ZCLA 1RI2A 3M82A 6LDHA 5EJEA 1Z12A 3T3EA 2CVFA 2CMFA 1NW5A 1Q1NA 2XE7A 3MMNA 4G1CA 1J5EB 3WNVA 4N5MA 5M04A 4IIXA 2I0FA 4PFSA 3U3JA 2HXYA 2OWDA 1FTNA 4RIFA 5TVKA 2OBLA 2D5LA 1QQTA 2OLJA 2BCEA 2I3AA 1AGRA 3GH3A 4IHJB 5KQRA 4WVLA 4RNDB 3AFGA 4M8SA 4F1WA 2W6JA 2I8LA 2C7RA 3J7AC 3DEYX 4TRNA 3UOAB 4GM0A 3G6KA 5SY6A 3RKRA 4GZMA 3BIWA 1C41A 4X3PA 1OFIA 5FUYA 1UJMA 1XZJA 2EQAA 4NEHB 1UDXA 2QRPA 4HDKB 2UZ1A 4CMEC 5IANA 4Y2VA 3JQAD 3TFOA 4JI2B 1E7YA 3Q7QA 2Y8EA 3ZIAA 3LXRA 1E89A 1S8NA 2CGEA 5H5JA 5E1OA 3QX7A 1AK2A 2VK8A 5JDIA 4KQ2A 5JI2E 4IXDA 1TECE 3VZRA 2GTHA 5JAZA 3EIFA 2P7IA 4YUYA 1DIHA 4YP7A 1P17A 4RVSA 2B36A 2QTCA 5C34B 4PYQA 4QDUA 4NJOA 3YASA 1EWRA 5I48A 3BB4A 3H9CA 3BWCA 2OM2A 3FMGA 3OLVA 4FYKA 3D5TA 1CJBA 2W6ID 2MMCA 2QJTA 3KJEA 3KR9A 4ZC8A 4I4TB 4WPGA 3L7BA 2ICAA 1RJ9B 2W2XA 5I7FA 2XCQA 3K9WA 3PA8A 3E15A 4G2NA 3TLBA 3ANSA 3VVBA 4DA4A 4FOSA 3UH0A 1C80A 1MQ8B 5A62A 3S44A 5LBTA 3WRYC 2FHPA 1R66A 1VG8A 4Y0VA 1N5DA 1QX4A 2TYSB 4XIJA 3DOJA 1KAOA 4LSZA 2WKQA 4NIMA 4ZREA 4FN4A 4P7KA 4JZYA 2GB4A 3OD5A 1R74A 3LFHA 4E5SA 1QB7A 3DM9B 4CU2A 1TI7A 5CXUA 2M1ZA 3LUFA 1SC9A 4WV3A 1SD1A 4C05A 3LQFA 1EDOA 5E2AA 4WGFA 3Q15C 5EGNA 3SSNA 1ZJYA 3P27A 1L7VC 4YJ2F 3RK0A 3NOXA 1P1CA 4TMWA 1DOHA 3QU5A 4I6EA 1U80A 2P68A 4XX0A 2YW2A 3AR5A 4ZWNA 2ODPA 3IJRA 3DL0A 3DHYA 3H5LA 9ATCA 4XSHA 4AG6A 3GJ3A 2Y1WA 3GC6A 521PA 4BB6A 1W4CA 4LYFA 2J4FA 2ORVA 1GJRA 1FP4B 3D5EA 5DM4A 5KYWA 2E0IA 2QLTA 1O2DA 1R8YA 3PQ6A 5A9RA 1Z4OA 2V03A 1G20A 2H85A 1INLA 1O5TA 1WQ3A 4WI1A 3RVJA 2ZR8A 2OXIA 4OI4A 4A0QA 5BN3A 4D42A 2WUDA 4UBLA 5C7YA 3I61A 4GR4A 5IYZB 3UT6A 2VAXA 2LKDA 2R8OA 4XJSA 4DDUA 3REQB 3RGWS 1DP4A 4EB8A 1RXCA 1Q7GA 2DQZA 3OCYA 3OJCA 4YXWA 3FN4A 3GFGA 3VU1A 2QGNA 4RZUA 3KTFA 3REFA 2WQ7A 1Z83A 3ULKA 3TE6A 5KNCA 3KHSA 3HYTA 1XTUA 3INGA 3AZPA 2H1OA 1ZR4A 1Y98A 4M37A 2Y92A 1VXOA 1JBKA 1M0TA 1H4VB 3D0KA 1W96A 3D6NB 4GC5A 1EVKA 3HJAA 1UXKA 4YDRA 4U2FA 4TKVA 2OQIA 3TKLA 3AB3A 3F96A 4A8PA 2IITA 1QYDA 3HKBA 2FFAA 4BCCA 4MQMA 3EGVA 1PQPA 3LO5A 1G291 3CX7A 1YTUA 2HK6A 4GYKA 5KTRA 5LJIA 1DPGA 3NDIA 4OQEA 1CQJB 4X65B 1SXJD 3DHNA 4L57A 1NASA 1SOAA 4J1TC 3BGSA 5FNVA 3W2EA 4KXNA 5BP7A 5ALKA 4DMKA 2WPDA 3KC2A 4IGFA 1CQWA 3KJZA 1IN7A 2Y0EA 1MRNA 1KI3A 5GJVC 1NI3A 4F8EA 4XSGA 4HPWA 1ZA2A 2WV9A 3CNNA 3DQPA 3KQWA 3V8PA 2FSHA 1ZY2A 2X6RA 1DAOA 5ARBA 3T1TA 1EGMB 4II2A 5EE9A 1ITZA 2X4GA 2WU1A 2XYRA 1BFUA 3BS4A 2X8JA 3ZWYA 1P74A 2EFHB 4CWAA 3STTA 3M4JA 3CM0A 2FMXA 4BX8A 3S55A 1J09A 1WETA 1JYSA 1IEQA 1NQTA 1N1DA 1SVSA 2QGZA 4IP0A 1AXGA 2BBTA 3ETHA 1NBMD 2YMLA 3R23A 3Q7IA 3GGGA 2QKYA 3DVSX 4Y2JA 5HOEA 1XD2B 4IIFA 4I5IA 4AS3A 3TD2A 3WIVA 1IONA 5HCUA 2EKDA 1QH1A 3HB9A 3UA3A 1MGOA 4PLCA 1HE8B 2R751 4N0QA 1JG6A 1H9BA 3SCZA 2DR3A 4B3GA 5DNAA 3HO8A 1JQKA 1ZH6A 2W6NA 3KVNA 2G1KA 3VOTA 4ENTA 2HXGA 3I01M 3ILSA 2EWMA 4OL0A 1M83A 3T38A 1MCZA 1NDUA 4EZBA 1IC6A 2ZS8A 4YX9A 3D5QA 1QO0D 1CYDA 4YASA 3FDZB 2H2IA 3PP8A 2ZRBA 2PL9A 1NX9A 2PX3A 1KO7A 2VSFA 2AOVA 1IMJA 4MI9A 3Q40A 4CQJA 1II8B 4EB6A 4F56A 3R7AA 2V45A 2X3YA 3PHJA 3Q7EA 1KDZA 5K0JA 1XA3A 3H5AA 3UJDA 1A97A 4NAUA 1LSUA 3KYDB 1YR6A 4EJ6A 3TRHA 3JAKB 4C5BA 5E6RB 3IV7A 4FZJA 4RJLA 4CTJA 4P3PA 4F04A 5K0FA 4EHAA 4RAQA 1H94A 3HJNA 1TO1E 1MO3A 3EQ2A 4DY4A 4EGJA 3WMGA 3V1TC 3PT9A 1PE0A 1XQ1A 2RHJA 3TLEA 5DYYA 3SC2B 5A5DA 5FV4A 3IPCA 3RYIA 3TOZA 1BWSA 5KPJA 1EIWA 1ECPA 1M76A 4M7OA 4K0KB 1KQPA 3BCHA 2H2HA 4D4KA 4X1OA 2VAVA 2JGAA 4YRQA 1ST2A 4S2EA 5AK0A 5L3VA 4HAYA 1HI9A 3I5YA 1IXZA 2LBPA 4U2CA 4I5FA 4NZZA 2DLDA 3KR2A 4X20B 1QAOA 2OCPA 1LTHR 4MWTA 3U9LA 5L51A 2ZREA 4GOOD 1KEZA 5T5QA 2Z3ZA 1YMVA 1GQOA 4QYIB 2PL1A 5AXCA 3BAZA 1CY8A 4P4UA 4GX2A 3HMKA 6AT1A 5J5VA 3PHIA 2IRWA 1NLYA 1RI1A 1DT5A 1MO5A 3C8DA 5ADVA 2F9MA 1P5JA 3A1WA 4GICA 4U5XA 1PWHA 3HSYA 5EWLB 1IPEA 3RSOA 4AYTA 4MVJP 5CB4F 2EL7A 1LBSA 3UMFA 4Q4JB 5HNKA 4JU9A 2OZPA 4REOA 3CUSA 2QW8A 4MS4B 2WUVA 3ROPA 3PV0A 3QX8A 1TW2A 2E4YA 4FCCA 4RTLA 3L43A 4X3OA 1LPMA 2C8JA 2JRLA 2VHYA 2VP3A 4IEEA 1FVOA 4K3VA 1ETHA 3C3JA 2LCQA 5LXTA 5I9SA 2X0KA 1AS2A 2O0HA 4I36A 4U7WA 1FNNA 5HTKA 3UC9A 1XU7A 3C8HA 3UM9A 4BX9A 5JZVA 1QU3A 1BX3A 4RWZA 1GLVA 4YXWD 2UZ4A 3O4GA 4M36A 4K1XA 3AKYA 1I4DD 4Z86A 2EKLA 4M1EA 1KMNA 1YB7A 2EKQA 2HFKA 3M4YA 4L5AA 3TDNA 1MJGM 3V5NA 3ZHRA 1SHTX 5EGSA 4K03A 7AT1A 1ILEA 3A1NA 1SHZA 1J2JA 1JRLA 1AUPA 1ZX1A 2AK2A 2VDKB 2XRMA 5T4HA 1FF9A 3UXYA 2OGSA 2H2DA 1QB8A 3QKIA 3AHFA 3OLWA 2Q5LA 3TNDA 2FZ4A 5BRJA 4YHBA 2IX3A 1YMQA 3PDWA 1UBHS 5BSKA 3W5IA 5EJ2A 1II0A 1XJ0A 4WCFB 1Q3TA 3OEED 1CY1A 4P4LA 1EFAA 1WB5A 3PFIA 1S9HA 4G9GA 2YCBA 1JJIA 4N65A 4WN9B 1D4ZA 1R6TA 3QELA 3BX1A 1KGDA 1TZCA 1TU0A 3BHMA 4FX5A 2VJKA 1QU2A 1MB2A 3RBVA 3VDRA 4EFDA 2IYOA 3R0VA 4YGYA 3WO0A 5KNDD 4P84A 1JAXA 2QEQA 4TMTA 1RKUA 4JD5A 1VIAA 4QFBA 4WEQA 1DMSA 2QVGA 3G0OA 3JVVA 3U4GA 1UT5A 3WLTA 2C2BA 4HZIA 3JRWA 3WNZA 1EVLA 2O0JA 1RM3A 2I4OA 2FPPB 1YDEA 1ZK4A 4H7IA 1M2NA 3BTVA 3OFVA 2IPAB 3AIOA 3UJCA 3P26A 1RE1A 3TZ6A 5CBKA 1RJDA 2LKCA 3W04A 3B8HA 3OBBA 4IIYA 3W8RA 4E5DA 1ODIA 5JNUA 2R5WA 1S4QA 3O1HB 4V39A 3SQNA 1KZGB 1RRFA 4DUGA 4HP8A 4OHFA 3RQSA 1OBVA 2VPIA 1YZTA 5I7UA 4BB9A 3NH9A 3ZV4A 2CNLA 4BNXA 2D2FA 3C4VA 1EUZA 4KR3A 1KKMA 3BFJA 1WX1A 3Q85A 3T7CA 1MB3A 2EJTA 1SZCA 5L95A 1IU9A 1JFLA 2EIHA 4ZARA 1MQSA 4GKVA 4YAWA 3V4FA 2AW5A 2QRVA 4EZIA 3KQPA 3A1SA 3LXUX 3PQ5A 4HS4A 1QC5B 2W6CX 1X8LA 3O9VA 1E0AA 2R1VA 1P5RA 1AK1A 2GI4A 2J3LA 2R1TB 4DA8A 4E15A 1JG4A 2ZCVA 1XZ8A 1Y4ZA 5E3IA 4G5FA 1YK1A 4ASUA 4LNAA 3PI7A 5CX1A 2FRXA 3QUSA 2H4ZA 3KZOA 5TF4A 1C50A 2GAJA 1BKYA 4B2IA 3RWMB 2VDWA 5CT5A 3D81A 2Q7XA 1UEJA 5CNJA 3LOQA 1L4YA 1YQWA 4I81A 3AF4A 3TD6A 3VJMA 2PX0A 1BHO1 1QIGA 2NG1A 3F6BX 2BDTA 4KH0A 2QTMA 3EGDB 4NV0A 4WIAA 1TCUA 3KPVA 3T12A 4CDRA 3SHTA 3N8HA 1ZN8A 3HYLA 1NZFA 3N05A 4IGIA 1U2QA 4BXOB 3AVVA 1I1QB 1JHMA 2VATA 2OFXA 2IZZA 1TRHA 3LWDA 3CZQA 1JHXA 2Y0PA 2NO1A 1ZINA 3VPDA 3M7IA 3GLGB 2XUJA 3RJTA 2KLBA 2ALJA 1CEQA 3B13B 3H5WA 4N49A 4EITA 4NX2A 5A3QA 4P92A 1DWPA 2H52A 3WLOA 5KU7A 1G2QA 5LP1A 4A4DA 3P19A 1PW7A 1XG5A 1A2QA 1MKYA 2CVOA 2HQOA 4Z7OB 3WSTA 4L51A 5CDTA 1ZC3A 4N0EA 4FYWA 4QPCA 1OPRA 3B2NA 1V8ZA 1OZAA 2Q1SA 1KJWA 3NBFA 2HWKA 5DTQA 1WNFA 3EPLA 1PEKE 4DCOA 4MA0A 1ZM7A 2ZJAA 4LCBA 4LOLA 2IBTA 1CUYA 4F86A 5KOJA 3BWBA 2WAXA 3UPTA 4PYJA 1M2JA 1ADCA 2QZSA 3X2EA 2VOJA 2CVPA 3FCSB 3WO1A 3GT4A 4NBWA 1Z6TA 5DF1A 3TR5A 5GM2A 3BUSA 1I3OA 2PJZA 2Z8YA 2H1SA 1KEVA 3MTIA 4OOEA 1Y5NA 4PGAA 2FWRA 2IIPA 1XEFA 1GY8A 1W94A 3KQQA 4DBLC 4EWLA 2OHGA 3L7YA 4FFLA 3R3HA 1UQRA 3WKCA 2Y66A 3PKZA 4EVQA 3Q10A 3FYUA 1CC1S 2VRCA 1C8KA 1B73A 3LP5A 4MQLA 5B1HA 3RTDA 3KZCA 1SVMA 3SBXA 3TLKA 2J0UA 1FFXA 3HBLA 5EZYA 5SV2A 1Y8AA 4JLUA 5CEFA 5JAQA 4WXPA 2VYNA 3ZY6A 2PTHA 4ZMRA 1RQLA 4DWWA 4PZPA 4RTSA 4Z3DA 3KXDA 1QHSA 2YV1A 5JXGA 3DJYA 4FOPA 1FUIA 2APJA 2YN2A 3F1KA 1Z17A 4K6OA 5ER9A 2L19A 3ZCQA 3ZQ6A 4AURA 1SOWA 5KVQA 1DL5A 1DFHA 3K6SB 3A4TA 1T1SA 1L4UA 1ZEJA 3W7AA 2OXTA 4RY2A 1EVQA 1P4GA 1QMPA 1ONNA 1QF7A 4BV3A 2RB4A 5I51A 1ACJA 3HY4A 1WSDA 4YQFA 2M6RA 1HE3A 2CDBA 3KZMA 5FHRA 2PFKA 5JIBA 5I4BA 1RPNA 4L76A 1G8HA 1G8MA 3PXUA 4IHJF 5HDQA 3S1AB 3ZXSA 2CLIB 4QEDA 4H3KB 3RYCA 1R4NA 2RK3A 3FG9A 2QVXX 3A6LA 3NORA 4Y30A 1W76A 5AH0A 3O21A 4BEJA 5FP0A 2JAPA 2XMDA 1R8JA 1FXWF 3V1UA 1N78A 3ETDA 2P2ZA 5B6JA 1A2OA 3KKMA 4KO4S 4KQIA 4Q6WA 3TRDA 2VWQA 4JJGA 4X94A 2AOUB 3C39A 4WXRA 1JS1X 3RYTC 1QNLA 1OLUA 2JFBA 1GVNB 3PGKA 1IN6A 4TZTA 5H3CA 1RCTE 1PBNA 4YJ3F 3SPXA 5L8VA 4B80A 5J4HA 3TNJA 3G2PA 4MV6A 2FFRA 3T1HB 3VHQA 1U8XX 4CF4A 1GAJA 4AM8A 1CUXA 1SKBA 1VMKA 2VTBA 2GKSA 3KJXA 1R0RE 3P96A 4HUQA 3KWJA 3WHIA 4RU1A 1D9XA 2GBIA 4MWZA 4WCVA 4NFSA 4URXR 1XTPA 2W2LD 4OIMA 3MC1A 4BPBA 5EE0A 1Z68A 1UBNA 5ENZA 4R2LA 1MG5A 4A92A 4ZFNA 1K08A 4TWRA 4B8WA 2Q2NA 1WO8A 3GDGA 2YWDA 3IODA 3PR1A 5JAOA 3Q9SA 4MW9A 4FP9A 5I9MA 4OV6B 3ZK7A 4BFSA 2Z3VA 3IAFA 4QJBA 3UK2A 3C3WA 1EUQA 1N6OA 2CD9A 2FEKA 4MPPA 2J3EA 1RW4A 1KC3A 4W99A 3L2OB 2WT4A 1NNUA 4WOBA 4D97A 1P4SA 1LQTA 4KQFA 1Q1BA 2P5SA 4ID3A 4Q03A 4YDQA 2FWPA 4TYWA 4I14A 3O7WA 2CVHA 3JQ8A 4GECA 2FPIA 3CZMA 3PHCA 2VDNB 4D80A 3AESB 4DN6A 3FCAA 3L0SA 4ZVTA 3F5DA 1ZL2A 1Q2UA 3HLTA 2CE7A 4XUDA 2MCFA 1TL7C 3DFUA 4HWOA 4PHTA 4JLWA 3EODA 4QBIA 4TTQA 1N57A 1H65A 4A2QA 4RPIA 5FPYA 3IELA 4LPSA 3CUVA 4OHPA 1H0SA 1DJPA 1K3FA 1ZVJA 2RAUA 4HGPA 4IQGA 4E7OA 1ESCA 1HDOA 3T35A 5KCZA 5JCJD 2Q3EA 4FX2A 1YUMA 4Q7QA 3DEZA 4C03A 1YJ8A 1GGEA 2P4QA 2XOKA 3KSDO 1PDVA 1YK0A 1N0VC 2YFYA 4G5XA 4JBGA 4I0WB 3GVCA 4FFBB 1JHQA 1C8BA 1N5LA 1WTCA 3TZHA 3OPNA 4DAOA 1UPTA 4KR6A 4TMKA 4Y2YA 2ZJ8A 1JA0A 1NDQA 2J30A 4I4IA 3HR8A 5T6BA 2O5RA 5CTAA 1V3UA 5KO2A 2P4UA 1YR9A 2WPNA 1RM5A 5F7JA 2NUPB 2JIMA 3DNFA 4W7IA 4DJTA 3FHTA 4L7VA 5EXEA 3DDNA 2AVDA 4FOOA 4WUVA 3PDCA 4O2BF 4YRFA 4P0QB 1NLUA 3NU1A 3O4FA 3LO8A 5AW5A 3I28A 1E3IA 3B12A 1YJBA 2YZKA 1UPCA 3GRUA 4UTRA 2Q0HA 3GWGA 4W8GA 3OM1A 4QHSA 4D0RA 2NU9A 2C5HA 4LRQA 4WXYB 3VO2A 3SR4A 4F60A 1RQNA 1GOTA 1UJ2A 1V11B 1XC7A 3K35A 3FMIA 5EE5B 1VE7A 4OYYA 3WHPA 1M6YA 3OJXA 4IMRA 3VOBA 1T2FA 5LA6F 2WFAA 3CXRA 1WUIS 1X1CA 4RDCA 4JLNA 1D5WA 4J3NA 4E94A 2QLBA 4Z9BA 1H5NA 1A71A 5EIHA 5EJAA 4EGAA 4DLAA 3COZA 4P53A 4AX8A 3UV7A 2Q2VA 4MIEA 5DEOA 3AEQA 1NOKA 2J3JA 3L1VA 2O07A 2N75A 3QE2A 5FAXA 4AG5A 9LDBA 9MHTA 1WDLA 5AVZA 5FWAA 3LKZA 1RJFA 3EW7A 2ZB8A 5F5XA 3UMRA 4PQRA 4A0HA 5EZQA 3AOEA 3TTXA 3OAAA 1VHTA 5AM3A 1UAGA 1PFVA 2JGRA 1ODTC 3CZ5A 4BTVA 4E46A 2DR0A 3F6SA 3GN2A 3O4RA 2Y6UA 1N7IA 4FFSA 2VLBA 4RJIA 3MJSA 4U3JA 4MYSA 4B73A 4UHFA 1ULHA 1JFTA 4UQPA 3R6DA 1HNZB 1AXRA 4K6CA 5LMUB 1B1CA 1BKSB 3OQHA 1FP2A 1I14A 5CXSA 3ZWKA 1KP9A 4KN6A 4Y2GA 1QDEA 2JIOA 4G25A 1IQUA 1DBWA 3OSUA 1Q0PA 5JYEA 2F3TA 1TAUA 1NL3A 2CJWB 5BSMA 5BW4A 1EG7A 1NLZA 1K7XB 4PRLA 2EZ8A 3SKXA 2WWWA 3FPCA 1HDCA 5IVIA 3NNDA 5KOYA 1I4WA 2DH6A 4DW8A 2ZIGA 3H86A 3HKCA 4OJQA 4DOMA 2QP9X 1Y7IA 2QTBA 2Z5GA 1RHKA 3M89A 1PBTA 3DNPA 4D4IA 4MR8B 4RS4A 3AQIA 1SOUA 4DNXA 1GG9A 1HT0A 3AEKB 2G07A 1MGPA 2E55A 2CJXA 1IUNA 5D5QA 4LSWA 5ESRA 2I3ZA 2DZDA 3F78A 3T9DA 4B3XA 1MABA 2JGLA 1OWNA 2WFZA 1ZIYA 3N5KA 4MZXA 5FA8A 3VC2A 1SKUA 3R44A 1G9TA 2XSZD 2PZFA 4JYPA 5DM60 4G0YA 5E4YA 4ZYVA 4D44A 1G38A 4OOFA 2P2YA 5KYVA 1NUSA 2OCKA 3SJBA 1YRYE 3ZCPA 3DWEX 3CLRC 1Y7PA 3L6BA 4PO8A 3A6HA 4LRYA 4A73A 3AYXB 1NVVR 1A9YA 1XQXA 1U7UA 1XVAA 2JFOA 4IDHA 5THKA 3S1SA 2ZRHA 1L5KA 1Z4JA 2MJLA 4XRRA 1C30A 1YS1X 1XMIA 5JS7A 2HW8A 2YWGA 1G7RA 1G8KA 4IR7A 4XVRA 1KJ8A 1WCV1 3CISA 3ESBA 1JW9B 4O0LA 4DADA 4EW1A 1WVMA 5EIOA 1QX3A 1GCGA 3C7DB 3SC6A 5F1YA 3OLYA 1XMQB 2C8KA 1BS2A 4EABA 1SUWA 1HRKA 3CUEF 2EHJA 2AE2A 1NN0A 1NX6A 1Y8QA 5EIBD 2AZTA 2NUAB 4BPRA 4BNKA 4Y1EA 4CL0A 3CRVA 4DFDA 3WWYA 5HYVA 2WT9A 2A57A 1XN1A 2E82A 2P9TA 1B2RA 1ZM9A 4EATA 2BP7B 3VHLB 4UAJA 1RWWA 4XOUA 3OHSX 2O4UX 3WX0A 1E6MA 1YJQA 1W0KA 3JZAA 3ZZ1A 3RROA 1DB3A 1U0RA 4N82A 4CMIB 3BCUA 4R1UA 3FMFA 3C3AA 1ZD1A 1NM5C 4E1AA 1XZEA 1V8PA 3PRHA 5CW1A 2E4AA 1KYYA 1ZHHA 4LMBA 1E4YA 3QVKA 4ERXA 4EVRA 3RUIA 3IOCA 2YVKA 1IOWA 2RHMA 3GK3A 1YAHA 3PQ8A 1KRXA 2K2QB 1K86A 2JHGA 2FDXA 2PCJA 1VHDA 3BWEA 4GNKA 1Z6YA 5D84A 3V34A 3W8NA 1X13A 1I2MA 2JGDB 3OZTA 4ED9A 1T5LA 1CUVA 2ZYSA 4DDMA 2V6IA 4YAFA 1WHTA 1WF3A 3ZIUA 4J76A 5A71A 4Z4EA 2ACKA 4CMHA 4M0UA 5FFMA 3VO8A 3K0EA 2BFEB 5TQ0A 3H4VA 4WX2B 5TX7A 5DTEA 3RE1A 2ZVQX 3SM3A 2ZYTX 3B3FA 3HI4A 3BZUA 2FWNA 4PW0A 1OXUA 4CT5A 4OQQA 3T7EA 4B32A 3HB7A 4O4LA 2Q7DA 4DABA 4Q1EA 3OZVA 2H18A 3O03A 3EXFB 1V6SA 2JFVA 1K66A 4OPMA 3UMGA 2O2HA 3HL0A 2ZJFA 5LUBA 1P1BA 3S5UA 3WWDA 3ZS8A 4BWFB 5K6AC 3M6VA 3ZD7A 2OKGA 4I5EA 3B3JA 1S7GA 2VBCA 1N0HA 4DV0B 1R1DA 4GSKA 4NEQA 1EGAA 4DSZA 2PUFA 3WP0A 2MYTA 3AFMA 3TTWA 2VP6A 1X1BA 4D0GA 1V71A 3Q8KA 3K30A 4TYPA 5E4JA 2XE8A 3AKZA 1M66A 2MYUA 1T2DA 1ZUD1 1M2WA 1Y5LA 4CVNA 4TS3A 5CYPA 2I7VA 5KYGA 3U4QB 5JZOA 3MTJA 3EEQA 4IH4A 2J3DA 3OQ1A 3ANNA 1GCOA 1SPXA 3MM4A 1COWD 2ORWA 2CUZA 3C3DA 3MWDA 1PQUA 1IN1A 1ADBA 1BXKA 3WL5A 4N5LA 3JQAB 1GTVA 1A9XB 3DE0X 2G17A 1HEUA 3LHKA 4FR0A 4Q47A 1AZLA 1OFUA 4DQXA 1SHJA 5BW6B 1U7HA 2QR5A 2I65A 3DPSA 4BIIA 5LJLA 3RREA 4QU0A 2HIHA 4PONA 4ZAXA 1T3SA 3IDOA 2AMVA 3KV1A 5K0ZA 4OXRA 3PHLA 1F8UA 2BI4A 2E4ZA 1V9LA 5KJ1A 4UUBA 2ORED 1XRLA 1NJ1A 1KI6B 1SHKA 1TZJA 2HWXA 3FFXA 4U2GA 4F12A 4OH7A 2QUAA 4Q4CA 5HMMA 1YQUA 2V58A 4AUNA 4EQ6A 1KKLA 2ISSD 5C8YB 4G07A 2B2XA 2L17A 3GZJA 3NOVA 3VR5A 1DWUA 4MUNA 3ZDYB 5HS4A 2HIGA 3V2IA 3ZHQA 5KTSA 1V1MA 3AVTA 4FFNA 4K28A 4U1RA 4YK7A 2YJZA 4JI7B 4AZ0A 4P6VF 3LQ2A 4Y9TA 2QTWB 3G9UA 3GAMA 3VV3A 4ESOA 2ZYWX 3S8EA 2FR1A 4Z6KA 2DFNA 3DE5X 4BMSA 2A84A 3FCXA 1XU4A 1EX9A 3EB9A 1FP7A 1SVNA 3BGIA 3ELUA 3IP1A 4ISCA 3V7WA 4DLNA 2I29A 3EG9A 3ROKA 5KQLA 1CZRA 4DC1A 1C1YA 4KFCA 4KR7A 2I2FA 2PKYX 4JV5B 1QIJA 2Q3DA 2MYPA 3BSWA 5EUQB 5HM8A 3PC2A 5CLJA 1EB8A 1BU5A 1OOEA 3BMCA 4FE3A 4JT4A 1SUAA 5ULLA 3A28A 4DANA 2UZ3A 1IEXA 4WESB 4QQFA 4G1FA 4TYNA 1FA9A 1SRQA 4ARIA 1P72A 3QK7A 4C7BA 5LZ9A 2IPNA 3U1BA 2PRZA 2Z30A 3Q3IA 1AKMA 5GVSA 1PDOA 2FMIA 2RC5A 2FZVA 4XDGA 1NNEA 3FF1A 4F4FA 1ZK1A 2IYZA 1LDBA 3ZWVA 2XLBA 5C8YF 2GPSA 3R5JA 3D3NA 1MXFA 2ACWA 1GDTA 1IBKB 1G21A 4E5YA 5EP1A 3ESYA 1T3LA 2ECPA 3SX2A 4L4XA 1ONOA 1GA1A 1Q3KA 1X7WA 2DFKB 3ITEA 3ORQA 2ZJ6A 1L5RA 1OA0A 1SZDA 3IAHA 3PA6A 3PPIA 4RUKA 4YXFA 1ODCA 2FCAA 4F85A 5BV8A 5FI1B 2HT6A 2Z1MA 1RRCA 2NV6A 2BBWA 2FFJA 4YP9A 1MAUA 3TYXA 4BP1A 1ZWKA 1G6Q1 3DD5A 3IUYA 1L4GA 4OHXA 4U2DA 4DWJA 3NEYA 1IE3A 5K6RA 3OJ0A 3C97A 1MC1A 5FWNA 1TKAA 2AI2A 2XX3A 1U90A 4J7CA 1ISHA 1TCVA 3IULA 1REQB 1SKYB 3O95A 4V0ME 2NNLD 5L45A 2HXSA 1OREA 1ZK3A 3PR2B 1JEDA 3HVUA 4JB3A 1NBWB 1N1GA 4AP5A 2EJBA 3KJFA 3CN9A 5C1BA 2FX2A 5B6IA 3O38A 4JQOA 4ZVMA 1T9DA 3H84A 3L8EA 4GWLA 2GYWA 3MB5A 1Z4QA 2R2AA 2GFIA 3TNLA 3VR4H 3M4XA 5JI3E 3QNWA 2FUNB 4AWXA 3A4LA 4UUQA 4ZI2A 1N2CB 2EJWA 3W5JA 1GN9A 1ZO8A 5KB3A 3OCXA 2PXXA 5AW1A 3VA7A 2I4IA 4D6PA 3E0QA 4ESHA 4ZIRA 4RY0A 5T3YA 1Z38A 2FX5A 3B5EA 3BQNB 1ZD4A 2N3ZA 2ZROA 4TLCA 3T5MA 1JIJA 2AFIE 3OF5A 5EP2A 4RHEA 5KS2A 1M1YA 2CLMB 2FWJA 1NV9A 3JQ8B 1KKUA 1TUBB 2R6AA 2KM1A 5IBCA 3H1PA 1L5NA 1JKIA 1LTQA 1KHHA 2YJ4A 4Q34A 3E9RA 2R5FA 4K7JA 5FDFA 3E22A 4OJKA 4DDHA 1E6EA 5EHNA 1XVUA 1B3RA 1LBHA 4P3YA 1ODJA 3A1CA 4E03A 2WINI 2DPMA 3V1KA 4AJ9A 1J0DA 4BV2A 4DCMA 3CPSA 4MUYA 3OQPA 1F1JA 3QEKA 4R1NA 5JBQA 2CE2X 2Q6KA 3C3KA 4ZCMA 5HGXA 1XMPA 4IZHA 4UPDA 1YTLA 4IXNA 3ZHCA 2QRNA 5A4JA 3CIFA 3DMRA 3R8FA 1OXBB 4IWXA 3NETA 3O73A 3PWZA 2Z8XA 3KT8A 1FLDA 3AIKA 1XA0A 2H08A 4GC9A 3DVLA 3TIXB 4RA6B 3IJEB 4FNOA 4UEWA 1UEXC 3GRPA 1L4BA 1PL6A 5TJHA 2PXCA 3X43A 1OI3A 1UADA 1XTZA 3DOEA 4BVBA 3CRRA 2Z8ZA 5COBA 4JWKA 4Z4HA 2CL6X 1T8RA 3FUCA 4XXHA 3SHQA 2HA0A 3WXMA 3GUYA 3WBFA 3RJZA 1BHSA 2QY9A 1NRJB 4IDAA 3SK0A 1IZ0A 1NMYA 2JDID 2QJWA 1PIWA 4GKBA 2Z2KA 1WPRA 3IOYA 3PITA 4K8OA 2I6SA 2PBZA 2R2GA 3AI7A 3SR0A 5IBPA 5FT9A 5COAA 1H1LB 1Z39A 2C77A 1J2UA 1G7SA 3Q11A 1SC3A 2NU9B 2OXEA 2PUJA 2ATEA 5AVWA 1PS8A 5ALFA 4GX0A 2QTHA 4PNPA 2E3JA 5AHKA 3VVMA 3P71T 4J8PA 1FU7A 4HAIA 2AOWA 2CFIA 2QX6A 1FPMA 1KOJA 1MENA 2KYRA 3BE4A 4TYYA 2QJFA 4WCDA 1TW3A 1WHSA 1XOIA 4DXHA 5EKSA 4BDSA 1BEUB 5T4FA 1GFSA 2Q3FA 1LC0A 3AUYA 1GKLA 4AULA 4I9FA 3A1UA 2C4NA 3GJ6A 3ROEA 1BA2A 2OD2A 2XIQA 1W36D 2QTNA 3RFTA 2JHCA 4CEJB 2NAPA 2VRBA 3C6YA 3RODA 4ETMA 4EY6A 4GYYA 1SXJC 2JI9A 5FPHA 1CQXA 4A2CA 5E9JA 4EHKA 3OQVA 1RAIA 1T36A 2JB9A 3EGIA 1Z25A 4FC6A 2ACVA 5IKOA 3WDLA 1JQDA 1QXSA 5CCXA 3B9QA 1GNQA 3R0XA 3MJ4A 1GRQA 1W19A 4HDKA 3U3XA 3GJXC 3OJWA 3IO3A 4OHKA 2OZKA 4RV9A 1YVPA 1M10A 2HUNA 1I3LA 1UBKS 3OTGA 1MFZA 2VXYA 2AL7A 3B6EA 4CM9D 3QJYA 4PLHA 2O1SA 4QECA 2IL1A 2AFIB 4RL4A 1HZJA 2NMVA 4W9NA 1R5OA 4J0CA 4C4RA 1NVTA 2BBOA 4H2DA 4Q01A 5C8DA 3W5SA 5HIMA 3Q1KA 5F7ZA 3JZDA 1T6ZA 3EARA 4GI1A 3RTBA 3FAKA 4TV9A 3K9BA 3V9PA 4O02B 1SBTA 1V5EA 1YKGA 1QOPB 3ZXIA 4GG1A 5JMPA 3A1TA 4U7HA 4XQ0A 3N2ZB 4UU1A 3TZKA 2J07A 4J49A 3MXTA 4EG7A 5BWOA 4YJHB 4TM7A 4B1FA 1JXAA 4UOZA 3IFSA 3G0GA 4X6YA 5EWJA 1ISRA 2WQ6A 1FTSA 3PIIA 3SVTA 3GNTA 4DRXA 1LRKA 2O57A 5E3JA 2GNAA 2QT9A 1Y8ZA 3RAJA 5HEKA 4DQDA 4WBNA 4YUVA 1CR1A 2OFWA 3E0XA 3GLQA 3PJEA 1TT7A 5BN4B 2RK4A 5IXJA 3LKDA 4YAKA 5BQOA 1F0KA 2BMJA 3ZWDA 3V6MA 3FWZA 1LS1A 1QCDA 4ER0A 5AVVA 1EJ0A 1LW6E 2XB6A 5C1IA 4HQ0A 1FUUA 1KK1A 2OAP1 4PWZA 1Y8QB 3A6DA 3AY6A 4KH1A 3AEUA 4OBXA 5EIWA 2PUEA 3ZHBA 5LQAA 1Z63A 4PHHA 4HYEA 2GZ2A 2GBPA 1ESDA 5JECA 1U2GC 1MC8A 3PFFA 5JISA 3B9PA 4A2WA 4BP8A 3GXBA 3QBVA 5EZSA 4QLAA 5IJXA 2DETA 2ZJ1A 4O5OA 3UJ7A 3TSWA 2BSQA 5F9MA 2C2MA 4H7JA 5JALA 2GZAA 1PWEA 3WKBA 2PVPA 2FF7A 3MGAA 4INZA 4H18A 1VA4A 4M7PA 3N8GA 2A9QA 2FQXA 1HT3A 1NE2A 2OA0A 1P2SA 1PDWA 2LIVA 2OCDA 1VG9B 3OE7D 2R6CA 4O4JF 3WSWA 3WRYA 3EGOA 3FUUA 1SOVA 2VTDA 1Z0JA 4UFNA 4CPDA 5TSDA 1VRVA 2HNAA 2WVAA 1P61B 1UFQA 4TROA 3NJ8A 4B6FA 1SNYA 1XUOA 1WPGA 2I2CA 1K5HA 3B9RA 4HH4A 3B1JA 5HFAA 2K7ZA 2PRKA 5D85A 4CGZA 1ZN7A 5FUWA 1MPTA 2QYSA 3OWXA 1J2YA 3ADPA 3HXOA 1PD0A 3NRBA 5JSUA 4QGSA 4F8JA 1CFJA 1QZTA 1NXVA 3BB1A 3OJOA 4MRRA 5DO9A 3W8EA 4C29A 1VJCA 1YZYA 2GZSA 1YC5A 3DAGA 4KWHA 5AJUA 2BEVB 2C54A 1PV2A 4QTUB 2BC9A 1YQTA 2F1RA 4OI2A 4CIDA 3JSAA 4HRXA 2R96A 3TTSA 1P73A 3RB8A 3R8CA 1G18A 1NBME 3F6EX 3FHJA 4YTEA 2VJDA 1BCSB 2WICA 5ADUS 1OBFO 2JFHA 2C2HA 2IYYA 1QR2A 1Z07A 2LXNA 3KVRA 3P0IA 4K8RB 4DA6A 1OYOA 2YJNA 1LU9A 4RY9A 1SELA 2R48A 1NBMA 3CKKA 2CFSA 4F6CA 1X7HA 3GLHA 4G6ZA 4AJOA 3A9RA 2P6MA 3OWHA 2P6RA 4MGHA 5LQNA 2X3UA 2GAFA 1WEHA 3DL7A 4PLVA 3LKVA 4L8YA 4GQAA 2D1TA 4RDIA 5K03A 4WA7A 4I4LA 1B7GO 3ESXA 2CEAA 3CGGA 3E3LA 1LF5A 2F3SA 3H2JA 5JFGA 4JJFA 2X2PA 4YIKA 3SYKA 4MQ4A 4KR0A 3VR0A 2DTDA 1VYTA 3QM1A 3I39X 3B89A 3JQAA 3P2KA 4GEKA 3IHWA 2QU8A 3EWIA 1QH1B 2H06A 3PRJA 3PL1A 3EXHC 3JWPA 1YA4A 1JNXX 2X7JA 4NCXA 2Q3HA 2PX6A 4OF4A 3PT5A 4HGZA 2WEKA 4EL0A 4BS9A 1W34A 5SZJA 2OCAA 2OZLA 4XVCA 3IQFA 1P1IA 2ZI6A 3ZD9A 3PK0A 4HDNB 1Z4NA 3NVAA 4IDFA 4P22A 1NOIA 5FYDA 4XQCA 2Q0SA 4B82A 2IYPA 4UVDA 1PT6A 3V2HA 4F4CA 1L7EA 3QBJA 3LDAA 4GOXA 3PGXA 2OK8A 2VA9A 3ENVA 4RLFA 4D4JA 3KETA 4XRGA 2ZYUX 2W58A 2WB4A 4UZEA 2BR3A 5DVZA 3ZW8A 4YR7A 3A2NA 1FXUA 3CIOA 2YIMA 2ST1A 4X6XA 1MRSA 2QENA 5C8YA 5H9WA 1T0PA 2N46A 2F3UA 4FKMA 3AVYA 4JYMA 5HOQA 3IRVA 2V4UA 2YOHA 1DEKA 5AJYA 4K9KA 2IYLD 3ZGYA 2J3IA 2I8AA 1WOYA 1LNQA 1QTRA 1X80B 2TS1A 3GGJA 4ZCRA 5L3SB 4FJ0A 4HV4A 4CUJA 5H8WA 2XT0A 5FFFA 3K09A 2PXAA 2VBFA 5HM6A 1U5AA 5BWMA 4JR2A 1DRWA 4HX5A 1G63A 4O2BA 2PBFA 4F4UA 3I9KA 3WBJA 4R2XA 2WB2A 3Q7SA 4PSCA 4O8ZA 5IX8A 4GGMX 3KAQA 1W4AA 3OPQA 2WA2A 3THRA 4RZQA 3ZWQA 1GTG1