1EBVA

Ovine pghs-1 complexed with salicyl hydroxamic acid
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
551
structure length
550
Chain Sequence
VNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPEIWTWLRTTLRPSPSFIHFLLTHGRWLWDFVNATFIRDTLMRLVLTVRSNLIPSPPTYNIAHDYISWESFSNVSYYTRILPSVPRDCPTPMGTKGKKQLPDAEFLSRRFLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQMLNGEVYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYATIWLREHNRVCDLLKAEHPTWGDEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQLKFDPELLFGAQFQYRNRIAMEFNQLYHWHPLMPDSFRVGPQDYSYEQFLFNTSMLVDYGVEALVDAFSRQPAGRIGGGRNIDHHILHVAVDVIKESRVLRLQPFNEYRKRFGMKPYTSFQELTGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEMGAPFLKGLLGNPICSPEYWKASTFGGEVGFNLVKTATLKKLVCLNTKTCPYVSFHVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title O-acetylsalicylhydroxamic acid, a novel acetylating inhibitor of prostaglandin H2 synthase: structural and functional characterization of enzyme-inhibitor interactions.
pubmed rcsb
molecule tags Oxidoreductase
molecule keywords PROSTAGLANDIN H2 SYNTHASE
total genus 186
structure length 550
sequence length 551
ec nomenclature ec 1.14.99.1: Prostaglandin-endoperoxide synthase.
pdb deposition date 2000-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF03098 An_peroxidase Animal haem peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.640.10 Mainly Alpha Orthogonal Bundle Myeloperoxidase, subunit C Haem peroxidase domain superfamily, animal type 1ebvA02
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1ebvA01
3ZS0C 2PR3B 2W3KB 1LPGA 2Y5HL 4NA9L 3BXIA 4NGAL 4YT7L 2J34B 3U73A 2IPSA 3V64C 3LC3B 1L5GB 1HCGB 3U7UG 1G1RA 2UWOB 1NFXB 1DIYA 1EZQB 1IVOC 1D7WC 5GLSA 1EMNA 3HS7A 2W2QE 1ATEA 2P93L 3NT1A 4C1MC 1DNWC 1EBVA 1W7XL 3KRKA 2XC0L 2K2SB 2Y82B 2EI6B 3KL6B 4CUEA 2Q1JB 2WG4B 4BXSA 1DX5I 1SZBA 4COXA 3EGFA 3F1SB 4DL1C 3P5BL 3TBDA 2JKHL 2G00L 3R5OA 3I6NA 1APQA 1CCFA 2BZ6L 1COUA 1FF7A 4Z0LA 3ZS1C 1JBUL 1PTHA 3TH3L 1GK5A 1ADXA 3GCLA 2Y38A 1KSNB 2EI8B 2VH6B 4Y76B 1G1QA 1YO8A 3ENSA 1HAFA 1FSBA 1UZPA 1XKBA 4YT6L 3N8ZA 1G1SA 2GD4A 2DDUA 3N8YB 1DDXA 1CXPC 3MQEA 4MMXB 1APOA 2Y80B 5JBBE 3NJPC 1IQKL 2J2UB 3F6UL 3FFGL 2WPHE 5EGMB 3OLTA 3HO5A 3CA7A 1PFXL 2MGRA 1J9CL 2BQWA 2OYUP 1MOXC 1NFYB 1B9WA 1XKAL 2WPKE 5KN5C 3Q3KB 4OTJA 1IGZA 3ZYGA 4KSZA 3SXVA 2Y5GL 2W3IB 3HS5A 2AYLA 2KL7A 5L2ZL 1HZ8A 4M11A 2W86A 5E8DA 3HO4A 2P16L 2WG3C 4HHSA 4LJJA 2H9EL 2J38B 1IQHL 1CQEA 1YUGA 2EI7B 2PHBB 2WYGB 4MMZB 2J95B 1LMJA 1G2MB 3CENL 1DNUC 2IKCA 5IKTA 3ZYJB 2W26B 5CKMA 1O5DL 3QH0A 3ELAL 3HS6A 3KQEL 1IQJL 1ATAA 2BMGA 3ASIA 5FF1A 1F7MA 4ZHAB 1IOXA 2Y7ZB 4Z0KB 1NFWB 1X7AL 2YGPA 2QQTA 1JL9A 1TLEA 2KV4A 2BOUA 2RNLA 1ZAQA 1XFEA 2P26A 1LPZA 2MHPA 3V65B 1CEJA 2CJIB 4Y71B 1RFNB 5KIRA 2VWLL 2E9EA 1U8CB 2XBVL 4CUFA 4BTIA 1HRFA 2NQXA 1K36A 4E1GA 6COXA 4YZUB 3KQBL 1WU1B 2W2OE 1IQNL 1WHEA 1EMOA 2XBYL 1JV2B 1CX2A 2GJMA 1MQ6L 1IGXA 2WFXB 1FAXL 1IQFL 2XC5L 1IQGL 4Y55A 2J94B 3R55A 1W8BL 3Q9KA 2UWLB 1F0RB 1Z6CA 4JYVL 4Y79B 4LORA 1WHFA 2EHAA 2J4IB 2R5LA 5JB9E 3S4FA 1A3PA 1BF9A 2VWMK 4D0FA 1HAEA 3KK6A 5IKRA 5F1AA 4O1ZA 4PH9A 4HHRA 2W2ME 1K37A 3FAQA 2BOHA 3KQDL 3SW2A 1N7DA 2QPKA 5L30L 1TOZA 4RUTA 3OGWA 5IKVA 4RRZA 1UZKA 3CFWA 4KVKA 2FZZL 1KLIL 3GCWE 4OTYA 2D1JB 2VWNL 1CVUA 3QCWA 3QF1A 5HPWA 1PRHA 4A7IA 1HJ7A 4FM5A 3V6QA 2BQ6A 2PUMA 4NG9L 4KVJA 2BOXA 1NZIA 2EFBA 2OYEP 2P95L 1FE2A 3N8FA 1D5LC 3RR3A 1U67A 1LPKA 2WYJB 3SOQA 3GCXE 3LTFB 4BDWA 2P3UA 4BXWA 1PGEA 3NIUA 1IP0A 2WFTA 3ERHA 4XLWA 3HO3A 1AUTL 3GCKA 1FJSL 3LIWB 3TK5B 1QFKL 4KVLA 3DEMA 4ZH8B 1EPGA 1XDTR 4NT3A 4D90A 1CCVA 2YGOA 3M36L 2W2PE 4GN6A 1HREA 1NQLB 3TGYA 1F7EA 3Q7DA 3R5QA 4O02B 2FLGA 3LN0A 3C9AC 4BTTA 3FNLA 5JVYA 5JW1A 2K2TA 3QL6A 4CUDA 3N8WA 3PGHA 4PNXA 3LTGD 5JBAE 4ISHL 2VVCK 4X8SL 5FDQA 4NJBA 1UZJA 3OLUA 3IJEB 3UBAA 3NTBA 2VJ3A 4X8TL 2O86A 1P9JA 1EPIA 1IQML 4JYUL 2TGFA 1PXXA 1IQEL 1ATBA 2B7DL 3K9XA 1ATDA 3LC5B 4X8UL 2UWPB 3H5CB 1EQGA 2I9AA 4ZAEB 3KCGL 1L3YA 1NFUB 4BTUA 1DVAL 1G2LB 2ADXA 5GH0A 2BO2A 3LAQA 4X8VL 1EQHA 1EAIC 1CVWL 1F0SB 2WPME 1Q4GA 2W2NE 3IITB 2XBXL 4RS0A 3QMOA 1MHLC 4RRWA 2P3TA 3FBYA 4JZDL 5COXA 4C16A 2I9BA 3TGFA 1NPEB 2OJVA 1M1XB 2PUQL 4Y6DB 2MGPA 4D0EA 2P94L 3MDLA 1KLOA 1N1IA 3FCSB 4M10A 1D2VC 4XBMA 3NYHA 4MMYB 2M74A 3R05A 2XC4L 3R4XA 1NT0A 1DQBA 3GCJA 3M37L 1URKA 5FIWC 4RRYA 3PY4A 1KLJL 5F19A 4AQTA 3BT1A 2KB9A 3SOBB 5CISA 1MYPC 3N8WB 1Z6EL 2VWOL 2FD6A 3NAKA 2P3FN 3N8VA 4ISIL 4ZXYL 4QYQA 2Y7XB 3POYA 3TK6B 3N8XA 3N8YA 1UZQA 2WPJE 1C5MF 4BDXA 2VH0B 3CS7L 3BPSE 1YUKB 1EPHA 1G1TA 1TPGA 4Y7AB 1P0SL 1HT5A 3LN1A 4JZEL 4LMFA 5L2YL 4GM7A 5IKQA 2QRBA 4QJQA 4TGFA 3HPTA 5CKNA 4XL1A 4N7AA 1IJQA 3ZYIB 3KRQA 2P28B 2F9BL 5K0HB 2BOKL 5B72A 2WPLE 1FFMA 5CKQA 3GC1A 1HT8A 4IG5A 2Y5FL 1IOEL 4CSYA 1YGCL 2Y81B 2RHPA 4Y7BB 2BQ7A 1IQLL 4Z6AL 1KIGL 5JBCE 3SOVA 1EGFA 3RKEA 5I46L 2VVUL 1MQ5L 1I0UA 2P3FL 2XBWL 1IQIL 4MSFA 4RRXA 1OB1C 3F9PC 4ZXXL 2NPRA 5JB8E 2FLRL 1LQDA 4JZFL 2PT3A 4OEKA 2RA0L 5JVZA 3GISX 1FAKL 3NTGA 3KQCL 1V3XB 2FLBL 3BT2A 3TZIA 2VVVL 2WPIE 1HX2A 1YUFA 1EPJA 3ERIA 4G1MB 2Z5ZA
chains in the Genus database with same CATH superfamily
3ZS0C 2PR3B 2W3KB 1LPGA 2Y5HL 4NA9L 3BXIA 4NGAL 4YT7L 2J34B 3U73A 2IPSA 3V64C 3LC3B 1L5GB 1HCGB 3U7UG 1G1RA 1LK9A 2UWOB 1NFXB 1DIYA 1EZQB 1IVOC 1D7WC 5GLSA 1EMNA 3HS7A 2W2QE 1QIUA 1ATEA 2P93L 3NT1A 4C1MC 1DNWC 1EBVA 1W7XL 3KRKA 2XC0L 2K2SB 2Y82B 2EI6B 3KL6B 4CUEA 2Q1JB 2WG4B 4BXSA 1DX5I 1SZBA 1V1IA 4COXA 3EGFA 3F1SB 4DL1C 3P5BL 3TBDA 2JKHL 2G00L 3R5OA 3I6NA 1APQA 1CCFA 2BZ6L 1COUA 1FF7A 4Z0LA 3ZS1C 1JBUL 1PTHA 3TH3L 1GK5A 1ADXA 3GCLA 2Y38A 1KSNB 2EI8B 2VH6B 4Y76B 1G1QA 1YO8A 3ENSA 1HAFA 1FSBA 1UZPA 1XKBA 4YT6L 3N8ZA 1G1SA 2GD4A 2DDUA 3N8YB 1DDXA 1CXPC 3MQEA 4MMXB 1APOA 2Y80B 5JBBE 3NJPC 1IQKL 2J2UB 3F6UL 1LMMA 3FFGL 2JJLA 2WPHE 5EGMB 3OLTA 3HO5A 3CA7A 1PFXL 2MGRA 1J9CL 2BQWA 2OYUP 1MOXC 1NFYB 1B9WA 1XKAL 2WPKE 5KN5C 3Q3KB 4OTJA 1IGZA 3ZYGA 4KSZA 4GU3A 3SXVA 2Y5GL 2W3IB 3HS5A 2AYLA 2KL7A 5L2ZL 1HZ8A 4M11A 2W86A 5E8DA 3HO4A 2P16L 2WG3C 4HHSA 4LJJA 2H9EL 2J38B 1IQHL 1CQEA 1YUGA 2EI7B 2PHBB 2WYGB 4MMZB 2HOXA 2J95B 1LMJA 1G2MB 3CENL 1DNUC 2IKCA 5IKTA 3ZYJB 2W26B 5CKMA 1O5DL 3QH0A 3S6XA 2BT8A 3ELAL 3HS6A 3KQEL 1IQJL 1ATAA 2BMGA 3ASIA 5FF1A 1F7MA 4ZHAB 1IOXA 2Y7ZB 4Z0KB 1NFWB 1X7AL 2YGPA 2QQTA 1JL9A 1TLEA 2KV4A 2BOUA 2RNLA 1ZAQA 1XFEA 2P26A 1LPZA 2MHPA 3V65B 1CEJA 2CJIB 4Y71B 1RFNB 5KIRA 2VWLL 2E9EA 1U8CB 2XBVL 4A94C 4CUFA 4BTIA 1HRFA 2NQXA 1K36A 4E1GA 6COXA 4YZUB 3KQBL 1WU1B 2W2OE 1IQNL 1WHEA 1EMOA 2XBYL 1JV2B 2BT7A 1CX2A 2GJMA 1MQ6L 1IGXA 2WFXB 1FAXL 1IQFL 2XC5L 1IQGL 4Y55A 2J94B 3R55A 1W8BL 3Q9KA 2UWLB 1F0RB 1Z6CA 4JYVL 4Y79B 4LORA 1WHFA 2EHAA 2J4IB 2R5LA 2HORA 5JB9E 3S4FA 1A3PA 1BF9A 2VWMK 4D0FA 1HAEA 3KK6A 5IKRA 5F1AA 4O1ZA 4PH9A 4HHRA 2W2ME 1K37A 3FAQA 2BOHA 3KQDL 3SW2A 1N7DA 2QPKA 5L30L 1TOZA 4RUTA 3OGWA 5IKVA 4RRZA 1UZKA 3CFWA 4KVKA 2FZZL 1KLIL 3GCWE 4OTYA 2D1JB 2VWNL 1CVUA 3QCWA 3QF1A 5HPWA 1PRHA 4A7IA 1HJ7A 4FM5A 3V6QA 2BQ6A 2PUMA 4NG9L 4KVJA 2BOXA 1NZIA 2EFBA 2OYEP 2P95L 1FE2A 3N8FA 1D5LC 1V1HA 3RR3A 1U67A 1LPKA 2WYJB 3SOQA 3GCXE 3LTFB 4BDWA 2P3UA 4BXWA 1PGEA 3NIUA 1IP0A 2WFTA 3ERHA 4XLWA 3HO3A 1AUTL 3GCKA 1FJSL 3LIWB 3TK5B 1QFKL 4KVLA 3DEMA 2VRSA 1EPGA 1XDTR 4NT3A 4ZH8B 4D90A 1CCVA 2YGOA 3M36L 2W2PE 4GN6A 1HREA 1NQLB 3TGYA 1F7EA 3Q7DA 3R5QA 4O02B 2FLGA 3LN0A 3C9AC 4BTTA 3FNLA 5JVYA 5JW1A 2K2TA 3QL6A 4CUDA 3N8WA 3PGHA 4PNXA 3LTGD 5JBAE 4ISHL 2VVCK 4X8SL 5FDQA 4NJBA 1UZJA 3OLUA 3IJEB 3UBAA 3NTBA 2VJ3A 4X8TL 2O86A 1P9JA 1EPIA 1IQML 4JYUL 2TGFA 1PXXA 1IQEL 1ATBA 2B7DL 3K9XA 1ATDA 3LC5B 4X8UL 2UWPB 3H5CB 1EQGA 2I9AA 4ZAEB 3KCGL 1L3YA 1NFUB 4BTUA 1DVAL 4GU4A 1G2LB 2ADXA 5GH0A 2BO2A 3LAQA 4X8VL 1EQHA 1EAIC 1CVWL 1F0SB 2WPME 1Q4GA 2W2NE 3IITB 2XBXL 4RS0A 3QMOA 1MHLC 4RRWA 2P3TA 3FBYA 4JZDL 5COXA 4C16A 2I9BA 3TGFA 1NPEB 2OJVA 1M1XB 2PUQL 4Y6DB 2MGPA 4D0EA 2P94L 3MDLA 1KLOA 1N1IA 3FCSB 4M10A 1D2VC 4XBMA 1KKEA 3NYHA 4MMYB 2M74A 3R05A 2XC4L 3R4XA 1NT0A 1DQBA 3GCJA 3M37L 1URKA 5FIWC 4RRYA 3PY4A 1KLJL 5F19A 4AQTA 3BT1A 2KB9A 3SOBB 5CISA 1MYPC 3N8WB 1Z6EL 2VWOL 2FD6A 3NAKA 2P3FN 3N8VA 4ISIL 4ZXYL 4QYQA 2Y7XB 3POYA 3TK6B 3N8XA 3N8YA 1UZQA 2WPJE 1C5MF 4BDXA 2VH0B 3CS7L 3BPSE 2YGQA 1YUKB 1EPHA 1G1TA 1TPGA 4Y7AB 1P0SL 1HT5A 3LN1A 4JZEL 4LMFA 5L2YL 4GM7A 5IKQA 2KNIA 2QRBA 4QJQA 4TGFA 3HPTA 5CKNA 4XL1A 2BSFA 4N7AA 1IJQA 3ZYIB 3KRQA 2P28B 2F9BL 5K0HB 2BOKL 5B72A 2WPLE 1FFMA 5CKQA 3GC1A 1HT8A 4IG5A 2Y5FL 1IOEL 4CSYA 1YGCL 2Y81B 2RHPA 4Y7BB 2BQ7A 1IQLL 4Z6AL 1KIGL 5JBCE 3SOVA 1EGFA 3RKEA 5I46L 2VVUL 1MQ5L 1I0UA 2P3FL 2XBWL 1IQIL 2H9EC 4MSFA 4RRXA 1OB1C 3F9PC 4ZXXL 2NPRA 5JB8E 2FLRL 1LQDA 4JZFL 2PT3A 4OEKA 2RA0L 5JVZA 2WZPP 3GISX 1FAKL 3NTGA 3KQCL 1V3XB 2FLBL 3BT2A 3TZIA 2VVVL 2WPIE 1HX2A 1YUFA 1EPJA 3ERIA 4G1MB 2Z5ZA
chains in the Genus database with same CATH topology
3ZS0C 2PR3B 2W3KB 1LPGA 2Y5HL 4NA9L 3BXIA 4NGAL 4YT7L 2J34B 3U73A 2IPSA 3V64C 3LC3B 1L5GB 1HCGB 3U7UG 1G1RA 2UWOB 1NFXB 1DIYA 1EZQB 1IVOC 1D7WC 5GLSA 1EMNA 3HS7A 2W2QE 1ATEA 2P93L 3NT1A 4C1MC 1DNWC 1EBVA 1W7XL 3KRKA 2XC0L 2K2SB 2Y82B 2EI6B 3KL6B 4CUEA 2Q1JB 2WG4B 4BXSA 1DX5I 1SZBA 4COXA 3EGFA 3F1SB 4DL1C 3P5BL 3TBDA 2JKHL 2G00L 3R5OA 3I6NA 1APQA 1CCFA 2BZ6L 1COUA 1FF7A 4Z0LA 3ZS1C 1JBUL 1PTHA 3TH3L 1GK5A 1ADXA 3GCLA 2Y38A 1KSNB 2EI8B 2VH6B 4Y76B 1G1QA 1YO8A 3ENSA 1HAFA 1FSBA 1UZPA 1XKBA 4YT6L 3N8ZA 1G1SA 2GD4A 2DDUA 3N8YB 1DDXA 1CXPC 3MQEA 4MMXB 1APOA 2Y80B 5JBBE 3NJPC 1IQKL 2J2UB 3F6UL 1LMMA 3FFGL 2WPHE 5EGMB 3OLTA 3HO5A 3CA7A 1PFXL 2MGRA 1J9CL 2BQWA 2OYUP 1MOXC 1NFYB 1B9WA 1XKAL 2WPKE 5KN5C 3Q3KB 4OTJA 1IGZA 3ZYGA 4KSZA 3SXVA 2Y5GL 2W3IB 3HS5A 2AYLA 2KL7A 5L2ZL 1HZ8A 4M11A 2W86A 5E8DA 3HO4A 2P16L 2WG3C 4HHSA 4LJJA 2H9EL 2J38B 1IQHL 1CQEA 1YUGA 2EI7B 2PHBB 2WYGB 4MMZB 2J95B 1LMJA 1G2MB 3CENL 1DNUC 2IKCA 5IKTA 3ZYJB 2W26B 5CKMA 1O5DL 3QH0A 3S6XA 3ELAL 3HS6A 3KQEL 1IQJL 1ATAA 2BMGA 3ASIA 5FF1A 1F7MA 4ZHAB 1IOXA 2Y7ZB 4Z0KB 1NFWB 1X7AL 2YGPA 2QQTA 1JL9A 1TLEA 2KV4A 2BOUA 2RNLA 1ZAQA 1XFEA 2P26A 1LPZA 2MHPA 3V65B 1CEJA 2CJIB 4Y71B 1RFNB 5KIRA 2VWLL 2E9EA 1U8CB 2XBVL 4A94C 4CUFA 4BTIA 1HRFA 2NQXA 1K36A 4E1GA 6COXA 4YZUB 3KQBL 1WU1B 2W2OE 1IQNL 1WHEA 1EMOA 2XBYL 1JV2B 1CX2A 2GJMA 1MQ6L 1IGXA 2WFXB 1FAXL 1IQFL 2XC5L 1IQGL 4Y55A 2J94B 3R55A 1W8BL 3Q9KA 2UWLB 1F0RB 1Z6CA 4JYVL 4Y79B 4LORA 1WHFA 2EHAA 2J4IB 2R5LA 5JB9E 3S4FA 1A3PA 1BF9A 2VWMK 4D0FA 1HAEA 3KK6A 5IKRA 5F1AA 4O1ZA 4PH9A 4HHRA 2W2ME 1K37A 3FAQA 2BOHA 3KQDL 3SW2A 1N7DA 2QPKA 5L30L 1TOZA 4RUTA 3OGWA 5IKVA 4RRZA 1UZKA 3CFWA 4KVKA 2FZZL 1KLIL 3GCWE 4OTYA 2D1JB 2VWNL 1CVUA 3QCWA 3QF1A 5HPWA 1PRHA 4A7IA 1HJ7A 4FM5A 3V6QA 2BQ6A 2PUMA 4NG9L 4KVJA 2BOXA 1NZIA 2EFBA 2OYEP 2P95L 1FE2A 3N8FA 1D5LC 3RR3A 1U67A 1LPKA 2WYJB 3SOQA 3GCXE 3LTFB 4BDWA 2P3UA 4BXWA 1PGEA 3NIUA 1IP0A 2WFTA 3ERHA 4XLWA 3HO3A 1AUTL 3GCKA 1FJSL 3LIWB 3TK5B 1QFKL 4KVLA 3DEMA 4ZH8B 1EPGA 1XDTR 4NT3A 4D90A 1CCVA 2YGOA 3M36L 2W2PE 4GN6A 1HREA 1NQLB 3TGYA 1F7EA 3Q7DA 3R5QA 4O02B 2FLGA 3LN0A 3C9AC 4BTTA 3FNLA 5JVYA 5JW1A 2K2TA 3QL6A 4CUDA 3N8WA 3PGHA 4PNXA 3LTGD 5JBAE 4ISHL 2VVCK 4X8SL 5FDQA 4NJBA 1UZJA 3OLUA 3IJEB 3UBAA 3NTBA 2VJ3A 4X8TL 2O86A 1P9JA 1EPIA 1IQML 4JYUL 2TGFA 1PXXA 1IQEL 1ATBA 2B7DL 3K9XA 1ATDA 3LC5B 4X8UL 2UWPB 3H5CB 1EQGA 2I9AA 4ZAEB 3KCGL 1L3YA 1NFUB 4BTUA 1DVAL 1G2LB 2ADXA 5GH0A 2BO2A 3LAQA 4X8VL 1EQHA 1EAIC 1CVWL 1F0SB 2WPME 1Q4GA 2W2NE 3IITB 2XBXL 4RS0A 3QMOA 1MHLC 4RRWA 2P3TA 3FBYA 4JZDL 5COXA 4C16A 2I9BA 3TGFA 1NPEB 2OJVA 1M1XB 2PUQL 4Y6DB 2MGPA 4D0EA 2P94L 3MDLA 1KLOA 1N1IA 3FCSB 4M10A 1D2VC 4XBMA 3NYHA 4MMYB 2M74A 3R05A 2XC4L 3R4XA 1NT0A 1DQBA 3GCJA 3M37L 1URKA 5FIWC 4RRYA 3PY4A 1KLJL 5F19A 4AQTA 3BT1A 2KB9A 3SOBB 5CISA 1MYPC 3N8WB 1Z6EL 2VWOL 2FD6A 3NAKA 2P3FN 3N8VA 4ISIL 4ZXYL 4QYQA 2Y7XB 3POYA 3TK6B 3N8XA 3N8YA 1UZQA 2WPJE 1C5MF 4BDXA 2VH0B 3CS7L 3BPSE 2YGQA 1YUKB 1EPHA 1G1TA 1TPGA 4Y7AB 1P0SL 1HT5A 3LN1A 4JZEL 4LMFA 5L2YL 4GM7A 5IKQA 2KNIA 2QRBA 4QJQA 4TGFA 3HPTA 5CKNA 4XL1A 4N7AA 1IJQA 3ZYIB 3KRQA 2P28B 2F9BL 5K0HB 2BOKL 5B72A 2WPLE 1FFMA 5CKQA 3GC1A 1HT8A 4IG5A 2Y5FL 1IOEL 4CSYA 1YGCL 2Y81B 2RHPA 4Y7BB 2BQ7A 1IQLL 4Z6AL 1KIGL 5JBCE 3SOVA 1EGFA 3RKEA 5I46L 2VVUL 1MQ5L 1I0UA 2P3FL 2XBWL 1IQIL 2H9EC 4MSFA 4RRXA 1OB1C 3F9PC 4ZXXL 2NPRA 5JB8E 2FLRL 1LQDA 4JZFL 2PT3A 4OEKA 2RA0L 5JVZA 2WZPP 3GISX 1FAKL 3NTGA 3KQCL 1V3XB 2FLBL 3BT2A 3TZIA 2VVVL 2WPIE 1HX2A 1YUFA 1EPJA 3ERIA 4G1MB 2Z5ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZS0 C;  2PR3 B;  2W3K B;  1LPG A;  2Y5H L;  4NA9 L;  3BXI A;  4NGA L;  4YT7 L;  2J34 B;  3U73 A;  2IPS A;  3V64 C;  3LC3 B;  1L5G B;  1HCG B;  3U7U G;  1G1R A;  2UWO B;  1NFX B;  1DIY A;  1EZQ B;  1IVO C;  1D7W C;  5GLS A;  1EMN A;  3HS7 A;  2W2Q E;  1ATE A;  2P93 L;  3NT1 A;  4C1M C;  1DNW C;  1EBV A;  1W7X L;  3KRK A;  2XC0 L;  2K2S B;  2Y82 B;  2EI6 B;  3KL6 B;  4CUE A;  2Q1J B;  2WG4 B;  4BXS A;  1DX5 I;  1SZB A;  4COX A;  3EGF A;  3F1S B;  4DL1 C;  3P5B L;  3TBD A;  2JKH L;  2G00 L;  3R5O A;  3I6N A;  1APQ A;  1CCF A;  2BZ6 L;  1COU A;  1FF7 A;  4Z0L A;  3ZS1 C;  1JBU L;  1PTH A;  3TH3 L;  1GK5 A;  1ADX A;  3GCL A;  2Y38 A;  1KSN B;  2EI8 B;  2VH6 B;  4Y76 B;  1G1Q A;  1YO8 A;  3ENS A;  1HAF A;  1FSB A;  1UZP A;  1XKB A;  4YT6 L;  3N8Z A;  1G1S A;  2GD4 A;  2DDU A;  3N8Y B;  1DDX A;  1CXP C;  3MQE A;  4MMX B;  1APO A;  2Y80 B;  5JBB E;  3NJP C;  1IQK L;  2J2U B;  3F6U L;  3FFG L;  2WPH E;  5EGM B;  3OLT A;  3HO5 A;  3CA7 A;  1PFX L;  2MGR A;  1J9C L;  2BQW A;  2OYU P;  1MOX C;  1NFY B;  1B9W A;  1XKA L;  2WPK E;  5KN5 C;  3Q3K B;  4OTJ A;  1IGZ A;  3ZYG A;  4KSZ A;  3SXV A;  2Y5G L;  2W3I B;  3HS5 A;  2AYL A;  2KL7 A;  5L2Z L;  1HZ8 A;  4M11 A;  2W86 A;  5E8D A;  3HO4 A;  2P16 L;  2WG3 C;  4HHS A;  4LJJ A;  2H9E L;  2J38 B;  1IQH L;  1CQE A;  1YUG A;  2EI7 B;  2PHB B;  2WYG B;  4MMZ B;  2J95 B;  1LMJ A;  1G2M B;  3CEN L;  1DNU C;  2IKC A;  5IKT A;  3ZYJ B;  2W26 B;  5CKM A;  1O5D L;  3QH0 A;  3ELA L;  3HS6 A;  3KQE L;  1IQJ L;  1ATA A;  2BMG A;  3ASI A;  5FF1 A;  1F7M A;  4ZHA B;  1IOX A;  2Y7Z B;  4Z0K B;  1NFW B;  1X7A L;  2YGP A;  2QQT A;  1JL9 A;  1TLE A;  2KV4 A;  2BOU A;  2RNL A;  1ZAQ A;  1XFE A;  2P26 A;  1LPZ A;  2MHP A;  3V65 B;  1CEJ A;  2CJI B;  4Y71 B;  1RFN B;  5KIR A;  2VWL L;  2E9E A;  1U8C B;  2XBV L;  4CUF A;  4BTI A;  1HRF A;  2NQX A;  1K36 A;  4E1G A;  6COX A;  4YZU B;  3KQB L;  1WU1 B;  2W2O E;  1IQN L;  1WHE A;  1EMO A;  2XBY L;  1JV2 B;  1CX2 A;  2GJM A;  1MQ6 L;  1IGX A;  2WFX B;  1FAX L;  1IQF L;  2XC5 L;  1IQG L;  4Y55 A;  2J94 B;  3R55 A;  1W8B L;  3Q9K A;  2UWL B;  1F0R B;  1Z6C A;  4JYV L;  4Y79 B;  4LOR A;  1WHF A;  2EHA A;  2J4I B;  2R5L A;  5JB9 E;  3S4F A;  1A3P A;  1BF9 A;  2VWM K;  4D0F A;  1HAE A;  3KK6 A;  5IKR A;  5F1A A;  4O1Z A;  4PH9 A;  4HHR A;  2W2M E;  1K37 A;  3FAQ A;  2BOH A;  3KQD L;  3SW2 A;  1N7D A;  2QPK A;  5L30 L;  1TOZ A;  4RUT A;  3OGW A;  5IKV A;  4RRZ A;  1UZK A;  3CFW A;  4KVK A;  2FZZ L;  1KLI L;  3GCW E;  4OTY A;  2D1J B;  2VWN L;  1CVU A;  3QCW A;  3QF1 A;  5HPW A;  1PRH A;  4A7I A;  1HJ7 A;  4FM5 A;  3V6Q A;  2BQ6 A;  2PUM A;  4NG9 L;  4KVJ A;  2BOX A;  1NZI A;  2EFB A;  2OYE P;  2P95 L;  1FE2 A;  3N8F A;  1D5L C;  3RR3 A;  1U67 A;  1LPK A;  2WYJ B;  3SOQ A;  3GCX E;  3LTF B;  4BDW A;  2P3U A;  4BXW A;  1PGE A;  3NIU A;  1IP0 A;  2WFT A;  3ERH A;  4XLW A;  3HO3 A;  1AUT L;  3GCK A;  1FJS L;  3LIW B;  3TK5 B;  1QFK L;  4KVL A;  3DEM A;  4ZH8 B;  1EPG A;  1XDT R;  4NT3 A;  4D90 A;  1CCV A;  2YGO A;  3M36 L;  2W2P E;  4GN6 A;  1HRE A;  1NQL B;  3TGY A;  1F7E A;  3Q7D A;  3R5Q A;  4O02 B;  2FLG A;  3LN0 A;  3C9A C;  4BTT A;  3FNL A;  5JVY A;  5JW1 A;  2K2T A;  3QL6 A;  4CUD A;  3N8W A;  3PGH A;  4PNX A;  3LTG D;  5JBA E;  4ISH L;  2VVC K;  4X8S L;  5FDQ A;  4NJB A;  1UZJ A;  3OLU A;  3IJE B;  3UBA A;  3NTB A;  2VJ3 A;  4X8T L;  2O86 A;  1P9J A;  1EPI A;  1IQM L;  4JYU L;  2TGF A;  1PXX A;  1IQE L;  1ATB A;  2B7D L;  3K9X A;  1ATD A;  3LC5 B;  4X8U L;  2UWP B;  3H5C B;  1EQG A;  2I9A A;  4ZAE B;  3KCG L;  1L3Y A;  1NFU B;  4BTU A;  1DVA L;  1G2L B;  2ADX A;  5GH0 A;  2BO2 A;  3LAQ A;  4X8V L;  1EQH A;  1EAI C;  1CVW L;  1F0S B;  2WPM E;  1Q4G A;  2W2N E;  3IIT B;  2XBX L;  4RS0 A;  3QMO A;  1MHL C;  4RRW A;  2P3T A;  3FBY A;  4JZD L;  5COX A;  4C16 A;  2I9B A;  3TGF A;  1NPE B;  2OJV A;  1M1X B;  2PUQ L;  4Y6D B;  2MGP A;  4D0E A;  2P94 L;  3MDL A;  1KLO A;  1N1I A;  3FCS B;  4M10 A;  1D2V C;  4XBM A;  3NYH A;  4MMY B;  2M74 A;  3R05 A;  2XC4 L;  3R4X A;  1NT0 A;  1DQB A;  3GCJ A;  3M37 L;  1URK A;  5FIW C;  4RRY A;  3PY4 A;  1KLJ L;  5F19 A;  4AQT A;  3BT1 A;  2KB9 A;  3SOB B;  5CIS A;  1MYP C;  3N8W B;  1Z6E L;  2VWO L;  2FD6 A;  3NAK A;  2P3F N;  3N8V A;  4ISI L;  4ZXY L;  4QYQ A;  2Y7X B;  3POY A;  3TK6 B;  3N8X A;  3N8Y A;  1UZQ A;  2WPJ E;  1C5M F;  4BDX A;  2VH0 B;  3CS7 L;  3BPS E;  1YUK B;  1EPH A;  1G1T A;  1TPG A;  4Y7A B;  1P0S L;  1HT5 A;  3LN1 A;  4JZE L;  4LMF A;  5L2Y L;  4GM7 A;  5IKQ A;  2QRB A;  4QJQ A;  4TGF A;  3HPT A;  5CKN A;  4XL1 A;  4N7A A;  1IJQ A;  3ZYI B;  3KRQ A;  2P28 B;  2F9B L;  5K0H B;  2BOK L;  5B72 A;  2WPL E;  1FFM A;  5CKQ A;  3GC1 A;  1HT8 A;  4IG5 A;  2Y5F L;  1IOE L;  4CSY A;  1YGC L;  2Y81 B;  2RHP A;  4Y7B B;  2BQ7 A;  1IQL L;  4Z6A L;  1KIG L;  5JBC E;  3SOV A;  1EGF A;  3RKE A;  5I46 L;  2VVU L;  1MQ5 L;  1I0U A;  2P3F L;  2XBW L;  1IQI L;  4MSF A;  4RRX A;  1OB1 C;  3F9P C;  4ZXX L;  2NPR A;  5JB8 E;  2FLR L;  1LQD A;  4JZF L;  2PT3 A;  4OEK A;  2RA0 L;  5JVZ A;  3GIS X;  1FAK L;  3NTG A;  3KQC L;  1V3X B;  2FLB L;  3BT2 A;  3TZI A;  2VVV L;  2WPI E;  1HX2 A;  1YUF A;  1EPJ A;  3ERI A;  4G1M B;  2Z5Z A; 
#chains in the Genus database with same CATH topology
 3ZS0 C;  2PR3 B;  2W3K B;  1LPG A;  2Y5H L;  4NA9 L;  3BXI A;  4NGA L;  4YT7 L;  2J34 B;  3U73 A;  2IPS A;  3V64 C;  3LC3 B;  1L5G B;  1HCG B;  3U7U G;  1G1R A;  1LK9 A;  2UWO B;  1NFX B;  1DIY A;  1EZQ B;  1IVO C;  1D7W C;  5GLS A;  1EMN A;  3HS7 A;  2W2Q E;  1QIU A;  1ATE A;  2P93 L;  3NT1 A;  4C1M C;  1DNW C;  1EBV A;  1W7X L;  3KRK A;  2XC0 L;  2K2S B;  2Y82 B;  2EI6 B;  3KL6 B;  4CUE A;  2Q1J B;  2WG4 B;  4BXS A;  1DX5 I;  1SZB A;  1V1I A;  4COX A;  3EGF A;  3F1S B;  4DL1 C;  3P5B L;  3TBD A;  2JKH L;  2G00 L;  3R5O A;  3I6N A;  1APQ A;  1CCF A;  2BZ6 L;  1COU A;  1FF7 A;  4Z0L A;  3ZS1 C;  1JBU L;  1PTH A;  3TH3 L;  1GK5 A;  1ADX A;  3GCL A;  2Y38 A;  1KSN B;  2EI8 B;  2VH6 B;  4Y76 B;  1G1Q A;  1YO8 A;  3ENS A;  1HAF A;  1FSB A;  1UZP A;  1XKB A;  4YT6 L;  3N8Z A;  1G1S A;  2GD4 A;  2DDU A;  3N8Y B;  1DDX A;  1CXP C;  3MQE A;  4MMX B;  1APO A;  2Y80 B;  5JBB E;  3NJP C;  1IQK L;  2J2U B;  3F6U L;  1LMM A;  3FFG L;  2JJL A;  2WPH E;  5EGM B;  3OLT A;  3HO5 A;  3CA7 A;  1PFX L;  2MGR A;  1J9C L;  2BQW A;  2OYU P;  1MOX C;  1NFY B;  1B9W A;  1XKA L;  2WPK E;  5KN5 C;  3Q3K B;  4OTJ A;  1IGZ A;  3ZYG A;  4KSZ A;  4GU3 A;  3SXV A;  2Y5G L;  2W3I B;  3HS5 A;  2AYL A;  2KL7 A;  5L2Z L;  1HZ8 A;  4M11 A;  2W86 A;  5E8D A;  3HO4 A;  2P16 L;  2WG3 C;  4HHS A;  4LJJ A;  2H9E L;  2J38 B;  1IQH L;  1CQE A;  1YUG A;  2EI7 B;  2PHB B;  2WYG B;  4MMZ B;  2HOX A;  2J95 B;  1LMJ A;  1G2M B;  3CEN L;  1DNU C;  2IKC A;  5IKT A;  3ZYJ B;  2W26 B;  5CKM A;  1O5D L;  3QH0 A;  3S6X A;  2BT8 A;  3ELA L;  3HS6 A;  3KQE L;  1IQJ L;  1ATA A;  2BMG A;  3ASI A;  5FF1 A;  1F7M A;  4ZHA B;  1IOX A;  2Y7Z B;  4Z0K B;  1NFW B;  1X7A L;  2YGP A;  2QQT A;  1JL9 A;  1TLE A;  2KV4 A;  2BOU A;  2RNL A;  1ZAQ A;  1XFE A;  2P26 A;  1LPZ A;  2MHP A;  3V65 B;  1CEJ A;  2CJI B;  4Y71 B;  1RFN B;  5KIR A;  2VWL L;  2E9E A;  1U8C B;  2XBV L;  4A94 C;  4CUF A;  4BTI A;  1HRF A;  2NQX A;  1K36 A;  4E1G A;  6COX A;  4YZU B;  3KQB L;  1WU1 B;  2W2O E;  1IQN L;  1WHE A;  1EMO A;  2XBY L;  1JV2 B;  2BT7 A;  1CX2 A;  2GJM A;  1MQ6 L;  1IGX A;  2WFX B;  1FAX L;  1IQF L;  2XC5 L;  1IQG L;  4Y55 A;  2J94 B;  3R55 A;  1W8B L;  3Q9K A;  2UWL B;  1F0R B;  1Z6C A;  4JYV L;  4Y79 B;  4LOR A;  1WHF A;  2EHA A;  2J4I B;  2R5L A;  2HOR A;  5JB9 E;  3S4F A;  1A3P A;  1BF9 A;  2VWM K;  4D0F A;  1HAE A;  3KK6 A;  5IKR A;  5F1A A;  4O1Z A;  4PH9 A;  4HHR A;  2W2M E;  1K37 A;  3FAQ A;  2BOH A;  3KQD L;  3SW2 A;  1N7D A;  2QPK A;  5L30 L;  1TOZ A;  4RUT A;  3OGW A;  5IKV A;  4RRZ A;  1UZK A;  3CFW A;  4KVK A;  2FZZ L;  1KLI L;  3GCW E;  4OTY A;  2D1J B;  2VWN L;  1CVU A;  3QCW A;  3QF1 A;  5HPW A;  1PRH A;  4A7I A;  1HJ7 A;  4FM5 A;  3V6Q A;  2BQ6 A;  2PUM A;  4NG9 L;  4KVJ A;  2BOX A;  1NZI A;  2EFB A;  2OYE P;  2P95 L;  1FE2 A;  3N8F A;  1D5L C;  1V1H A;  3RR3 A;  1U67 A;  1LPK A;  2WYJ B;  3SOQ A;  3GCX E;  3LTF B;  4BDW A;  2P3U A;  4BXW A;  1PGE A;  3NIU A;  1IP0 A;  2WFT A;  3ERH A;  4XLW A;  3HO3 A;  1AUT L;  3GCK A;  1FJS L;  3LIW B;  3TK5 B;  1QFK L;  4KVL A;  3DEM A;  2VRS A;  1EPG A;  1XDT R;  4NT3 A;  4ZH8 B;  4D90 A;  1CCV A;  2YGO A;  3M36 L;  2W2P E;  4GN6 A;  1HRE A;  1NQL B;  3TGY A;  1F7E A;  3Q7D A;  3R5Q A;  4O02 B;  2FLG A;  3LN0 A;  3C9A C;  4BTT A;  3FNL A;  5JVY A;  5JW1 A;  2K2T A;  3QL6 A;  4CUD A;  3N8W A;  3PGH A;  4PNX A;  3LTG D;  5JBA E;  4ISH L;  2VVC K;  4X8S L;  5FDQ A;  4NJB A;  1UZJ A;  3OLU A;  3IJE B;  3UBA A;  3NTB A;  2VJ3 A;  4X8T L;  2O86 A;  1P9J A;  1EPI A;  1IQM L;  4JYU L;  2TGF A;  1PXX A;  1IQE L;  1ATB A;  2B7D L;  3K9X A;  1ATD A;  3LC5 B;  4X8U L;  2UWP B;  3H5C B;  1EQG A;  2I9A A;  4ZAE B;  3KCG L;  1L3Y A;  1NFU B;  4BTU A;  1DVA L;  4GU4 A;  1G2L B;  2ADX A;  5GH0 A;  2BO2 A;  3LAQ A;  4X8V L;  1EQH A;  1EAI C;  1CVW L;  1F0S B;  2WPM E;  1Q4G A;  2W2N E;  3IIT B;  2XBX L;  4RS0 A;  3QMO A;  1MHL C;  4RRW A;  2P3T A;  3FBY A;  4JZD L;  5COX A;  4C16 A;  2I9B A;  3TGF A;  1NPE B;  2OJV A;  1M1X B;  2PUQ L;  4Y6D B;  2MGP A;  4D0E A;  2P94 L;  3MDL A;  1KLO A;  1N1I A;  3FCS B;  4M10 A;  1D2V C;  4XBM A;  1KKE A;  3NYH A;  4MMY B;  2M74 A;  3R05 A;  2XC4 L;  3R4X A;  1NT0 A;  1DQB A;  3GCJ A;  3M37 L;  1URK A;  5FIW C;  4RRY A;  3PY4 A;  1KLJ L;  5F19 A;  4AQT A;  3BT1 A;  2KB9 A;  3SOB B;  5CIS A;  1MYP C;  3N8W B;  1Z6E L;  2VWO L;  2FD6 A;  3NAK A;  2P3F N;  3N8V A;  4ISI L;  4ZXY L;  4QYQ A;  2Y7X B;  3POY A;  3TK6 B;  3N8X A;  3N8Y A;  1UZQ A;  2WPJ E;  1C5M F;  4BDX A;  2VH0 B;  3CS7 L;  3BPS E;  2YGQ A;  1YUK B;  1EPH A;  1G1T A;  1TPG A;  4Y7A B;  1P0S L;  1HT5 A;  3LN1 A;  4JZE L;  4LMF A;  5L2Y L;  4GM7 A;  5IKQ A;  2KNI A;  2QRB A;  4QJQ A;  4TGF A;  3HPT A;  5CKN A;  4XL1 A;  2BSF A;  4N7A A;  1IJQ A;  3ZYI B;  3KRQ A;  2P28 B;  2F9B L;  5K0H B;  2BOK L;  5B72 A;  2WPL E;  1FFM A;  5CKQ A;  3GC1 A;  1HT8 A;  4IG5 A;  2Y5F L;  1IOE L;  4CSY A;  1YGC L;  2Y81 B;  2RHP A;  4Y7B B;  2BQ7 A;  1IQL L;  4Z6A L;  1KIG L;  5JBC E;  3SOV A;  1EGF A;  3RKE A;  5I46 L;  2VVU L;  1MQ5 L;  1I0U A;  2P3F L;  2XBW L;  1IQI L;  2H9E C;  4MSF A;  4RRX A;  1OB1 C;  3F9P C;  4ZXX L;  2NPR A;  5JB8 E;  2FLR L;  1LQD A;  4JZF L;  2PT3 A;  4OEK A;  2RA0 L;  5JVZ A;  2WZP P;  3GIS X;  1FAK L;  3NTG A;  3KQC L;  1V3X B;  2FLB L;  3BT2 A;  3TZI A;  2VVV L;  2WPI E;  1HX2 A;  1YUF A;  1EPJ A;  3ERI A;  4G1M B;  2Z5Z A; 
#chains in the Genus database with same CATH homology
 3ZS0 C;  2PR3 B;  2W3K B;  1LPG A;  2Y5H L;  4NA9 L;  3BXI A;  4NGA L;  4YT7 L;  2J34 B;  3U73 A;  2IPS A;  3V64 C;  3LC3 B;  1L5G B;  1HCG B;  3U7U G;  1G1R A;  2UWO B;  1NFX B;  1DIY A;  1EZQ B;  1IVO C;  1D7W C;  5GLS A;  1EMN A;  3HS7 A;  2W2Q E;  1ATE A;  2P93 L;  3NT1 A;  4C1M C;  1DNW C;  1EBV A;  1W7X L;  3KRK A;  2XC0 L;  2K2S B;  2Y82 B;  2EI6 B;  3KL6 B;  4CUE A;  2Q1J B;  2WG4 B;  4BXS A;  1DX5 I;  1SZB A;  4COX A;  3EGF A;  3F1S B;  4DL1 C;  3P5B L;  3TBD A;  2JKH L;  2G00 L;  3R5O A;  3I6N A;  1APQ A;  1CCF A;  2BZ6 L;  1COU A;  1FF7 A;  4Z0L A;  3ZS1 C;  1JBU L;  1PTH A;  3TH3 L;  1GK5 A;  1ADX A;  3GCL A;  2Y38 A;  1KSN B;  2EI8 B;  2VH6 B;  4Y76 B;  1G1Q A;  1YO8 A;  3ENS A;  1HAF A;  1FSB A;  1UZP A;  1XKB A;  4YT6 L;  3N8Z A;  1G1S A;  2GD4 A;  2DDU A;  3N8Y B;  1DDX A;  1CXP C;  3MQE A;  4MMX B;  1APO A;  2Y80 B;  5JBB E;  3NJP C;  1IQK L;  2J2U B;  3F6U L;  1LMM A;  3FFG L;  2WPH E;  5EGM B;  3OLT A;  3HO5 A;  3CA7 A;  1PFX L;  2MGR A;  1J9C L;  2BQW A;  2OYU P;  1MOX C;  1NFY B;  1B9W A;  1XKA L;  2WPK E;  5KN5 C;  3Q3K B;  4OTJ A;  1IGZ A;  3ZYG A;  4KSZ A;  3SXV A;  2Y5G L;  2W3I B;  3HS5 A;  2AYL A;  2KL7 A;  5L2Z L;  1HZ8 A;  4M11 A;  2W86 A;  5E8D A;  3HO4 A;  2P16 L;  2WG3 C;  4HHS A;  4LJJ A;  2H9E L;  2J38 B;  1IQH L;  1CQE A;  1YUG A;  2EI7 B;  2PHB B;  2WYG B;  4MMZ B;  2J95 B;  1LMJ A;  1G2M B;  3CEN L;  1DNU C;  2IKC A;  5IKT A;  3ZYJ B;  2W26 B;  5CKM A;  1O5D L;  3QH0 A;  3S6X A;  3ELA L;  3HS6 A;  3KQE L;  1IQJ L;  1ATA A;  2BMG A;  3ASI A;  5FF1 A;  1F7M A;  4ZHA B;  1IOX A;  2Y7Z B;  4Z0K B;  1NFW B;  1X7A L;  2YGP A;  2QQT A;  1JL9 A;  1TLE A;  2KV4 A;  2BOU A;  2RNL A;  1ZAQ A;  1XFE A;  2P26 A;  1LPZ A;  2MHP A;  3V65 B;  1CEJ A;  2CJI B;  4Y71 B;  1RFN B;  5KIR A;  2VWL L;  2E9E A;  1U8C B;  2XBV L;  4A94 C;  4CUF A;  4BTI A;  1HRF A;  2NQX A;  1K36 A;  4E1G A;  6COX A;  4YZU B;  3KQB L;  1WU1 B;  2W2O E;  1IQN L;  1WHE A;  1EMO A;  2XBY L;  1JV2 B;  1CX2 A;  2GJM A;  1MQ6 L;  1IGX A;  2WFX B;  1FAX L;  1IQF L;  2XC5 L;  1IQG L;  4Y55 A;  2J94 B;  3R55 A;  1W8B L;  3Q9K A;  2UWL B;  1F0R B;  1Z6C A;  4JYV L;  4Y79 B;  4LOR A;  1WHF A;  2EHA A;  2J4I B;  2R5L A;  5JB9 E;  3S4F A;  1A3P A;  1BF9 A;  2VWM K;  4D0F A;  1HAE A;  3KK6 A;  5IKR A;  5F1A A;  4O1Z A;  4PH9 A;  4HHR A;  2W2M E;  1K37 A;  3FAQ A;  2BOH A;  3KQD L;  3SW2 A;  1N7D A;  2QPK A;  5L30 L;  1TOZ A;  4RUT A;  3OGW A;  5IKV A;  4RRZ A;  1UZK A;  3CFW A;  4KVK A;  2FZZ L;  1KLI L;  3GCW E;  4OTY A;  2D1J B;  2VWN L;  1CVU A;  3QCW A;  3QF1 A;  5HPW A;  1PRH A;  4A7I A;  1HJ7 A;  4FM5 A;  3V6Q A;  2BQ6 A;  2PUM A;  4NG9 L;  4KVJ A;  2BOX A;  1NZI A;  2EFB A;  2OYE P;  2P95 L;  1FE2 A;  3N8F A;  1D5L C;  3RR3 A;  1U67 A;  1LPK A;  2WYJ B;  3SOQ A;  3GCX E;  3LTF B;  4BDW A;  2P3U A;  4BXW A;  1PGE A;  3NIU A;  1IP0 A;  2WFT A;  3ERH A;  4XLW A;  3HO3 A;  1AUT L;  3GCK A;  1FJS L;  3LIW B;  3TK5 B;  1QFK L;  4KVL A;  3DEM A;  4ZH8 B;  1EPG A;  1XDT R;  4NT3 A;  4D90 A;  1CCV A;  2YGO A;  3M36 L;  2W2P E;  4GN6 A;  1HRE A;  1NQL B;  3TGY A;  1F7E A;  3Q7D A;  3R5Q A;  4O02 B;  2FLG A;  3LN0 A;  3C9A C;  4BTT A;  3FNL A;  5JVY A;  5JW1 A;  2K2T A;  3QL6 A;  4CUD A;  3N8W A;  3PGH A;  4PNX A;  3LTG D;  5JBA E;  4ISH L;  2VVC K;  4X8S L;  5FDQ A;  4NJB A;  1UZJ A;  3OLU A;  3IJE B;  3UBA A;  3NTB A;  2VJ3 A;  4X8T L;  2O86 A;  1P9J A;  1EPI A;  1IQM L;  4JYU L;  2TGF A;  1PXX A;  1IQE L;  1ATB A;  2B7D L;  3K9X A;  1ATD A;  3LC5 B;  4X8U L;  2UWP B;  3H5C B;  1EQG A;  2I9A A;  4ZAE B;  3KCG L;  1L3Y A;  1NFU B;  4BTU A;  1DVA L;  1G2L B;  2ADX A;  5GH0 A;  2BO2 A;  3LAQ A;  4X8V L;  1EQH A;  1EAI C;  1CVW L;  1F0S B;  2WPM E;  1Q4G A;  2W2N E;  3IIT B;  2XBX L;  4RS0 A;  3QMO A;  1MHL C;  4RRW A;  2P3T A;  3FBY A;  4JZD L;  5COX A;  4C16 A;  2I9B A;  3TGF A;  1NPE B;  2OJV A;  1M1X B;  2PUQ L;  4Y6D B;  2MGP A;  4D0E A;  2P94 L;  3MDL A;  1KLO A;  1N1I A;  3FCS B;  4M10 A;  1D2V C;  4XBM A;  3NYH A;  4MMY B;  2M74 A;  3R05 A;  2XC4 L;  3R4X A;  1NT0 A;  1DQB A;  3GCJ A;  3M37 L;  1URK A;  5FIW C;  4RRY A;  3PY4 A;  1KLJ L;  5F19 A;  4AQT A;  3BT1 A;  2KB9 A;  3SOB B;  5CIS A;  1MYP C;  3N8W B;  1Z6E L;  2VWO L;  2FD6 A;  3NAK A;  2P3F N;  3N8V A;  4ISI L;  4ZXY L;  4QYQ A;  2Y7X B;  3POY A;  3TK6 B;  3N8X A;  3N8Y A;  1UZQ A;  2WPJ E;  1C5M F;  4BDX A;  2VH0 B;  3CS7 L;  3BPS E;  2YGQ A;  1YUK B;  1EPH A;  1G1T A;  1TPG A;  4Y7A B;  1P0S L;  1HT5 A;  3LN1 A;  4JZE L;  4LMF A;  5L2Y L;  4GM7 A;  5IKQ A;  2KNI A;  2QRB A;  4QJQ A;  4TGF A;  3HPT A;  5CKN A;  4XL1 A;  4N7A A;  1IJQ A;  3ZYI B;  3KRQ A;  2P28 B;  2F9B L;  5K0H B;  2BOK L;  5B72 A;  2WPL E;  1FFM A;  5CKQ A;  3GC1 A;  1HT8 A;  4IG5 A;  2Y5F L;  1IOE L;  4CSY A;  1YGC L;  2Y81 B;  2RHP A;  4Y7B B;  2BQ7 A;  1IQL L;  4Z6A L;  1KIG L;  5JBC E;  3SOV A;  1EGF A;  3RKE A;  5I46 L;  2VVU L;  1MQ5 L;  1I0U A;  2P3F L;  2XBW L;  1IQI L;  2H9E C;  4MSF A;  4RRX A;  1OB1 C;  3F9P C;  4ZXX L;  2NPR A;  5JB8 E;  2FLR L;  1LQD A;  4JZF L;  2PT3 A;  4OEK A;  2RA0 L;  5JVZ A;  2WZP P;  3GIS X;  1FAK L;  3NTG A;  3KQC L;  1V3X B;  2FLB L;  3BT2 A;  3TZI A;  2VVV L;  2WPI E;  1HX2 A;  1YUF A;  1EPJ A;  3ERI A;  4G1M B;  2Z5Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...