1EC5A

Crystal structure of four-helix bundle model
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
48
structure length
48
Chain Sequence
DYLRELLKLELQLIKQYREALEYVKLPVLAKILEDEEKHIEWLETILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inaugural article: retrostructural analysis of metalloproteins: application to the design of a minimal model for diiron proteins.
pubmed doi rcsb
molecule tags De novo protein
molecule keywords PROTEIN (FOUR-HELIX BUNDLE MODEL)
total genus 20
structure length 48
sequence length 48
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2000-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1ec5A00
4GOEA 1JMBA 2P58A 1H0TB 1U7MA 2ZAEB 4HB1A 2KZJA 2LXBA 2WMMA 3PH0A 4NPEA 4JBZA 2KZIA 1Y47A 3MZWB 1ZXGA 5EFWB 1Q2NA 1H0TA 3FXEA 4K35A 4GOFA 1EC5A 2KUBA 1FC2C 5DJUB 1NVOA 2QRXA 4WWIA 3S1KA 1MFTA 4K3AA 3RGUA 4ASVA 4ZMDA 2HR3A 4GODA 2QVAA 1X0TA 3MHVA 2SPZA 4ASWA 5C39A 4NPFX 4CPGA 4MN4C 2Q1KA 2M5AA 1LP1B 2R44A 2B87B 5CBNA 1S3JA 1SS1A 2M0BA 1BDCA 4IOIH 4KJMA 2JWDA 3FXDA 1U7JA 1EDIA 5CBOA 3ZDMA 2B87A 4HJGH 1LP1A 2RKLA 4EYYQ 4HKZH 1EDJA 2M5AB 2K3RA 1OVRA 2I8DA 1JM0A 2KIKA 2KS1B 1BDDA 2LXCB 4ZNCA 2B88A 5DJTB 2B89A 4NPDA 2UWJE 1DEEG 1EDKA 5K5GB 1EDLA 1OVVA 1ZW0A 2KI7B 1OVUA 2LR2A 3QWOC 2OTKE 1LT1A 4BXLA
chains in the Genus database with same CATH superfamily
5CJ4A 3NXSA 4GOEA 2KLUA 3PTZA 2IFMA 1L0LD 2NPSD 3H1LD 3VMXA 5BU8B 5CCHA 1M8OB 4C7NA 1VF5D 2C9NY 3L70G 3P8CD 1M57D 1NU1J 1R5LA 3H32B 4XFJA 5KAFH 1H0TB 3D6YA 3BASA 2K9YA 4GT1A 1QVGO 1FS0E 1U7MA 2IYOA 1M1KQ 1HJBA 2Y0CA 3L73D 1AQTA 2D2CD 2WMMA 3PLNA 3CMEP 2KZIA 3RK2C 3MZWB 1X79B 1SQXK 2FXPA 2YIUB 1T8ZA 3C1LA 3HUSA 3P8MC 4PV1B 1Q2NA 2YIUC 2PGDA 1IJDB 1JY2O 3MP7B 3MUDA 1ZLLA 4K35A 4TT3H 1EC5A 3WU2E 1PIXA 3BRVB 5CMZA 1NVOA 1PL5A 2OYHA 2NPSA 2XZRA 3L4FA 3CCQP 2G3AA 2QRXA 3EQ2A 3H1KJ 4AUWA 2Y0EA 4JYCA 2AXTH 1FZCA 2K9JB 4JQ0D 1JO5A 1SQXJ 1KFNA 1BGYJ 5GTIH 1SQBK 1NJIQ 1GZLA 3CCLP 3A0BE 1AQ5A 3TF5A 5E79H 1IFPA 4ASVA 2WSCH 3S9OA 2IYPA 5H2FE 4BXLA 2R32A 1T2KC 3M0AA 4AQRD 1NU1K 1VQ8P 2HODB 3Q5PA 3CX5D 3G71P 2M8RA 1GL2C 1NO4A 2ZT9D 3CCEP 1LTIC 2FY8A 1YIJP 3H1KE 1FOSF 3CWBG 3HE5B 2SPZA 3CCMP 1HJ0A 2OGUA 3M91A 4I7ZB 1PPJG 1JB0J 2AEFA 2WPRA 3H1HE 4CPGA 1VPCA 1FZGA 3D71A 1X8YA 1LT9A 4H13B 2WZ7A 4C7RA 1FOSE 3L72G 3BRTB 2P67A 1SQVE 1L0LK 1BGYD 1L4AC 3CI9A 5CBNA 3OW2O 3AE2C 2OARA 2FYUD 2ZJSE 2JP3A 3CXHI 4HH2A 4PJ0E 1J1DC 1GW3A 3GG2A 1SQBG 3H1ID 4WY4B 5AW1B 2FFDA 2M0BA 2BCCE 1R8EA 4KJMA 4IFFA 1JY2N 1Q86Q 1SQBJ 5AVQB 1FDOA 3H25A 2JWDA 4I2LC 3G4SP 4IL6E 1S9KD 1AJYA 1GU4A 1KD1Q 4PD4D 3SFDC 2XDJA 5AW9B 3AEAC 1SQVK 5CBOA 5AVSB 3H1JE 1RE4C 2E74B 3L72E 3B71A 1Y8AA 2A06D 2RKLA 2BEZF 3OAKA 4JYBA 2WPVB 3E1RA 4HKZH 1SQVG 1Q82Q 4RKUJ 2WWWA 3WUVA 1GL2A 1EZVE 3KHUA 2C9LY 3I5CA 4RO0A 4LGDE 5KLVD 2RH0A 3G6EP 5E79E 3PJSK 1ZOYC 2BASA 1JM0A 2LKMA 2BCCG 2NRGA 4KT0J 4D6TD 1JY3O 2J5UA 5AVTB 1WMKA 3JC22 1NTMK 3L75D 3LIDA 4H0LC 3AEEC 3G9RA 1HUCA 1OFCX 2W83C 4I6MC 5APSA 4DT0A 2ZXXA 5KLVE 2B89A 1PFIA 1YJWP 2UWJE 2KSEA 3RK3B 3B5NB 2P7JA 5K5GB 1S5LE 1FZFA 1L0NE 3SWYA 1N7SC 1OVVA 1BCCD 4TLFA 5TJHA 1ZW0A 2KI7B 3BCCJ 3CCJP 1DEBA 3AE9C 1G2CB 4H13D 2FYUG 2IPPA 4DZOA 1KORA 1ZP0C 5KJ7C 1YITP 3CMAP 1XTCC 4U3FD 1NAFA 2ZT9C 2JKVA 4PV1D 1RF0C 1PGQA 2OQQA 1OZHA 3TYYA 1JEKA 4EYYQ 1RF1C 1K04A 1NKZB 2V7QH 1GW4A 1LWUC 3IR9A 2Q6QA 3KQGA 1GDTA 2H89C 5KLVG 1LTJA 3VMAA 1MZ9A 2ZYDA 3F5HA 2JDIH 3GHGB 4O9BA 2FYNB 3RBXA 1EQ7A 3A0HE 3L75J 5GTHE 1M1JA 3K5BA 2KNCB 3F89A 2A45G 1KQLA 2IX7C 3TGUJ 2ZAEB 3TK1A 1VQNP 2KZJA 2POHA 1VQ4P 1JY3P 1VQKP 2YMYA 5AW8B 1RE3C 3HE4B 2E43A 1QL1A 1TU3F 1KMIZ 1KILB 1N7LA 1L4AB 1NTKK 1SFCD 3M9HA 1SQPD 1ZXGA 5B66E 2K1AA 1AVYA 3A3YB 3VYIA 5CCHC 1NGMB 4H13C 1FJPA 1BE3J 2H88C 1RQUA 2KUBA 2Z4EA 5CCGC 1T6AA 3H1KG 4OVNF 3JSVC 1BE3E 4JF7A 4IL6H 4WB4A 5DJUB 1M56D 2QJKB 1HF9A 2VRSA 1H8AA 2WQYC 3VP9A 4RJTA 3H1HG 3LW5H 3S1KA 5TISE 2WITA 3KZIH 1FZAA 1KILC 1RHZB 5AVZB 3L70D 4LC1A 1VL2A 3AE4C 3AEBC 1G2CA 3ITKA 4I1LA 4UB8E 5CHXA 1RQVA 3N4XA 2O1KA 2QSIA 3HE4A 5KLIC 4WY4D 1MUUA 4RESB 4L74A 1SQBE 4GODA 1NTMD 3CCRP 1SQQJ 3L71D 1CZQA 4EI2A 2YKOA 5KAFE 1J2JB 1IFNA 1SQQE 1BE3G 2RN0A 3MHVA 1KB9E 1EXJA 3L35A 1J1EB 5C39A 3WUTA 1GU5A 4NPFX 2E42A 1KN7A 1KV4A 2QA4P 1NU1E 3H1JJ 2JEEA 2YKPA 3MTUE 2C0XA 2Q1KA 1P84H 3H1JG 2ZVNB 3AEGC 1BGYG 1SQXE 3S4RA 4Y99C 2IBZD 1DH3A 3OA7A 2R44A 2K88A 1BCCG 4W7ZA 1GMJA 5APWA 2B87B 1EZVI 1ZRTD 2E5TA 1EZVG 1KILD 2WPQA 3N7NA 3CCVP 1NTZE 3P32A 3EFFK 4A7PA 3I56P 3H1KD 2PAJA 2FYUK 2W8ZA 4L73A 2JJLA 4U3FG 3E1IA 4IFMA 3RK2D 1RF1B 4DCKA 4LLHA 1GTWA 1SQQG 2KXPB 3FXDA 4KHXA 1KZUB 2IZ1A 3H1HD 5KKZB 5CCGD 2L5GB 2B9BA 1RF1A 3WMM0 1PZQA 1L0NJ 1PGJA 4D6TJ 1EDIA 4YXDC 1NTKD 2Q7CA 1AFOA 1IK9A 2WVRA 4YXWH 1L0NG 1X22A 2B87A 1SQVD 1L4AA 1BGYE 1BSNA 1SFCC 1VDFA 1PPJD 2HODA 3B5NC 3FGAD 2OYIC 2FYUE 3CC2P 3L36A 1BCCE 3HD7C 3VP8A 1N2DC 3VOPA 2BCCD 1KYOE 1AV1A 2KNCA 3IF4A 1VQMP 2I8DA 2P1JA 1DD4A 3OJAB 4U3FE 1URQD 2KS1B 5APVA 2Y9ZA 2ZT9B 3V2RA 3U59A 2KK7A 3Q3DA 1G1IA 3VMYA 2KLVA 2HLOA 2GUSA 1QEXA 5DJTB 5APUA 1JMMA 1GD2E 1LGHB 2R5DA 4R4LA 2OYOA 1KQFB 1J1DB 4WY4C 5CCGA 1EDLA 1KB9H 1PGOA 5CJ0A 1DD3A 2J59M 3GW6A 3UIAA 1S72P 3H1LJ 3P7KA 1L4AD 3HUSB 1D7MA 1L0LE 1CI6A 1KILA 2WPSA 3PHLA 2Y9YA 3RL0g 5TISH 2H43A 1DIPA 1FDIA 1QGKB 2QJYC 4Y99B 1FBMA 3O8ZA 3G3ZA 4GDOA 5BVZA 2OTLP 2OYHB 5KKZC 3RL0C 3VTPC 3V6IA 1RH5B 3L70J 5GTIE 2ZXEB 4H44B 3TSIA 3Q1MA 2HYNA 2RMZA 2P58A 1IZNB 2WSEH 3MUDC 4GKGA 3GHGA 3GMAA 1JNMA 1YQ4C 3BCCD 3HE5A 1VQLP 1GL2D 2ZYAA 3C8VA 1T3UA 2NPSC 2YXQB 2OTJP 2V4HA 3JCUH 4HB1A 3P8CE 2O1JA 3ABVC 1SQPG 3BCCE 3PH0A 5AW4B 4JBZA 1L0LG 1LTBC 1NTZJ 2JWAA 1M1JB 1UIXA 2HG5D 2PFXA 1PV3A 2W6AA 4N78D 5EFWB 1SQPK 4U7JA 5AVXB 2XU6A 1LTJC 5APXA 3A7OA 5KLVK 2IBZI 3M06A 1NWQA 5AW2B 1A02J 1SQBD 1E5WA 1KB9I 1M1JC 1VQ6P 2E75D 2Q3IA 1L0NK 2HFED 3HD7D 5KLVJ 3TGUD 1NYHA 1ZMEC 3HRNA 1AVOA 3B5ND 4Z1MH 3AECC 1NU1G 2NZ2A 1YTZI 2I1JA 2IZ0A 1S4XA 2J58A 2M3BA 1Y9BA 3MD0A 1MFTA 4PJ0H 2XV5A 2Y0DA 5AW3B 5B66H 3TGUE 3RL0B 1SQXG 1SQPE 2N9BA 3HUSC 3RBZA 2JR8A 1EXIA 3CX5E 3RGUA 1LT9C 2E76B 1ZV8A 2YO3A 1SQPJ 2ZYGA 5AVVB 5AVYB 4ZMDA 2PRRA 1PP9J 2IDBA 3B4SA 2QG4A 3B5NA 1NTZG 1SP4A 3L74J 3V2QA 1K8AQ 3AEDC 1NOHA 1M7LA 3M9QA 4BWNA 1ZR2A 2FFDC 3AEFC 2QVAA 5CCHD 1X0TA 2A45H 1FZCC 2YMKA 1IO4A 1QVFO 1VQ7P 3CLQA 3EFGA 1S1CX 1VQPP 2O01H 4YTPC 3T97A 2WT7B 1KC8Q 1JY3N 4PD4H 1YJNP 1SQQK 1NH4A 1NTKE 2ZVOB 3EWKA 1M90Q 1HTLC 1ZN5A 2M3EA 3AE6C 1HH0A 3L71G 4WY4A 3B8EB 2CPBA 5BU5A 3CCSP 5APTA 5AW7B 2O3JA 1U57A 1SFCB 2PP6A 3L71J 3LIEA 4U3FJ 4W7YA 4OWFA 5AVWB 1FZCB 4PD4E 1W5CE 2FYNC 4IOIH 1P84D 1T3JA 3H1IG 3RK2B 1FZEA 1U7JA 3Q2YA 4B86A 2KSJA 1QLED 3WU2H 3FWLA 3CPWO 1JCCA 1QX8A 1NTZK 3Q5SA 1IFIA 3A2AA 3HD7B 3SWFA 3CC7P 1SQXD 3ZDMA 1LJ2A 2QEXP 1EZVD 2OYIB 2FKWB 4HJGH 1FJKA 2DW3A 3AE5C 2WSFJ 1LP1A 2FXMA 2D2CB 1N7SD 1DX7A 1NTZD 1HVVA 4ZKPA 3L72J 3BATA 2M5AB 1S5LX 1HGZA 4I7ZC 1YYCA 1HBWA 2BCCJ 2KOGA 1OVRA 2W90A 3W67A 4EDFA 1N8RQ 2XNXA 3L72D 1VQOP 2A06E 2IBZG 2KIKA 2Z5HA 4H0LD 3U1CA 2WSFH 2V7QJ 3H32A 3A0HH 1H88A 2C0WA 4C7NB 2R5BA 2JO1A 1IC2A 1LTJB 1OWAA 1J1EC 1FE6A 2K9JA 3PP5A 3SFEC 4BRYA 1JUNA 4EIJA 5AW6B 2N1TA 3L75G 4NPDA 3CXHE 1LWUA 4HYTB 2BEQD 1EDKA 3CL3D 3USSA 1K05A 4EOTA 4ZKUA 2Q3EA 1K9MQ 3IAOA 2W6BA 5AVUB 1URQA 1LNQA 2YKQA 3QWOC 3BCCG 5B5EE 1OMIA 2FYUJ 3A0BH 3TDKA 1PP9E 2YO2A 1X9VA 2QJYB 3HTKB 3L37A 5L8RJ 1JY2P 1KQGB 1RE3A 1XTGB 3IN6A 3SWKA 1S5LH 5KLIB 4IL6X 1LT1A 3LW5J 1OW7A 4N78E 1KFMA 2P10A 2YXRB 1FZBA 1PP9D 2FBWC 4PV1C 4XE5B 3V4QA 3A5TA 1JMBA 1VQ5P 3V5BA 5KTBA 5AVRB 3SSUA 4H44C 5KJ7D 1WRGA 4H44D 3VN0A 1HWTC 3NFQA 3L73G 2OYHC 2G8YA 3L74D 2Q9IA 2QJKC 4L76A 2H8PD 3M0DA 2QM7A 1GL2B 2XKMA 4W80A 2WTYA 2D2CC 2E75C 2LXBA 1RF0A 5AW5B 5KAIE 1GK4A 3TGUG 4NPEA 1ZR4A 3W68A 2WSCJ 5APQA 1PP9G 1Y47A 3V2NA 1KYOI 3H1LG 3L74E 1SVFA 3R2PA 3M9BA 2HPCA 2N1TC 1H0TA 1URQB 3FXEA 1YTZT 4JPZB 5KAIH 4GOFA 1N86A 2Z5IA 1FC2C 2QIWA 1S2EA 3BVHA 2R3CA 4Y28J 2WSSH 2WSEJ 3L70E 3H1HJ 1N73C 1T2KD 1Z56A 3CC4P 1GK6A 2N1TB 4R4MA 1SLQA 1CSBA 2KB7P 3L73E 2KYVA 4WWIA 4BRYB 1NTKJ 3V2PA 4OGQB 5APYA 1BE3D 4M3LA 3PRJA 3D6ZA 1JTHA 3NTNA 2FFDB 2AXCA 1NTKG 2FXOA 2E5YA 3II6A 1YJ9P 4K3AA 4N3YB 3L71E 2KP8A 4PD4I 3KZIE 1JOCA 3L74G 3RL0D 1NAYA 1LT9B 4GIFA 1L0LJ 1KB9D 2E76D 2QJPB 2HR3A 3QH9A 3R4YA 3AE8C 3AE3C 3O6QA 1QL2A 3TNUA 3H1IJ 2QJPC 1OW8A 5M1BA 4UB6E 3RK3C 1E79H 5B5EH 1NU1D 1UIIA 3H1IE 1NHLA 1WT6A 2AEMA 4ASWA 3GF7A 4D6TG 3I55P 4L75A 1L2PA 1NTME 3CWBJ 3E7KA 3CXHH 2GM4A 1Q90D 3O6QB 3VMZA 3MIWA 4MN4C 2YNYA 1SQQD 2W27A 2E76C 2XNDH 3Q5RA 2M5AA 3D70A 1N7SB 2L91A 3HTKA 1LP1B 4C46A 1CI6B 1YBKA 2O01N 1JTHB 1RE4A 3H1JD 3KXDA 1SFCA 2MJZA 2E74C 3CWBD 3KYQA 2OYIA 1VF5C 1LTSC 5GTHH 1S3JA 1BCCJ 1URQC 2IFNA 4H0LB 2R3SA 3HD7A 1KQSO 4OH8B 1AA0A 1SS1A 1OX3A 2A06G 2IBZE 1BDCA 2GUVA 3V4WA 2NPSB 3FWNA 1VQ9P 1NTMJ 1ZRTE 3CWBE 1MFZA 1KILE 1PGPA 4UB6H 1NKNA 2ZFCA 1VF5B 3GF3A 3H6PA 4WBAA 2E75B 1PPJE 2N9YB 1NTMG 4D6TE 4IFDK 3L75E 1CW5A 3WUUA 2P2UA 2N1TD 1IFDA 5H2FH 4DJGA 2E74D 4XA4A 2CK3H 1K73Q 3CX5H 3CXHD 2AEJA 1YHQP 2KS1A 4OGQD 1IK7A 1MV8A 2CPSA 2GA1A 3CX5I 1OXZA 1L0ND 2ITAA 2Q5UA 3AE1C 1N7SA 2FYZA 3FX0A 1RY3A 3GLMA 3CCUP 1YI2P 1H89A 2H7HA 2K3RA 2I1KA 3AE7C 3T97B 3M0DC 1P84E 4QMAA 1SQVJ 1KTMA 1BSHA 5KJ7A 2O01J 1S9KE 1LTAC 1JCDA 1BDDA 2K37A 3C9IA 2LXCB 2QM8A 1LTTC 3NMDA 4ZNCA 1USEA 3CD6P 2B88A 1KYOD 2W6JH 4N6JA 3MGNA 4YPCA 3RK3D 1A02F 5AW0B 3L73J 1FU1A 2MKVA 3IFMA 1DEEG 1LTGC 3TNUB 1KYOH 3KPEA 1USDA 2A45I 3GHGC 1Q7YQ 1OVUA 1HGVA 4OGQC 3RK3E 1N73A 1EDJA 2LR2A 1P84I 2HPCB 1Q81Q 1FDMA 1IFMA 1W2BO 1YQ3C 1OW6A 1N73B 4WVZA 1G1JA 4AYCA 3U1AA 3H1LE 1MKMA 1IFJA 3KDPB 1OIPA 1W2EA 2OTKE 2AXTE 2QE7H 1R5SA 4UB8H 4DOJA 3JCUE 1FAVA 1LWUB 2WT7A
chains in the Genus database with same CATH topology
4GOEA 1JMBA 2P58A 1H0TB 1U7MA 2ZAEB 4HB1A 2KZJA 2LXBA 2WMMA 3PH0A 4NPEA 4JBZA 2KZIA 1Y47A 3MZWB 1ZXGA 5EFWB 1Q2NA 1H0TA 3FXEA 4K35A 4GOFA 1EC5A 2KUBA 1FC2C 5DJUB 1NVOA 2QRXA 4WWIA 3S1KA 1MFTA 4K3AA 3RGUA 4ASVA 4ZMDA 2HR3A 4GODA 2QVAA 1X0TA 3MHVA 2SPZA 4ASWA 5C39A 4NPFX 4CPGA 4MN4C 2Q1KA 2M5AA 1LP1B 2R44A 2B87B 5CBNA 1S3JA 1SS1A 2M0BA 1BDCA 4IOIH 4KJMA 2JWDA 3FXDA 1U7JA 1EDIA 5CBOA 3ZDMA 2B87A 4HJGH 1LP1A 2RKLA 4EYYQ 4HKZH 1EDJA 2M5AB 2K3RA 1OVRA 2I8DA 1JM0A 2KIKA 2KS1B 1BDDA 2LXCB 4ZNCA 2B88A 5DJTB 2B89A 4NPDA 2UWJE 1DEEG 1EDKA 5K5GB 1EDLA 1OVVA 1ZW0A 2KI7B 1OVUA 2LR2A 3QWOC 2OTKE 1LT1A 4BXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GOE A;  1JMB A;  2P58 A;  1H0T B;  1U7M A;  2ZAE B;  4HB1 A;  2KZJ A;  2LXB A;  2WMM A;  3PH0 A;  4NPE A;  4JBZ A;  2KZI A;  1Y47 A;  3MZW B;  1ZXG A;  5EFW B;  1Q2N A;  1H0T A;  3FXE A;  4K35 A;  4GOF A;  1EC5 A;  2KUB A;  1FC2 C;  5DJU B;  1NVO A;  2QRX A;  4WWI A;  3S1K A;  1MFT A;  4K3A A;  3RGU A;  4ASV A;  4ZMD A;  2HR3 A;  4GOD A;  2QVA A;  1X0T A;  3MHV A;  2SPZ A;  4ASW A;  5C39 A;  4NPF X;  4CPG A;  4MN4 C;  2Q1K A;  2M5A A;  1LP1 B;  2R44 A;  2B87 B;  5CBN A;  1S3J A;  1SS1 A;  2M0B A;  1BDC A;  4IOI H;  4KJM A;  2JWD A;  3FXD A;  1U7J A;  1EDI A;  5CBO A;  3ZDM A;  2B87 A;  4HJG H;  1LP1 A;  2RKL A;  4EYY Q;  4HKZ H;  1EDJ A;  2M5A B;  2K3R A;  1OVR A;  2I8D A;  1JM0 A;  2KIK A;  2KS1 B;  1BDD A;  2LXC B;  4ZNC A;  2B88 A;  5DJT B;  2B89 A;  4NPD A;  2UWJ E;  1DEE G;  1EDK A;  5K5G B;  1EDL A;  1OVV A;  1ZW0 A;  2KI7 B;  1OVU A;  2LR2 A;  3QWO C;  2OTK E;  1LT1 A;  4BXL A; 
#chains in the Genus database with same CATH topology
 5CJ4 A;  3NXS A;  4GOE A;  2KLU A;  3PTZ A;  2IFM A;  1L0L D;  2NPS D;  3H1L D;  3VMX A;  5BU8 B;  5CCH A;  1M8O B;  4C7N A;  1VF5 D;  2C9N Y;  3L70 G;  3P8C D;  1M57 D;  1NU1 J;  1R5L A;  3H32 B;  4XFJ A;  5KAF H;  1H0T B;  3D6Y A;  3BAS A;  2K9Y A;  4GT1 A;  1QVG O;  1FS0 E;  1U7M A;  2IYO A;  1M1K Q;  1HJB A;  2Y0C A;  3L73 D;  1AQT A;  2D2C D;  2WMM A;  3PLN A;  3CME P;  2KZI A;  3RK2 C;  3MZW B;  1X79 B;  1SQX K;  2FXP A;  2YIU B;  1T8Z A;  3C1L A;  3HUS A;  3P8M C;  4PV1 B;  1Q2N A;  2YIU C;  2PGD A;  1IJD B;  1JY2 O;  3MP7 B;  3MUD A;  1ZLL A;  4K35 A;  4TT3 H;  1EC5 A;  3WU2 E;  1PIX A;  3BRV B;  5CMZ A;  1NVO A;  1PL5 A;  2OYH A;  2NPS A;  2XZR A;  3L4F A;  3CCQ P;  2G3A A;  2QRX A;  3EQ2 A;  3H1K J;  4AUW A;  2Y0E A;  4JYC A;  2AXT H;  1FZC A;  2K9J B;  4JQ0 D;  1JO5 A;  1SQX J;  1KFN A;  1BGY J;  5GTI H;  1SQB K;  1NJI Q;  1GZL A;  3CCL P;  3A0B E;  1AQ5 A;  3TF5 A;  5E79 H;  1IFP A;  4ASV A;  2WSC H;  3S9O A;  2IYP A;  5H2F E;  4BXL A;  2R32 A;  1T2K C;  3M0A A;  4AQR D;  1NU1 K;  1VQ8 P;  2HOD B;  3Q5P A;  3CX5 D;  3G71 P;  2M8R A;  1GL2 C;  1NO4 A;  2ZT9 D;  3CCE P;  1LTI C;  2FY8 A;  1YIJ P;  3H1K E;  1FOS F;  3CWB G;  3HE5 B;  2SPZ A;  3CCM P;  1HJ0 A;  2OGU A;  3M91 A;  4I7Z B;  1PPJ G;  1JB0 J;  2AEF A;  2WPR A;  3H1H E;  4CPG A;  1VPC A;  1FZG A;  3D71 A;  1X8Y A;  1LT9 A;  4H13 B;  2WZ7 A;  4C7R A;  1FOS E;  3L72 G;  3BRT B;  2P67 A;  1SQV E;  1L0L K;  1BGY D;  1L4A C;  3CI9 A;  5CBN A;  3OW2 O;  3AE2 C;  2OAR A;  2FYU D;  2ZJS E;  2JP3 A;  3CXH I;  4HH2 A;  4PJ0 E;  1J1D C;  1GW3 A;  3GG2 A;  1SQB G;  3H1I D;  4WY4 B;  5AW1 B;  2FFD A;  2M0B A;  2BCC E;  1R8E A;  4KJM A;  4IFF A;  1JY2 N;  1Q86 Q;  1SQB J;  5AVQ B;  1FDO A;  3H25 A;  2JWD A;  4I2L C;  3G4S P;  4IL6 E;  1S9K D;  1AJY A;  1GU4 A;  1KD1 Q;  4PD4 D;  3SFD C;  2XDJ A;  5AW9 B;  3AEA C;  1SQV K;  5CBO A;  5AVS B;  3H1J E;  1RE4 C;  2E74 B;  3L72 E;  3B71 A;  1Y8A A;  2A06 D;  2RKL A;  2BEZ F;  3OAK A;  4JYB A;  2WPV B;  3E1R A;  4HKZ H;  1SQV G;  1Q82 Q;  4RKU J;  2WWW A;  3WUV A;  1GL2 A;  1EZV E;  3KHU A;  2C9L Y;  3I5C A;  4RO0 A;  4LGD E;  5KLV D;  2RH0 A;  3G6E P;  5E79 E;  3PJS K;  1ZOY C;  2BAS A;  1JM0 A;  2LKM A;  2BCC G;  2NRG A;  4KT0 J;  4D6T D;  1JY3 O;  2J5U A;  5AVT B;  1WMK A;  3JC2 2;  1NTM K;  3L75 D;  3LID A;  4H0L C;  3AEE C;  3G9R A;  1HUC A;  1OFC X;  2W83 C;  4I6M C;  5APS A;  4DT0 A;  2ZXX A;  5KLV E;  2B89 A;  1PFI A;  1YJW P;  2UWJ E;  2KSE A;  3RK3 B;  3B5N B;  2P7J A;  5K5G B;  1S5L E;  1FZF A;  1L0N E;  3SWY A;  1N7S C;  1OVV A;  1BCC D;  4TLF A;  5TJH A;  1ZW0 A;  2KI7 B;  3BCC J;  3CCJ P;  1DEB A;  3AE9 C;  1G2C B;  4H13 D;  2FYU G;  2IPP A;  4DZO A;  1KOR A;  1ZP0 C;  5KJ7 C;  1YIT P;  3CMA P;  1XTC C;  4U3F D;  1NAF A;  2ZT9 C;  2JKV A;  4PV1 D;  1RF0 C;  1PGQ A;  2OQQ A;  1OZH A;  3TYY A;  1JEK A;  4EYY Q;  1RF1 C;  1K04 A;  1NKZ B;  2V7Q H;  1GW4 A;  1LWU C;  3IR9 A;  2Q6Q A;  3KQG A;  1GDT A;  2H89 C;  5KLV G;  1LTJ A;  3VMA A;  1MZ9 A;  2ZYD A;  3F5H A;  2JDI H;  3GHG B;  4O9B A;  2FYN B;  3RBX A;  1EQ7 A;  3A0H E;  3L75 J;  5GTH E;  1M1J A;  3K5B A;  2KNC B;  3F89 A;  2A45 G;  1KQL A;  2IX7 C;  3TGU J;  2ZAE B;  3TK1 A;  1VQN P;  2KZJ A;  2POH A;  1VQ4 P;  1JY3 P;  1VQK P;  2YMY A;  5AW8 B;  1RE3 C;  3HE4 B;  2E43 A;  1QL1 A;  1TU3 F;  1KMI Z;  1KIL B;  1N7L A;  1L4A B;  1NTK K;  1SFC D;  3M9H A;  1SQP D;  1ZXG A;  5B66 E;  2K1A A;  1AVY A;  3A3Y B;  3VYI A;  5CCH C;  1NGM B;  4H13 C;  1FJP A;  1BE3 J;  2H88 C;  1RQU A;  2KUB A;  2Z4E A;  5CCG C;  1T6A A;  3H1K G;  4OVN F;  3JSV C;  1BE3 E;  4JF7 A;  4IL6 H;  4WB4 A;  5DJU B;  1M56 D;  2QJK B;  1HF9 A;  2VRS A;  1H8A A;  2WQY C;  3VP9 A;  4RJT A;  3H1H G;  3LW5 H;  3S1K A;  5TIS E;  2WIT A;  3KZI H;  1FZA A;  1KIL C;  1RHZ B;  5AVZ B;  3L70 D;  4LC1 A;  1VL2 A;  3AE4 C;  3AEB C;  1G2C A;  3ITK A;  4I1L A;  4UB8 E;  5CHX A;  1RQV A;  3N4X A;  2O1K A;  2QSI A;  3HE4 A;  5KLI C;  4WY4 D;  1MUU A;  4RES B;  4L74 A;  1SQB E;  4GOD A;  1NTM D;  3CCR P;  1SQQ J;  3L71 D;  1CZQ A;  4EI2 A;  2YKO A;  5KAF E;  1J2J B;  1IFN A;  1SQQ E;  1BE3 G;  2RN0 A;  3MHV A;  1KB9 E;  1EXJ A;  3L35 A;  1J1E B;  5C39 A;  3WUT A;  1GU5 A;  4NPF X;  2E42 A;  1KN7 A;  1KV4 A;  2QA4 P;  1NU1 E;  3H1J J;  2JEE A;  2YKP A;  3MTU E;  2C0X A;  2Q1K A;  1P84 H;  3H1J G;  2ZVN B;  3AEG C;  1BGY G;  1SQX E;  3S4R A;  4Y99 C;  2IBZ D;  1DH3 A;  3OA7 A;  2R44 A;  2K88 A;  1BCC G;  4W7Z A;  1GMJ A;  5APW A;  2B87 B;  1EZV I;  1ZRT D;  2E5T A;  1EZV G;  1KIL D;  2WPQ A;  3N7N A;  3CCV P;  1NTZ E;  3P32 A;  3EFF K;  4A7P A;  3I56 P;  3H1K D;  2PAJ A;  2FYU K;  2W8Z A;  4L73 A;  2JJL A;  4U3F G;  3E1I A;  4IFM A;  3RK2 D;  1RF1 B;  4DCK A;  4LLH A;  1GTW A;  1SQQ G;  2KXP B;  3FXD A;  4KHX A;  1KZU B;  2IZ1 A;  3H1H D;  5KKZ B;  5CCG D;  2L5G B;  2B9B A;  1RF1 A;  3WMM 0;  1PZQ A;  1L0N J;  1PGJ A;  4D6T J;  1EDI A;  4YXD C;  1NTK D;  2Q7C A;  1AFO A;  1IK9 A;  2WVR A;  4YXW H;  1L0N G;  1X22 A;  2B87 A;  1SQV D;  1L4A A;  1BGY E;  1BSN A;  1SFC C;  1VDF A;  1PPJ D;  2HOD A;  3B5N C;  3FGA D;  2OYI C;  2FYU E;  3CC2 P;  3L36 A;  1BCC E;  3HD7 C;  3VP8 A;  1N2D C;  3VOP A;  2BCC D;  1KYO E;  1AV1 A;  2KNC A;  3IF4 A;  1VQM P;  2I8D A;  2P1J A;  1DD4 A;  3OJA B;  4U3F E;  1URQ D;  2KS1 B;  5APV A;  2Y9Z A;  2ZT9 B;  3V2R A;  3U59 A;  2KK7 A;  3Q3D A;  1G1I A;  3VMY A;  2KLV A;  2HLO A;  2GUS A;  1QEX A;  5DJT B;  5APU A;  1JMM A;  1GD2 E;  1LGH B;  2R5D A;  4R4L A;  2OYO A;  1KQF B;  1J1D B;  4WY4 C;  5CCG A;  1EDL A;  1KB9 H;  1PGO A;  5CJ0 A;  1DD3 A;  2J59 M;  3GW6 A;  3UIA A;  1S72 P;  3H1L J;  3P7K A;  1L4A D;  3HUS B;  1D7M A;  1L0L E;  1CI6 A;  1KIL A;  2WPS A;  3PHL A;  2Y9Y A;  3RL0 g;  5TIS H;  2H43 A;  1DIP A;  1FDI A;  1QGK B;  2QJY C;  4Y99 B;  1FBM A;  3O8Z A;  3G3Z A;  4GDO A;  5BVZ A;  2OTL P;  2OYH B;  5KKZ C;  3RL0 C;  3VTP C;  3V6I A;  1RH5 B;  3L70 J;  5GTI E;  2ZXE B;  4H44 B;  3TSI A;  3Q1M A;  2HYN A;  2RMZ A;  2P58 A;  1IZN B;  2WSE H;  3MUD C;  4GKG A;  3GHG A;  3GMA A;  1JNM A;  1YQ4 C;  3BCC D;  3HE5 A;  1VQL P;  1GL2 D;  2ZYA A;  3C8V A;  1T3U A;  2NPS C;  2YXQ B;  2OTJ P;  2V4H A;  3JCU H;  4HB1 A;  3P8C E;  2O1J A;  3ABV C;  1SQP G;  3BCC E;  3PH0 A;  5AW4 B;  4JBZ A;  1L0L G;  1LTB C;  1NTZ J;  2JWA A;  1M1J B;  1UIX A;  2HG5 D;  2PFX A;  1PV3 A;  2W6A A;  4N78 D;  5EFW B;  1SQP K;  4U7J A;  5AVX B;  2XU6 A;  1LTJ C;  5APX A;  3A7O A;  5KLV K;  2IBZ I;  3M06 A;  1NWQ A;  5AW2 B;  1A02 J;  1SQB D;  1E5W A;  1KB9 I;  1M1J C;  1VQ6 P;  2E75 D;  2Q3I A;  1L0N K;  2HFE D;  3HD7 D;  5KLV J;  3TGU D;  1NYH A;  1ZME C;  3HRN A;  1AVO A;  3B5N D;  4Z1M H;  3AEC C;  1NU1 G;  2NZ2 A;  1YTZ I;  2I1J A;  2IZ0 A;  1S4X A;  2J58 A;  2M3B A;  1Y9B A;  3MD0 A;  1MFT A;  4PJ0 H;  2XV5 A;  2Y0D A;  5AW3 B;  5B66 H;  3TGU E;  3RL0 B;  1SQX G;  1SQP E;  2N9B A;  3HUS C;  3RBZ A;  2JR8 A;  1EXI A;  3CX5 E;  3RGU A;  1LT9 C;  2E76 B;  1ZV8 A;  2YO3 A;  1SQP J;  2ZYG A;  5AVV B;  5AVY B;  4ZMD A;  2PRR A;  1PP9 J;  2IDB A;  3B4S A;  2QG4 A;  3B5N A;  1NTZ G;  1SP4 A;  3L74 J;  3V2Q A;  1K8A Q;  3AED C;  1NOH A;  1M7L A;  3M9Q A;  4BWN A;  1ZR2 A;  2FFD C;  3AEF C;  2QVA A;  5CCH D;  1X0T A;  2A45 H;  1FZC C;  2YMK A;  1IO4 A;  1QVF O;  1VQ7 P;  3CLQ A;  3EFG A;  1S1C X;  1VQP P;  2O01 H;  4YTP C;  3T97 A;  2WT7 B;  1KC8 Q;  1JY3 N;  4PD4 H;  1YJN P;  1SQQ K;  1NH4 A;  1NTK E;  2ZVO B;  3EWK A;  1M90 Q;  1HTL C;  1ZN5 A;  2M3E A;  3AE6 C;  1HH0 A;  3L71 G;  4WY4 A;  3B8E B;  2CPB A;  5BU5 A;  3CCS P;  5APT A;  5AW7 B;  2O3J A;  1U57 A;  1SFC B;  2PP6 A;  3L71 J;  3LIE A;  4U3F J;  4W7Y A;  4OWF A;  5AVW B;  1FZC B;  4PD4 E;  1W5C E;  2FYN C;  4IOI H;  1P84 D;  1T3J A;  3H1I G;  3RK2 B;  1FZE A;  1U7J A;  3Q2Y A;  4B86 A;  2KSJ A;  1QLE D;  3WU2 H;  3FWL A;  3CPW O;  1JCC A;  1QX8 A;  1NTZ K;  3Q5S A;  1IFI A;  3A2A A;  3HD7 B;  3SWF A;  3CC7 P;  1SQX D;  3ZDM A;  1LJ2 A;  2QEX P;  1EZV D;  2OYI B;  2FKW B;  4HJG H;  1FJK A;  2DW3 A;  3AE5 C;  2WSF J;  1LP1 A;  2FXM A;  2D2C B;  1N7S D;  1DX7 A;  1NTZ D;  1HVV A;  4ZKP A;  3L72 J;  3BAT A;  2M5A B;  1S5L X;  1HGZ A;  4I7Z C;  1YYC A;  1HBW A;  2BCC J;  2KOG A;  1OVR A;  2W90 A;  3W67 A;  4EDF A;  1N8R Q;  2XNX A;  3L72 D;  1VQO P;  2A06 E;  2IBZ G;  2KIK A;  2Z5H A;  4H0L D;  3U1C A;  2WSF H;  2V7Q J;  3H32 A;  3A0H H;  1H88 A;  2C0W A;  4C7N B;  2R5B A;  2JO1 A;  1IC2 A;  1LTJ B;  1OWA A;  1J1E C;  1FE6 A;  2K9J A;  3PP5 A;  3SFE C;  4BRY A;  1JUN A;  4EIJ A;  5AW6 B;  2N1T A;  3L75 G;  4NPD A;  3CXH E;  1LWU A;  4HYT B;  2BEQ D;  1EDK A;  3CL3 D;  3USS A;  1K05 A;  4EOT A;  4ZKU A;  2Q3E A;  1K9M Q;  3IAO A;  2W6B A;  5AVU B;  1URQ A;  1LNQ A;  2YKQ A;  3QWO C;  3BCC G;  5B5E E;  1OMI A;  2FYU J;  3A0B H;  3TDK A;  1PP9 E;  2YO2 A;  1X9V A;  2QJY B;  3HTK B;  3L37 A;  5L8R J;  1JY2 P;  1KQG B;  1RE3 A;  1XTG B;  3IN6 A;  3SWK A;  1S5L H;  5KLI B;  4IL6 X;  1LT1 A;  3LW5 J;  1OW7 A;  4N78 E;  1KFM A;  2P10 A;  2YXR B;  1FZB A;  1PP9 D;  2FBW C;  4PV1 C;  4XE5 B;  3V4Q A;  3A5T A;  1JMB A;  1VQ5 P;  3V5B A;  5KTB A;  5AVR B;  3SSU A;  4H44 C;  5KJ7 D;  1WRG A;  4H44 D;  3VN0 A;  1HWT C;  3NFQ A;  3L73 G;  2OYH C;  2G8Y A;  3L74 D;  2Q9I A;  2QJK C;  4L76 A;  2H8P D;  3M0D A;  2QM7 A;  1GL2 B;  2XKM A;  4W80 A;  2WTY A;  2D2C C;  2E75 C;  2LXB A;  1RF0 A;  5AW5 B;  5KAI E;  1GK4 A;  3TGU G;  4NPE A;  1ZR4 A;  3W68 A;  2WSC J;  5APQ A;  1PP9 G;  1Y47 A;  3V2N A;  1KYO I;  3H1L G;  3L74 E;  1SVF A;  3R2P A;  3M9B A;  2HPC A;  2N1T C;  1H0T A;  1URQ B;  3FXE A;  1YTZ T;  4JPZ B;  5KAI H;  4GOF A;  1N86 A;  2Z5I A;  1FC2 C;  2QIW A;  1S2E A;  3BVH A;  2R3C A;  4Y28 J;  2WSS H;  2WSE J;  3L70 E;  3H1H J;  1N73 C;  1T2K D;  1Z56 A;  3CC4 P;  1GK6 A;  2N1T B;  4R4M A;  1SLQ A;  1CSB A;  2KB7 P;  3L73 E;  2KYV A;  4WWI A;  4BRY B;  1NTK J;  3V2P A;  4OGQ B;  5APY A;  1BE3 D;  4M3L A;  3PRJ A;  3D6Z A;  1JTH A;  3NTN A;  2FFD B;  2AXC A;  1NTK G;  2FXO A;  2E5Y A;  3II6 A;  1YJ9 P;  4K3A A;  4N3Y B;  3L71 E;  2KP8 A;  4PD4 I;  3KZI E;  1JOC A;  3L74 G;  3RL0 D;  1NAY A;  1LT9 B;  4GIF A;  1L0L J;  1KB9 D;  2E76 D;  2QJP B;  2HR3 A;  3QH9 A;  3R4Y A;  3AE8 C;  3AE3 C;  3O6Q A;  1QL2 A;  3TNU A;  3H1I J;  2QJP C;  1OW8 A;  5M1B A;  4UB6 E;  3RK3 C;  1E79 H;  5B5E H;  1NU1 D;  1UII A;  3H1I E;  1NHL A;  1WT6 A;  2AEM A;  4ASW A;  3GF7 A;  4D6T G;  3I55 P;  4L75 A;  1L2P A;  1NTM E;  3CWB J;  3E7K A;  3CXH H;  2GM4 A;  1Q90 D;  3O6Q B;  3VMZ A;  3MIW A;  4MN4 C;  2YNY A;  1SQQ D;  2W27 A;  2E76 C;  2XND H;  3Q5R A;  2M5A A;  3D70 A;  1N7S B;  2L91 A;  3HTK A;  1LP1 B;  4C46 A;  1CI6 B;  1YBK A;  2O01 N;  1JTH B;  1RE4 A;  3H1J D;  3KXD A;  1SFC A;  2MJZ A;  2E74 C;  3CWB D;  3KYQ A;  2OYI A;  1VF5 C;  1LTS C;  5GTH H;  1S3J A;  1BCC J;  1URQ C;  2IFN A;  4H0L B;  2R3S A;  3HD7 A;  1KQS O;  4OH8 B;  1AA0 A;  1SS1 A;  1OX3 A;  2A06 G;  2IBZ E;  1BDC A;  2GUV A;  3V4W A;  2NPS B;  3FWN A;  1VQ9 P;  1NTM J;  1ZRT E;  3CWB E;  1MFZ A;  1KIL E;  1PGP A;  4UB6 H;  1NKN A;  2ZFC A;  1VF5 B;  3GF3 A;  3H6P A;  4WBA A;  2E75 B;  1PPJ E;  2N9Y B;  1NTM G;  4D6T E;  4IFD K;  3L75 E;  1CW5 A;  3WUU A;  2P2U A;  2N1T D;  1IFD A;  5H2F H;  4DJG A;  2E74 D;  4XA4 A;  2CK3 H;  1K73 Q;  3CX5 H;  3CXH D;  2AEJ A;  1YHQ P;  2KS1 A;  4OGQ D;  1IK7 A;  1MV8 A;  2CPS A;  2GA1 A;  3CX5 I;  1OXZ A;  1L0N D;  2ITA A;  2Q5U A;  3AE1 C;  1N7S A;  2FYZ A;  3FX0 A;  1RY3 A;  3GLM A;  3CCU P;  1YI2 P;  1H89 A;  2H7H A;  2K3R A;  2I1K A;  3AE7 C;  3T97 B;  3M0D C;  1P84 E;  4QMA A;  1SQV J;  1KTM A;  1BSH A;  5KJ7 A;  2O01 J;  1S9K E;  1LTA C;  1JCD A;  1BDD A;  2K37 A;  3C9I A;  2LXC B;  2QM8 A;  1LTT C;  3NMD A;  4ZNC A;  1USE A;  3CD6 P;  2B88 A;  1KYO D;  2W6J H;  4N6J A;  3MGN A;  4YPC A;  3RK3 D;  1A02 F;  5AW0 B;  3L73 J;  1FU1 A;  2MKV A;  3IFM A;  1DEE G;  1LTG C;  3TNU B;  1KYO H;  3KPE A;  1USD A;  2A45 I;  3GHG C;  1Q7Y Q;  1OVU A;  1HGV A;  4OGQ C;  3RK3 E;  1N73 A;  1EDJ A;  2LR2 A;  1P84 I;  2HPC B;  1Q81 Q;  1FDM A;  1IFM A;  1W2B O;  1YQ3 C;  1OW6 A;  1N73 B;  4WVZ A;  1G1J A;  4AYC A;  3U1A A;  3H1L E;  1MKM A;  1IFJ A;  3KDP B;  1OIP A;  1W2E A;  2OTK E;  2AXT E;  2QE7 H;  1R5S A;  4UB8 H;  4DOJ A;  3JCU E;  1FAV A;  1LWU B;  2WT7 A; 
#chains in the Genus database with same CATH homology
 4GOE A;  1JMB A;  2P58 A;  1H0T B;  1U7M A;  2ZAE B;  4HB1 A;  2KZJ A;  2LXB A;  2WMM A;  3PH0 A;  4NPE A;  4JBZ A;  2KZI A;  1Y47 A;  3MZW B;  1ZXG A;  5EFW B;  1Q2N A;  1H0T A;  3FXE A;  4K35 A;  4GOF A;  1EC5 A;  2KUB A;  1FC2 C;  5DJU B;  1NVO A;  2QRX A;  4WWI A;  3S1K A;  1MFT A;  4K3A A;  3RGU A;  4ASV A;  4ZMD A;  2HR3 A;  4GOD A;  2QVA A;  1X0T A;  3MHV A;  2SPZ A;  4ASW A;  5C39 A;  4NPF X;  4CPG A;  4MN4 C;  2Q1K A;  2M5A A;  1LP1 B;  2R44 A;  2B87 B;  5CBN A;  1S3J A;  1SS1 A;  2M0B A;  1BDC A;  4IOI H;  4KJM A;  2JWD A;  3FXD A;  1U7J A;  1EDI A;  5CBO A;  3ZDM A;  2B87 A;  4HJG H;  1LP1 A;  2RKL A;  4EYY Q;  4HKZ H;  1EDJ A;  2M5A B;  2K3R A;  1OVR A;  2I8D A;  1JM0 A;  2KIK A;  2KS1 B;  1BDD A;  2LXC B;  4ZNC A;  2B88 A;  5DJT B;  2B89 A;  4NPD A;  2UWJ E;  1DEE G;  1EDK A;  5K5G B;  1EDL A;  1OVV A;  1ZW0 A;  2KI7 B;  1OVU A;  2LR2 A;  3QWO C;  2OTK E;  1LT1 A;  4BXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...