1EC5A

Crystal structure of four-helix bundle model
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
48
structure length
48
Chain Sequence
DYLRELLKLELQLIKQYREALEYVKLPVLAKILEDEEKHIEWLETILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inaugural article: retrostructural analysis of metalloproteins: application to the design of a minimal model for diiron proteins.
pubmed doi rcsb
molecule tags De novo protein
molecule keywords PROTEIN (FOUR-HELIX BUNDLE MODEL)
total genus 20
structure length 48
sequence length 48
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2000-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1ec5A00
4CPGA 4NPDA 1OVUA 3ZDMA 2HR3A 2QRXA 1FC2C 4BXLA 4EYYQ 1BDCA 1ZW0A 1ZXGA 5EFWB 4WWIA 5K5GB 1S3JA 2ZAEB 5C39A 2SPZA 2JWDA 1LP1B 4IOIH 1U7JA 2B89A 2R44A 4GOFA 2KZIA 2P58A 2M5AA 1Y47A 2K3RA 4MN4C 4K3AA 1Q2NA 3MHVA 4JBZA 1JM0A 2M0BA 2B88A 1OVRA 1LT1A 2LXCB 2KS1B 2I8DA 1JMBA 1EDLA 2M5AB 3MZWB 1BDDA 5CBNA 4NPEA 1H0TB 3S1KA 1EC5A 4ZNCA 1SS1A 5DJTB 4HKZH 2OTKE 2KIKA 2QVAA 1NVOA 2RKLA 1U7MA 4ASWA 4K35A 4NPFX 1EDJA 1H0TA 2B87A 1X0TA 1EDKA 3PH0A 1MFTA 2KZJA 3FXDA 3RGUA 3QWOC 4HB1A 2KUBA 1OVVA 2Q1KA 2WMMA 4ASVA 1EDIA 5CBOA 2LR2A 1LP1A 2LXBA 2KI7B 1DEEG 2UWJE 4HJGH 4GOEA 4KJMA 4GODA 5DJUB 3FXEA 2B87B 4ZMDA
chains in the Genus database with same CATH superfamily
1VQNP 2ZVOB 1AVYA 1HGZA 2WSCH 3AE8C 3HTKA 3ZDMA 1BGYE 1BGYG 2AEJA 3P8MC 3L37A 3T97B 2FYZA 3RK3E 1L0NE 4EYYQ 1NU1D 2Q3EA 5KLIC 5AVTB 4C7NB 1JB0J 2FYUK 1QLED 2QIWA 3FGAD 3CWBG 3FWLA 1OFCX 1SQXJ 3A0BH 3TF5A 3CCMP 1NU1E 2AXTH 1S2EA 3EQ2A 3HUSB 1VPCA 2FY8A 2W27A 2Y0EA 3NMDA 2W83C 3U1AA 1LTSC 2H7HA 1L0LG 2SPZA 4Y99C 1NTME 5M1BA 4EDFA 4UB8E 3CCVP 3H1JJ 2ZJSE 1X22A 3B71A 3MIWA 5AW6B 4D6TE 3LIDA 2QJYC 1S5LE 3B8EB 3E1IA 1H89A 3WU2E 2QJKB 1RH5B 1VF5B 3JCUE 3O6QB 3RK2D 1ZOYC 5AW0B 4DOJA 4UB6H 3TGUD 1FDIA 2KSJA 3CX5E 1KV4A 1Z56A 4UB8H 3H1ID 4QMAA 3TNUA 1LNQA 2C0XA 3F89A 2K3RA 2CPSA 2M3EA 1YJNP 1L4AC 1Q7YQ 4MN4C 1FE6A 1NTZE 2IBZD 4H44D 3G4SP 2OYIC 1FZCC 1NU1J 5GTHH 3GF3A 1FOSF 2XNDH 1OX3A 1ZRTE 3MUDC 4WY4C 3CCSP 3FWNA 1VQOP 1VF5D 1IFNA 1L0LD 2AEMA 1ZR2A 4I7ZC 3AE2C 3H6PA 3HE5B 1G1JA 4D6TJ 2BCCE 1VQ6P 3MTUE 3H1KG 3U59A 2W6JH 4W7YA 2O1JA 1MUUA 3CWBD 1YTZI 2KS1B 1SQXK 4OVNF 1BE3D 1LWUB 2IFMA 2Y0DA 3M9HA 3Q1MA 1URQC 3H1JG 1L4AB 3IF4A 1IK7A 1OMIA 5B5EH 1EDLA 4L76A 5CCGC 1JNMA 1USEA 3MZWB 1RY3A 1T3UA 2AXCA 2H88C 1NTMD 2MJZA 2YO2A 3M9BA 4I7ZB 4L74A 4NPEA 2RN0A 3AE1C 1NWQA 1UIIA 3CCUP 3BVHA 3KZIH 2FFDA 3L73D 3L74E 5BU5A 3HE4B 3P32A 2NPSB 2G3AA 2ZYAA 2IDBA 3PH0A 4WBAA 1Q82Q 5DJTB 4HKZH 2WWWA 3L71D 1S4XA 2KNCA 2O01J 3A0HE 3CLQA 2BCCJ 2FYNB 2WSEJ 3A0HH 4U3FD 1M56D 2OTKE 1R5LA 4PD4H 1H88A 2KIKA 4Z1MH 1T2KD 2FKWB 2HYNA 2KYVA 2D2CD 2KB7P 2JJLA 3A2AA 4IFMA 1JY2O 2MKVA 1URQD 1U7MA 1LTIC 2RKLA 1OW6A 3R2PA 4U3FE 2Q6QA 2XKMA 3PJSK 1NGMB 3D6ZA 2I1JA 2Q9IA 4M3LA 2OYHA 1SQVD 2KK7A 1OXZA 1EXJA 2IYPA 3LIEA 3MGNA 1LTGC 2BCCD 3L70J 1KQLA 3TSIA 3CCLP 4N6JA 1BGYJ 2O01N 3B5NA 1AQ5A 2CPBA 1L0ND 5KAFH 3L74G 5B66H 1G2CB 1HUCA 1QL1A 3HTKB 3Q5RA 2K9YA 1FZCA 2E5YA 2E76B 2P10A 3G9RA 3RL0D 2N1TA 3CCQP 1MFTA 5CCHA 5AVUB 1QVGO 1NKNA 3USSA 2KZJA 1L4AD 3M91A 3A7OA 3FXDA 2VRSA 1SQPK 4TLFA 1SQQJ 3GG2A 1BCCE 2O1KA 2W6BA 3II6A 1HH0A 1T2KC 3BCCJ 3L72G 3RK3D 2POHA 2KUBA 1AQTA 3BATA 2WSFJ 2ZXEB 1QL2A 2XNXA 2Q7CA 1EQ7A 1A02F 2P7JA 3C8VA 1KYOD 2BCCG 2LXBA 1LP1A 3E7KA 2WT7A 1LTTC 2DW3A 3EWKA 4BRYA 1E5WA 2OARA 2QJYB 2UWJE 3O6QA 1ZLLA 2KLUA 3C9IA 1AJYA 4H44C 3E1RA 5DJUB 1GL2D 1NTZD 2ZYGA 3FXEA 1W2EA 3NXSA 3RK3B 3TNUB 3WUTA 1KD1Q 5BU8B 1OVUA 3CXHI 3CMEP 4AUWA 1T6AA 1ZRTD 2HR3A 1HF9A 3M0AA 4KHXA 1N73C 1Y9BA 3CI9A 4H13B 1RF1B 4PV1D 3A0BE 3CC4P 2XV5A 3BCCD 4I1LA 3V2NA 3OW2O 3M06A 3D6YA 1JCDA 2KOGA 1SQVE 3B5ND 4D6TG 1SQBK 3JCUH 1E79H 3AE5C 3AE4C 3H32A 4YTPC 1JO5A 2N1TD 1LWUA 2JWDA 1RE3C 3H1LJ 1VQPP 3PP5A 1SQVK 1QGKB 2PGDA 4GOFA 2WQYC 4W7ZA 3IR9A 1IK9A 1BSNA 2J58A 1M90Q 2C9LY 3CWBE 1IZNB 2M5AA 3UIAA 5AW2B 1Y47A 1RF0C 1EXIA 4GIFA 3EFFK 1CW5A 1JTHA 3V6IA 5APYA 4IFDK 1L0NG 2WITA 3Q2YA 1NTZK 2OYHC 3W68A 3D71A 1LTJB 3L72D 1LT9C 2W90A 1VQLP 1CI6A 1KYOI 3HE4A 3L75J 3CC7P 3D70A 1NYHA 4PJ0E 1J1EC 5E79H 2M0BA 5APUA 5APXA 4C46A 2H89C 1YIJP 3VN0A 3VMAA 4DCKA 1RHZB 3H1LE 2QJPB 3H1HJ 4LLHA 4OWFA 2B88A 3CCRP 1LT1A 3CCEP 1FS0E 5KLIB 3KHUA 1KFNA 3NFQA 4A7PA 1NOHA 3L71G 1SQQD 3VMZA 2IBZG 2OYHB 1S72P 1JMBA 5L8RJ 5TISH 1DD3A 1J2JB 1NTMJ 1FZAA 1NAFA 3H1IG 5CBNA 3B5NB 5AW4B 4RJTA 3H1HD 1EC5A 4L75A 3L75E 1NTKD 3CXHH 1KILA 3S1KA 2WVRA 4ZNCA 1L0LK 3B4SA 4N78D 2J59M 5KJ7A 1GW3A 1BCCJ 4KT0J 1IFDA 1OWAA 1RE4A 1AV1A 4I2LC 3V4WA 1ZR4A 2WSEH 1S9KE 3SFEC 4N78E 5KAFE 3WUVA 2WTYA 1K8AQ 3ITKA 2HFED 1PP9G 1QX8A 2PP6A 2W8ZA 1S5LH 2IZ0A 3H1IJ 3P7KA 3I55P 2QVAA 1JOCA 1NVOA 2P2UA 2W6AA 3KYQA 4TT3H 5AW9B 5CJ4A 2E74C 1SQPD 2V7QH 3W67A 4AQRD 4ASWA 3AE9C 2NPSC 1P84H 2Z5IA 4H13D 4YXDC 3PLNA 1JMMA 2AXTE 4BRYB 1PP9E 1YTZT 2YMYA 2M8RA 1AFOA 1SP4A 1A02J 3HD7A 4K35A 3GF7A 1YQ4C 2E5TA 3BASA 2IX7C 1PGPA 1LTBC 3H1KD 1H0TA 2R5DA 2YNYA 1X0TA 1YBKA 3AECC 2QJPC 5CCHC 4RESB 1SQBG 1HVVA 1EDKA 1GZLA 1NTMK 2HG5D 2WPVB 1KB9D 1PIXA 1SQPJ 1XTGB 2NPSD 3C1LA 3O8ZA 3RL0B 4EOTA 5CJ0A 3WUUA 2R3CA 5AW8B 2QG4A 5H2FE 1UIXA 1JCCA 2E74B 2ZVNB 3AEAC 3R4YA 4WY4A 1NAYA 1FDOA 4EI2A 1DEBA 1PV3A 2CK3H 1FZGA 1NH4A 1HTLC 1NTKG 1SQXD 3QWOC 2E43A 2NZ2A 1OVVA 2GA1A 2WMMA 4H0LD 4OGQD 1HBWA 3BRTB 2KXPB 4WVZA 1SQXE 3GHGB 1SFCA 1GW4A 2FYUJ 1L0LE 2YO3A 3S4RA 4DT0A 1VDFA 4N3YB 4Y99B 5CBOA 1DEEG 2BEZF 1NU1G 1G1IA 4U3FJ 2YIUC 3L35A 2QM8A 1P84D 3CCJP 1N86A 1N7SA 1SQBD 1K9MQ 2JWAA 4IFFA 1IFPA 1JY2P 1SQPE 1S9KD 4EIJA 1FJKA 2B87B 2LR2A 4ZMDA 3I5CA 2Z4EA 2ZT9D 3M9QA 1PP9D 3AEBC 3BRVB 5TJHA 1KFMA 1LT9B 2R5BA 1LTJC 3GLMA 2QRXA 5APTA 5AW3B 1CI6B 4BXLA 3G3ZA 1SQQK 2Q3IA 1KYOH 1ZXGA 2YKOA 1SQPG 3AE7C 4R4MA 5EFWB 2ZT9C 3MP7B 3SFDC 1IO4A 4WWIA 1SQBJ 3L74D 4D6TD 1PFIA 1HJBA 1VQKP 2ZAEB 5C39A 1L0NK 3HE5A 5TISE 1SQQE 1MV8A 3CXHD 1IC2A 3CMAP 4JPZB 1YITP 4IL6H 2V4HA 1PGOA 3PHLA 1SQXG 2OYIA 1ZP0C 2KS1A 1SLQA 1FBMA 1OW7A 2A45H 2R44A 2A06D 2A45I 2E75B 3A3YB 1EZVG 3GW6A 4IOIH 1NKZB 1NTKE 1BSHA 2IYOA 1H8AA 3RL0g 2P1JA 3EFGA 3HD7D 4OGQB 4PJ0H 2C9NY 4RKUJ 1KILB 2ITAA 1KQGB 3M0DC 2QA4P 1GL2C 4K3AA 2GUVA 1SQBE 1PGQA 5AVQB 1URQA 2L5GB 1KQFB 1Q2NA 2YXRB 3T97A 3TDKA 5E79E 4H44B 1YI2P 3V5BA 1N7LA 1RQUA 3MHVA 1GK6A 1JM0A 3VOPA 4AYCA 3VMXA 1N7SD 3V4QA 5AVXB 1DH3A 3WMM0 2ZYDA 2QM7A 3HUSA 1X79B 1J1DC 2Z5HA 4PV1C 1GU4A 1QVFO 3L70G 2XZRA 2NRGA 1S1CX 3TYYA 1K73Q 2K9JA 1FZFA 4H13C 2I1KA 1RF1A 1P84I 1SQVJ 1RF1C 1N73B 2E75D 2I8DA 5B66E 1BE3G 2JEEA 1KB9H 2V7QJ 2QJKC 1FAVA 3L72E 3MUDA 4H0LB 2E76C 3JC22 1FDMA 3CL3D 1NTZJ 3NTNA 1D7MA 2WSSH 5GTIE 1SVFA 1FU1A 5GTIH 3SSUA 2IBZI 1VQMP 2N1TB 1DIPA 1FZCB 1PGJA 1RQVA 1N7SC 3KPEA 3L75G 5KKZC 2PFXA 3GMAA 2OYIB 3CD6P 2JO1A 5KAIE 4C7RA 1R8EA 3SWYA 1VQ7P 1DX7A 1GDTA 1NTKK 4YXWH 2FYUE 3CPWO 1ZN5A 3L73E 2BEQD 2WPRA 3H1HG 3TGUG 3GHGA 1SFCB 5KLVD 1P84E 1ZV8A 3Q5PA 5AW7B 1R5SA 1TU3F 3H1HE 1T3JA 1EZVI 3TGUE 1KORA 3H1LG 1M1JA 3L73G 3P8CD 5AVWB 4ZKUA 3IN6A 2FXOA 5KLVE 3H1KJ 2N9YB 2RH0A 1N7SB 3CX5H 3LW5H 4JQ0D 5B5EE 2Y9YA 3AEFC 1OIPA 3JSVC 1WRGA 2IZ1A 5APVA 5KKZB 3G6EP 1LT9A 1FJPA 5CHXA 3AEDC 1YYCA 5KTBA 4UB6E 2O01H 2YXQB 3KZIE 3TK1A 2KP8A 1NU1K 1IFJA 3L73J 3RGUA 4L73A 1IJDB 1X8YA 2WSFH 1PPJD 4HB1A 3M0DA 4ZKPA 2G8YA 2Q1KA 1KQSO 1BE3E 1GL2A 3FX0A 3H1JE 2Y9ZA 3TGUJ 1CZQA 2FYNC 2A06E 2R3SA 3IFMA 2K1AA 1PPJE 4XFJA 3V2RA 1JY2N 1BCCD 1NTKJ 2LKMA 3H1KE 3L36A 3L70E 2N1TC 1VF5C 5KLVJ 2HPCA 2KI7B 3LW5J 3QH9A 1SQVG 4HJGH 2QEXP 1KB9E 4KJMA 3I56P 1X9VA 1Q81Q 2OYOA 1LJ2A 4JF7A 1JTHB 5CCGD 1AA0A 3N4XA 1M57D 2O3JA 1G2CA 1NTZG 3CWBJ 4NPDA 4CPGA 3AE3C 5KJ7C 4LGDE 1W2BO 4OGQC 1VQ4P 1LWUC 3MD0A 5AW5B 1NHLA 2M3BA 1URQB 2JR8A 1FC2C 3KDPB 2RMZA 3CX5D 3SWKA 4DZOA 2FFDC 1ZW0A 5AVRB 3RK2C 1BE3J 2IPPA 1BDCA 1JEKA 1RF0A 5K5GB 1S3JA 4PD4E 1PL5A 1EZVE 2R32A 1GD2E 1N2DC 4C7NA 1M7LA 2QSIA 1JY3O 1MZ9A 3A5TA 2HODB 1GU5A 1NTMG 3RBZA 3CC2P 2K9JB 5AVSB 1CSBA 1PPJG 3L72J 5CMZA 3VP8A 2A06G 1OW8A 1LP1B 2KSEA 3L71J 2WT7B 1N73A 1U7JA 2B89A 3KQGA 2KZIA 3H1JD 3PTZA 1KB9I 1KILE 2A45G 3H25A 1KN7A 2P58A 5BVZA 1GK4A 1BCCG 3V2QA 5AVYB 1QEXA 3VMYA 5KLVK 2OQQA 3GHGC 3RK3C 2ZT9B 3ABVC 4GT1A 4OH8B 2C0WA 1KILD 1WMKA 3RBXA 2QE7H 1M1JC 1N8RQ 3VYIA 1K04A 2OGUA 5APWA 1OZHA 1RE3A 2HPCB 1VL2A 1KC8Q 1BGYD 1WT6A 4JBZA 3HUSC 4I6MC 2YIUB 1HWTC 3L70D 1L0NJ 5KLVG 2JP3A 1HJ0A 4Y28J 2JKVA 1DD4A 3AE6C 2XU6A 4JYCA 2H43A 2LXCB 1OVRA 3P8CE 5H2FH 1USDA 1SFCC 2E42A 4U7JA 4U3FG 2FYUD 2L91A 2PRRA 3H32B 5AVZB 2XDJA 1RE4C 2YMKA 2E74D 1M1JB 2ZFCA 3RK2B 2FYUG 4IL6X 5APQA 3HRNA 2M5AB 1KZUB 3HD7B 1GTWA 2ZXXA 3CX5I 1BDDA 2Y0CA 5GTHE 3RL0C 4XA4A 4BWNA 2Q5UA 1H0TB 3VTPC 1SFCD 4XE5B 3AEGC 4HH2A 5CCGA 1YJWP 4WB4A 3WU2H 3K5BA 5CCHD 1LTJA 2JDIH 1EZVD 1PZQA 2WPSA 3F5HA 3IAOA 4GKGA 3BCCE 4B86A 1SS1A 1Y8AA 2OTJP 1T8ZA 4LC1A 4WY4B 1K05A 5AW1B 2OTLP 4H0LC 1LTAC 3S9OA 1NJIQ 4R4LA 1GL2B 5APSA 4RO0A 1U57A 3Q3DA 2WPQA 1IFMA 3L4FA 1KILC 3V2PA 2YKQA 1ZMEC 2D2CB 4IL6E 3OJAB 4JYBA 1VQ5P 3VP9A 3CXHE 1IFIA 1L4AA 1FOSE 1YQ3C 2FBWC 1VQ9P 1GMJA 1L0LJ 1VQ8P 2FXMA 1JY3P 5AVVB 1J1DB 4PV1B 1YHQP 1KYOE 1MFZA 2B9BA 3AEEC 2GUSA 3KXDA 2K88A 2B87A 4NPFX 1EDJA 3BCCG 1FZBA 3G71P 4DJGA 3OA7A 1Q90D 3B5NC 1JY3N 2E76D 2AEFA 2KLVA 2FFDB 2N9BA 3PRJA 2FXPA 2NPSA 2WZ7A 1AVOA 1Q86Q 2D2CC 3H1IE 2K37A 3H1LD 1W5CE 2KNCB 1KMIZ 1FZEA 1MKMA 2H8PD 2E75C 1HGVA 2BASA 3HD7C 3L74J 4PD4I 2PAJA 1JUNA 2IBZE 4GDOA 3L71E 5KJ7D 1M8OB 2HODA 2P67A 4ASVA 1PP9J 1EDIA 1KTMA 4PD4D 4HYTB 2YKPA 1L2PA 1SQQG 1YJ9P 2IFNA 4W80A 3SWFA 2GM4A 1J1EB 1LGHB 2HLOA 4WY4D 2J5UA 4GOEA 3L75D 3OAKA 4YPCA 3N7NA 3Q5SA 1M1KQ 3U1CA 1NO4A 4GODA 2WSCJ 1S5LX 1XTCC 5KAIH 4O9BA
chains in the Genus database with same CATH topology
4CPGA 4NPDA 1OVUA 3ZDMA 2HR3A 2QRXA 1FC2C 4BXLA 4EYYQ 1BDCA 1ZW0A 1ZXGA 5EFWB 4WWIA 5K5GB 1S3JA 2ZAEB 5C39A 2SPZA 2JWDA 1LP1B 4IOIH 1U7JA 2B89A 2R44A 4GOFA 2KZIA 2P58A 2M5AA 1Y47A 2K3RA 4MN4C 4K3AA 1Q2NA 3MHVA 4JBZA 1JM0A 2M0BA 2B88A 1OVRA 1LT1A 2LXCB 2KS1B 2I8DA 1JMBA 1EDLA 2M5AB 3MZWB 1BDDA 5CBNA 4NPEA 1H0TB 3S1KA 1EC5A 4ZNCA 1SS1A 5DJTB 4HKZH 2OTKE 2KIKA 2QVAA 1NVOA 2RKLA 1U7MA 4ASWA 4K35A 4NPFX 1EDJA 1H0TA 2B87A 1X0TA 1EDKA 3PH0A 1MFTA 2KZJA 3FXDA 3RGUA 3QWOC 4HB1A 2KUBA 1OVVA 2Q1KA 2WMMA 4ASVA 1EDIA 5CBOA 2LR2A 1LP1A 2LXBA 2KI7B 1DEEG 2UWJE 4HJGH 4GOEA 4KJMA 4GODA 5DJUB 3FXEA 2B87B 4ZMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CPG A;  4NPD A;  1OVU A;  3ZDM A;  2HR3 A;  2QRX A;  1FC2 C;  4BXL A;  4EYY Q;  1BDC A;  1ZW0 A;  1ZXG A;  5EFW B;  4WWI A;  5K5G B;  1S3J A;  2ZAE B;  5C39 A;  2SPZ A;  2JWD A;  1LP1 B;  4IOI H;  1U7J A;  2B89 A;  2R44 A;  4GOF A;  2KZI A;  2P58 A;  2M5A A;  1Y47 A;  2K3R A;  4MN4 C;  4K3A A;  1Q2N A;  3MHV A;  4JBZ A;  1JM0 A;  2M0B A;  2B88 A;  1OVR A;  1LT1 A;  2LXC B;  2KS1 B;  2I8D A;  1JMB A;  1EDL A;  2M5A B;  3MZW B;  1BDD A;  5CBN A;  4NPE A;  1H0T B;  3S1K A;  1EC5 A;  4ZNC A;  1SS1 A;  5DJT B;  4HKZ H;  2OTK E;  2KIK A;  2QVA A;  1NVO A;  2RKL A;  1U7M A;  4ASW A;  4K35 A;  4NPF X;  1EDJ A;  1H0T A;  2B87 A;  1X0T A;  1EDK A;  3PH0 A;  1MFT A;  2KZJ A;  3FXD A;  3RGU A;  3QWO C;  4HB1 A;  2KUB A;  1OVV A;  2Q1K A;  2WMM A;  4ASV A;  1EDI A;  5CBO A;  2LR2 A;  1LP1 A;  2LXB A;  2KI7 B;  1DEE G;  2UWJ E;  4HJG H;  4GOE A;  4KJM A;  4GOD A;  5DJU B;  3FXE A;  2B87 B;  4ZMD A; 
#chains in the Genus database with same CATH topology
 1VQN P;  2ZVO B;  1AVY A;  1HGZ A;  2WSC H;  3AE8 C;  3HTK A;  3ZDM A;  1BGY E;  1BGY G;  2AEJ A;  3P8M C;  3L37 A;  3T97 B;  2FYZ A;  3RK3 E;  1L0N E;  4EYY Q;  1NU1 D;  2Q3E A;  5KLI C;  5AVT B;  4C7N B;  1JB0 J;  2FYU K;  1QLE D;  2QIW A;  3FGA D;  3CWB G;  3FWL A;  1OFC X;  1SQX J;  3A0B H;  3TF5 A;  3CCM P;  1NU1 E;  2AXT H;  1S2E A;  3EQ2 A;  3HUS B;  1VPC A;  2FY8 A;  2W27 A;  2Y0E A;  3NMD A;  2W83 C;  3U1A A;  1LTS C;  2H7H A;  1L0L G;  2SPZ A;  4Y99 C;  1NTM E;  5M1B A;  4EDF A;  4UB8 E;  3CCV P;  3H1J J;  2ZJS E;  1X22 A;  3B71 A;  3MIW A;  5AW6 B;  4D6T E;  3LID A;  2QJY C;  1S5L E;  3B8E B;  3E1I A;  1H89 A;  3WU2 E;  2QJK B;  1RH5 B;  1VF5 B;  3JCU E;  3O6Q B;  3RK2 D;  1ZOY C;  5AW0 B;  4DOJ A;  4UB6 H;  3TGU D;  1FDI A;  2KSJ A;  3CX5 E;  1KV4 A;  1Z56 A;  4UB8 H;  3H1I D;  4QMA A;  3TNU A;  1LNQ A;  2C0X A;  3F89 A;  2K3R A;  2CPS A;  2M3E A;  1YJN P;  1L4A C;  1Q7Y Q;  4MN4 C;  1FE6 A;  1NTZ E;  2IBZ D;  4H44 D;  3G4S P;  2OYI C;  1FZC C;  1NU1 J;  5GTH H;  3GF3 A;  1FOS F;  2XND H;  1OX3 A;  1ZRT E;  3MUD C;  4WY4 C;  3CCS P;  3FWN A;  1VQO P;  1VF5 D;  1IFN A;  1L0L D;  2AEM A;  1ZR2 A;  4I7Z C;  3AE2 C;  3H6P A;  3HE5 B;  1G1J A;  4D6T J;  2BCC E;  1VQ6 P;  3MTU E;  3H1K G;  3U59 A;  2W6J H;  4W7Y A;  2O1J A;  1MUU A;  3CWB D;  1YTZ I;  2KS1 B;  1SQX K;  4OVN F;  1BE3 D;  1LWU B;  2IFM A;  2Y0D A;  3M9H A;  3Q1M A;  1URQ C;  3H1J G;  1L4A B;  3IF4 A;  1IK7 A;  1OMI A;  5B5E H;  1EDL A;  4L76 A;  5CCG C;  1JNM A;  1USE A;  3MZW B;  1RY3 A;  1T3U A;  2AXC A;  2H88 C;  1NTM D;  2MJZ A;  2YO2 A;  3M9B A;  4I7Z B;  4L74 A;  4NPE A;  2RN0 A;  3AE1 C;  1NWQ A;  1UII A;  3CCU P;  3BVH A;  3KZI H;  2FFD A;  3L73 D;  3L74 E;  5BU5 A;  3HE4 B;  3P32 A;  2NPS B;  2G3A A;  2ZYA A;  2IDB A;  3PH0 A;  4WBA A;  1Q82 Q;  5DJT B;  4HKZ H;  2WWW A;  3L71 D;  1S4X A;  2KNC A;  2O01 J;  3A0H E;  3CLQ A;  2BCC J;  2FYN B;  2WSE J;  3A0H H;  4U3F D;  1M56 D;  2OTK E;  1R5L A;  4PD4 H;  1H88 A;  2KIK A;  4Z1M H;  1T2K D;  2FKW B;  2HYN A;  2KYV A;  2D2C D;  2KB7 P;  2JJL A;  3A2A A;  4IFM A;  1JY2 O;  2MKV A;  1URQ D;  1U7M A;  1LTI C;  2RKL A;  1OW6 A;  3R2P A;  4U3F E;  2Q6Q A;  2XKM A;  3PJS K;  1NGM B;  3D6Z A;  2I1J A;  2Q9I A;  4M3L A;  2OYH A;  1SQV D;  2KK7 A;  1OXZ A;  1EXJ A;  2IYP A;  3LIE A;  3MGN A;  1LTG C;  2BCC D;  3L70 J;  1KQL A;  3TSI A;  3CCL P;  4N6J A;  1BGY J;  2O01 N;  3B5N A;  1AQ5 A;  2CPB A;  1L0N D;  5KAF H;  3L74 G;  5B66 H;  1G2C B;  1HUC A;  1QL1 A;  3HTK B;  3Q5R A;  2K9Y A;  1FZC A;  2E5Y A;  2E76 B;  2P10 A;  3G9R A;  3RL0 D;  2N1T A;  3CCQ P;  1MFT A;  5CCH A;  5AVU B;  1QVG O;  1NKN A;  3USS A;  2KZJ A;  1L4A D;  3M91 A;  3A7O A;  3FXD A;  2VRS A;  1SQP K;  4TLF A;  1SQQ J;  3GG2 A;  1BCC E;  2O1K A;  2W6B A;  3II6 A;  1HH0 A;  1T2K C;  3BCC J;  3L72 G;  3RK3 D;  2POH A;  2KUB A;  1AQT A;  3BAT A;  2WSF J;  2ZXE B;  1QL2 A;  2XNX A;  2Q7C A;  1EQ7 A;  1A02 F;  2P7J A;  3C8V A;  1KYO D;  2BCC G;  2LXB A;  1LP1 A;  3E7K A;  2WT7 A;  1LTT C;  2DW3 A;  3EWK A;  4BRY A;  1E5W A;  2OAR A;  2QJY B;  2UWJ E;  3O6Q A;  1ZLL A;  2KLU A;  3C9I A;  1AJY A;  4H44 C;  3E1R A;  5DJU B;  1GL2 D;  1NTZ D;  2ZYG A;  3FXE A;  1W2E A;  3NXS A;  3RK3 B;  3TNU B;  3WUT A;  1KD1 Q;  5BU8 B;  1OVU A;  3CXH I;  3CME P;  4AUW A;  1T6A A;  1ZRT D;  2HR3 A;  1HF9 A;  3M0A A;  4KHX A;  1N73 C;  1Y9B A;  3CI9 A;  4H13 B;  1RF1 B;  4PV1 D;  3A0B E;  3CC4 P;  2XV5 A;  3BCC D;  4I1L A;  3V2N A;  3OW2 O;  3M06 A;  3D6Y A;  1JCD A;  2KOG A;  1SQV E;  3B5N D;  4D6T G;  1SQB K;  3JCU H;  1E79 H;  3AE5 C;  3AE4 C;  3H32 A;  4YTP C;  1JO5 A;  2N1T D;  1LWU A;  2JWD A;  1RE3 C;  3H1L J;  1VQP P;  3PP5 A;  1SQV K;  1QGK B;  2PGD A;  4GOF A;  2WQY C;  4W7Z A;  3IR9 A;  1IK9 A;  1BSN A;  2J58 A;  1M90 Q;  2C9L Y;  3CWB E;  1IZN B;  2M5A A;  3UIA A;  5AW2 B;  1Y47 A;  1RF0 C;  1EXI A;  4GIF A;  3EFF K;  1CW5 A;  1JTH A;  3V6I A;  5APY A;  4IFD K;  1L0N G;  2WIT A;  3Q2Y A;  1NTZ K;  2OYH C;  3W68 A;  3D71 A;  1LTJ B;  3L72 D;  1LT9 C;  2W90 A;  1VQL P;  1CI6 A;  1KYO I;  3HE4 A;  3L75 J;  3CC7 P;  3D70 A;  1NYH A;  4PJ0 E;  1J1E C;  5E79 H;  2M0B A;  5APU A;  5APX A;  4C46 A;  2H89 C;  1YIJ P;  3VN0 A;  3VMA A;  4DCK A;  1RHZ B;  3H1L E;  2QJP B;  3H1H J;  4LLH A;  4OWF A;  2B88 A;  3CCR P;  1LT1 A;  3CCE P;  1FS0 E;  5KLI B;  3KHU A;  1KFN A;  3NFQ A;  4A7P A;  1NOH A;  3L71 G;  1SQQ D;  3VMZ A;  2IBZ G;  2OYH B;  1S72 P;  1JMB A;  5L8R J;  5TIS H;  1DD3 A;  1J2J B;  1NTM J;  1FZA A;  1NAF A;  3H1I G;  5CBN A;  3B5N B;  5AW4 B;  4RJT A;  3H1H D;  1EC5 A;  4L75 A;  3L75 E;  1NTK D;  3CXH H;  1KIL A;  3S1K A;  2WVR A;  4ZNC A;  1L0L K;  3B4S A;  4N78 D;  2J59 M;  5KJ7 A;  1GW3 A;  1BCC J;  4KT0 J;  1IFD A;  1OWA A;  1RE4 A;  1AV1 A;  4I2L C;  3V4W A;  1ZR4 A;  2WSE H;  1S9K E;  3SFE C;  4N78 E;  5KAF E;  3WUV A;  2WTY A;  1K8A Q;  3ITK A;  2HFE D;  1PP9 G;  1QX8 A;  2PP6 A;  2W8Z A;  1S5L H;  2IZ0 A;  3H1I J;  3P7K A;  3I55 P;  2QVA A;  1JOC A;  1NVO A;  2P2U A;  2W6A A;  3KYQ A;  4TT3 H;  5AW9 B;  5CJ4 A;  2E74 C;  1SQP D;  2V7Q H;  3W67 A;  4AQR D;  4ASW A;  3AE9 C;  2NPS C;  1P84 H;  2Z5I A;  4H13 D;  4YXD C;  3PLN A;  1JMM A;  2AXT E;  4BRY B;  1PP9 E;  1YTZ T;  2YMY A;  2M8R A;  1AFO A;  1SP4 A;  1A02 J;  3HD7 A;  4K35 A;  3GF7 A;  1YQ4 C;  2E5T A;  3BAS A;  2IX7 C;  1PGP A;  1LTB C;  3H1K D;  1H0T A;  2R5D A;  2YNY A;  1X0T A;  1YBK A;  3AEC C;  2QJP C;  5CCH C;  4RES B;  1SQB G;  1HVV A;  1EDK A;  1GZL A;  1NTM K;  2HG5 D;  2WPV B;  1KB9 D;  1PIX A;  1SQP J;  1XTG B;  2NPS D;  3C1L A;  3O8Z A;  3RL0 B;  4EOT A;  5CJ0 A;  3WUU A;  2R3C A;  5AW8 B;  2QG4 A;  5H2F E;  1UIX A;  1JCC A;  2E74 B;  2ZVN B;  3AEA C;  3R4Y A;  4WY4 A;  1NAY A;  1FDO A;  4EI2 A;  1DEB A;  1PV3 A;  2CK3 H;  1FZG A;  1NH4 A;  1HTL C;  1NTK G;  1SQX D;  3QWO C;  2E43 A;  2NZ2 A;  1OVV A;  2GA1 A;  2WMM A;  4H0L D;  4OGQ D;  1HBW A;  3BRT B;  2KXP B;  4WVZ A;  1SQX E;  3GHG B;  1SFC A;  1GW4 A;  2FYU J;  1L0L E;  2YO3 A;  3S4R A;  4DT0 A;  1VDF A;  4N3Y B;  4Y99 B;  5CBO A;  1DEE G;  2BEZ F;  1NU1 G;  1G1I A;  4U3F J;  2YIU C;  3L35 A;  2QM8 A;  1P84 D;  3CCJ P;  1N86 A;  1N7S A;  1SQB D;  1K9M Q;  2JWA A;  4IFF A;  1IFP A;  1JY2 P;  1SQP E;  1S9K D;  4EIJ A;  1FJK A;  2B87 B;  2LR2 A;  4ZMD A;  3I5C A;  2Z4E A;  2ZT9 D;  3M9Q A;  1PP9 D;  3AEB C;  3BRV B;  5TJH A;  1KFM A;  1LT9 B;  2R5B A;  1LTJ C;  3GLM A;  2QRX A;  5APT A;  5AW3 B;  1CI6 B;  4BXL A;  3G3Z A;  1SQQ K;  2Q3I A;  1KYO H;  1ZXG A;  2YKO A;  1SQP G;  3AE7 C;  4R4M A;  5EFW B;  2ZT9 C;  3MP7 B;  3SFD C;  1IO4 A;  4WWI A;  1SQB J;  3L74 D;  4D6T D;  1PFI A;  1HJB A;  1VQK P;  2ZAE B;  5C39 A;  1L0N K;  3HE5 A;  5TIS E;  1SQQ E;  1MV8 A;  3CXH D;  1IC2 A;  3CMA P;  4JPZ B;  1YIT P;  4IL6 H;  2V4H A;  1PGO A;  3PHL A;  1SQX G;  2OYI A;  1ZP0 C;  2KS1 A;  1SLQ A;  1FBM A;  1OW7 A;  2A45 H;  2R44 A;  2A06 D;  2A45 I;  2E75 B;  3A3Y B;  1EZV G;  3GW6 A;  4IOI H;  1NKZ B;  1NTK E;  1BSH A;  2IYO A;  1H8A A;  3RL0 g;  2P1J A;  3EFG A;  3HD7 D;  4OGQ B;  4PJ0 H;  2C9N Y;  4RKU J;  1KIL B;  2ITA A;  1KQG B;  3M0D C;  2QA4 P;  1GL2 C;  4K3A A;  2GUV A;  1SQB E;  1PGQ A;  5AVQ B;  1URQ A;  2L5G B;  1KQF B;  1Q2N A;  2YXR B;  3T97 A;  3TDK A;  5E79 E;  4H44 B;  1YI2 P;  3V5B A;  1N7L A;  1RQU A;  3MHV A;  1GK6 A;  1JM0 A;  3VOP A;  4AYC A;  3VMX A;  1N7S D;  3V4Q A;  5AVX B;  1DH3 A;  3WMM 0;  2ZYD A;  2QM7 A;  3HUS A;  1X79 B;  1J1D C;  2Z5H A;  4PV1 C;  1GU4 A;  1QVF O;  3L70 G;  2XZR A;  2NRG A;  1S1C X;  3TYY A;  1K73 Q;  2K9J A;  1FZF A;  4H13 C;  2I1K A;  1RF1 A;  1P84 I;  1SQV J;  1RF1 C;  1N73 B;  2E75 D;  2I8D A;  5B66 E;  1BE3 G;  2JEE A;  1KB9 H;  2V7Q J;  2QJK C;  1FAV A;  3L72 E;  3MUD A;  4H0L B;  2E76 C;  3JC2 2;  1FDM A;  3CL3 D;  1NTZ J;  3NTN A;  1D7M A;  2WSS H;  5GTI E;  1SVF A;  1FU1 A;  5GTI H;  3SSU A;  2IBZ I;  1VQM P;  2N1T B;  1DIP A;  1FZC B;  1PGJ A;  1RQV A;  1N7S C;  3KPE A;  3L75 G;  5KKZ C;  2PFX A;  3GMA A;  2OYI B;  3CD6 P;  2JO1 A;  5KAI E;  4C7R A;  1R8E A;  3SWY A;  1VQ7 P;  1DX7 A;  1GDT A;  1NTK K;  4YXW H;  2FYU E;  3CPW O;  1ZN5 A;  3L73 E;  2BEQ D;  2WPR A;  3H1H G;  3TGU G;  3GHG A;  1SFC B;  5KLV D;  1P84 E;  1ZV8 A;  3Q5P A;  5AW7 B;  1R5S A;  1TU3 F;  3H1H E;  1T3J A;  1EZV I;  3TGU E;  1KOR A;  3H1L G;  1M1J A;  3L73 G;  3P8C D;  5AVW B;  4ZKU A;  3IN6 A;  2FXO A;  5KLV E;  3H1K J;  2N9Y B;  2RH0 A;  1N7S B;  3CX5 H;  3LW5 H;  4JQ0 D;  5B5E E;  2Y9Y A;  3AEF C;  1OIP A;  3JSV C;  1WRG A;  2IZ1 A;  5APV A;  5KKZ B;  3G6E P;  1LT9 A;  1FJP A;  5CHX A;  3AED C;  1YYC A;  5KTB A;  4UB6 E;  2O01 H;  2YXQ B;  3KZI E;  3TK1 A;  2KP8 A;  1NU1 K;  1IFJ A;  3L73 J;  3RGU A;  4L73 A;  1IJD B;  1X8Y A;  2WSF H;  1PPJ D;  4HB1 A;  3M0D A;  4ZKP A;  2G8Y A;  2Q1K A;  1KQS O;  1BE3 E;  1GL2 A;  3FX0 A;  3H1J E;  2Y9Z A;  3TGU J;  1CZQ A;  2FYN C;  2A06 E;  2R3S A;  3IFM A;  2K1A A;  1PPJ E;  4XFJ A;  3V2R A;  1JY2 N;  1BCC D;  1NTK J;  2LKM A;  3H1K E;  3L36 A;  3L70 E;  2N1T C;  1VF5 C;  5KLV J;  2HPC A;  2KI7 B;  3LW5 J;  3QH9 A;  1SQV G;  4HJG H;  2QEX P;  1KB9 E;  4KJM A;  3I56 P;  1X9V A;  1Q81 Q;  2OYO A;  1LJ2 A;  4JF7 A;  1JTH B;  5CCG D;  1AA0 A;  3N4X A;  1M57 D;  2O3J A;  1G2C A;  1NTZ G;  3CWB J;  4NPD A;  4CPG A;  3AE3 C;  5KJ7 C;  4LGD E;  1W2B O;  4OGQ C;  1VQ4 P;  1LWU C;  3MD0 A;  5AW5 B;  1NHL A;  2M3B A;  1URQ B;  2JR8 A;  1FC2 C;  3KDP B;  2RMZ A;  3CX5 D;  3SWK A;  4DZO A;  2FFD C;  1ZW0 A;  5AVR B;  3RK2 C;  1BE3 J;  2IPP A;  1BDC A;  1JEK A;  1RF0 A;  5K5G B;  1S3J A;  4PD4 E;  1PL5 A;  1EZV E;  2R32 A;  1GD2 E;  1N2D C;  4C7N A;  1M7L A;  2QSI A;  1JY3 O;  1MZ9 A;  3A5T A;  2HOD B;  1GU5 A;  1NTM G;  3RBZ A;  3CC2 P;  2K9J B;  5AVS B;  1CSB A;  1PPJ G;  3L72 J;  5CMZ A;  3VP8 A;  2A06 G;  1OW8 A;  1LP1 B;  2KSE A;  3L71 J;  2WT7 B;  1N73 A;  1U7J A;  2B89 A;  3KQG A;  2KZI A;  3H1J D;  3PTZ A;  1KB9 I;  1KIL E;  2A45 G;  3H25 A;  1KN7 A;  2P58 A;  5BVZ A;  1GK4 A;  1BCC G;  3V2Q A;  5AVY B;  1QEX A;  3VMY A;  5KLV K;  2OQQ A;  3GHG C;  3RK3 C;  2ZT9 B;  3ABV C;  4GT1 A;  4OH8 B;  2C0W A;  1KIL D;  1WMK A;  3RBX A;  2QE7 H;  1M1J C;  1N8R Q;  3VYI A;  1K04 A;  2OGU A;  5APW A;  1OZH A;  1RE3 A;  2HPC B;  1VL2 A;  1KC8 Q;  1BGY D;  1WT6 A;  4JBZ A;  3HUS C;  4I6M C;  2YIU B;  1HWT C;  3L70 D;  1L0N J;  5KLV G;  2JP3 A;  1HJ0 A;  4Y28 J;  2JKV A;  1DD4 A;  3AE6 C;  2XU6 A;  4JYC A;  2H43 A;  2LXC B;  1OVR A;  3P8C E;  5H2F H;  1USD A;  1SFC C;  2E42 A;  4U7J A;  4U3F G;  2FYU D;  2L91 A;  2PRR A;  3H32 B;  5AVZ B;  2XDJ A;  1RE4 C;  2YMK A;  2E74 D;  1M1J B;  2ZFC A;  3RK2 B;  2FYU G;  4IL6 X;  5APQ A;  3HRN A;  2M5A B;  1KZU B;  3HD7 B;  1GTW A;  2ZXX A;  3CX5 I;  1BDD A;  2Y0C A;  5GTH E;  3RL0 C;  4XA4 A;  4BWN A;  2Q5U A;  1H0T B;  3VTP C;  1SFC D;  4XE5 B;  3AEG C;  4HH2 A;  5CCG A;  1YJW P;  4WB4 A;  3WU2 H;  3K5B A;  5CCH D;  1LTJ A;  2JDI H;  1EZV D;  1PZQ A;  2WPS A;  3F5H A;  3IAO A;  4GKG A;  3BCC E;  4B86 A;  1SS1 A;  1Y8A A;  2OTJ P;  1T8Z A;  4LC1 A;  4WY4 B;  1K05 A;  5AW1 B;  2OTL P;  4H0L C;  1LTA C;  3S9O A;  1NJI Q;  4R4L A;  1GL2 B;  5APS A;  4RO0 A;  1U57 A;  3Q3D A;  2WPQ A;  1IFM A;  3L4F A;  1KIL C;  3V2P A;  2YKQ A;  1ZME C;  2D2C B;  4IL6 E;  3OJA B;  4JYB A;  1VQ5 P;  3VP9 A;  3CXH E;  1IFI A;  1L4A A;  1FOS E;  1YQ3 C;  2FBW C;  1VQ9 P;  1GMJ A;  1L0L J;  1VQ8 P;  2FXM A;  1JY3 P;  5AVV B;  1J1D B;  4PV1 B;  1YHQ P;  1KYO E;  1MFZ A;  2B9B A;  3AEE C;  2GUS A;  3KXD A;  2K88 A;  2B87 A;  4NPF X;  1EDJ A;  3BCC G;  1FZB A;  3G71 P;  4DJG A;  3OA7 A;  1Q90 D;  3B5N C;  1JY3 N;  2E76 D;  2AEF A;  2KLV A;  2FFD B;  2N9B A;  3PRJ A;  2FXP A;  2NPS A;  2WZ7 A;  1AVO A;  1Q86 Q;  2D2C C;  3H1I E;  2K37 A;  3H1L D;  1W5C E;  2KNC B;  1KMI Z;  1FZE A;  1MKM A;  2H8P D;  2E75 C;  1HGV A;  2BAS A;  3HD7 C;  3L74 J;  4PD4 I;  2PAJ A;  1JUN A;  2IBZ E;  4GDO A;  3L71 E;  5KJ7 D;  1M8O B;  2HOD A;  2P67 A;  4ASV A;  1PP9 J;  1EDI A;  1KTM A;  4PD4 D;  4HYT B;  2YKP A;  1L2P A;  1SQQ G;  1YJ9 P;  2IFN A;  4W80 A;  3SWF A;  2GM4 A;  1J1E B;  1LGH B;  2HLO A;  4WY4 D;  2J5U A;  4GOE A;  3L75 D;  3OAK A;  4YPC A;  3N7N A;  3Q5S A;  1M1K Q;  3U1C A;  1NO4 A;  4GOD A;  2WSC J;  1S5L X;  1XTC C;  5KAI H;  4O9B A; 
#chains in the Genus database with same CATH homology
 4CPG A;  4NPD A;  1OVU A;  3ZDM A;  2HR3 A;  2QRX A;  1FC2 C;  4BXL A;  4EYY Q;  1BDC A;  1ZW0 A;  1ZXG A;  5EFW B;  4WWI A;  5K5G B;  1S3J A;  2ZAE B;  5C39 A;  2SPZ A;  2JWD A;  1LP1 B;  4IOI H;  1U7J A;  2B89 A;  2R44 A;  4GOF A;  2KZI A;  2P58 A;  2M5A A;  1Y47 A;  2K3R A;  4MN4 C;  4K3A A;  1Q2N A;  3MHV A;  4JBZ A;  1JM0 A;  2M0B A;  2B88 A;  1OVR A;  1LT1 A;  2LXC B;  2KS1 B;  2I8D A;  1JMB A;  1EDL A;  2M5A B;  3MZW B;  1BDD A;  5CBN A;  4NPE A;  1H0T B;  3S1K A;  1EC5 A;  4ZNC A;  1SS1 A;  5DJT B;  4HKZ H;  2OTK E;  2KIK A;  2QVA A;  1NVO A;  2RKL A;  1U7M A;  4ASW A;  4K35 A;  4NPF X;  1EDJ A;  1H0T A;  2B87 A;  1X0T A;  1EDK A;  3PH0 A;  1MFT A;  2KZJ A;  3FXD A;  3RGU A;  3QWO C;  4HB1 A;  2KUB A;  1OVV A;  2Q1K A;  2WMM A;  4ASV A;  1EDI A;  5CBO A;  2LR2 A;  1LP1 A;  2LXB A;  2KI7 B;  1DEE G;  2UWJ E;  4HJG H;  4GOE A;  4KJM A;  4GOD A;  5DJU B;  3FXE A;  2B87 B;  4ZMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...