1EC5A

Crystal structure of four-helix bundle model
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
48
structure length
48
Chain Sequence
b'DYLRELLKLELQLIKQYREALEYVKLPVLAKILEDEEKHIEWLETILG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FOUR-HELIX BUNDLE MODEL)
publication title Inaugural article: retrostructural analysis of metalloproteins: application to the design of a minimal model for diiron proteins.
pubmed doi rcsb
molecule tags De novo protein
total genus 20
structure length 48
sequence length 48
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2000-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1ec5A00
4CPGA 1S3JA 4HB1A 1MFTA 4ZMDA 1SS1A 2JWDA 2I8DA 2WMMA 4NPFX 1OVRA 1EC5A 3QWOC 3PH0A 4GODA 3RGUA 4ZNCA 4BXLA 4MN4C 1LT1A 2LXCB 3MZWB 4WWIA 2KS1B 1Q2NA 3MHVA 1EDIA 4HJGH 5CBNA 1OVUA 2KUBA 2B87A 2KI7B 1ZW0A 2SPZA 1EDJA 1LP1A 1NVOA 2R44A 5DJUB 1ZXGA 2M0BA 1U7JA 1BDDA 2Q1KA 1U7MA 2KIKA 5C39A 1BDCA 4IOIH 4ASVA 1X0TA 2M5AB 1EDKA 1Y47A 1JM0A 4JBZA 4HKZH 1JMBA 4K3AA 1H0TB 4K35A 4GOFA 4NPEA 3FXEA 2B88A 2OTKE 2QVAA 1DEEG 5K5GB 2KZJA 2ZAEB 1EDLA 3FXDA 2B89A 2P58A 5DJTB 5CBOA 4ASWA 4EYYQ 2QRXA 1FC2C 2LR2A 3ZDMA 2LXBA 2HR3A 2UWJE 4NPDA 2M5AA 2RKLA 2K3RA 2KZIA 3S1KA 2B87B 5EFWB 4KJMA 1OVVA 4GOEA 1LP1B 1H0TA
chains in the Genus database with same CATH superfamily
2PGDA 2M3EA 1KQLA 4ZMDA 1PP9J 3HD7C 3W68A 1KB9D 1FOSE 4MN4C 2Z4EA 1LT1A 1LTTC 3CCMP 2KNCA 1M1JB 3CXHI 2E75B 4I1LA 3C1LA 1VF5C 1PGJA 3T97A 1H89A 1PV3A 3BRTB 2FYUG 2XKMA 3V2RA 2AEFA 1EZVD 5APTA 5KJ7D 2L91A 1XTCC 1GTWA 4D6TE 3Q5RA 1Q7YQ 2O3JA 1FZBA 4OGQB 2IZ1A 1FJPA 2WVRA 1K73Q 2P2UA 3CX5E 3CC4P 2R5DA 3A0HE 4TLFA 2ZT9D 4NPEA 3AE9C 2OTKE 2QJKB 4N78E 1M1JC 3WMM0 3M0DA 1WT6A 4DOJA 1SFCD 1IK7A 1RE3A 1T6AA 2J58A 2XV5A 3D6YA 4GT1A 1H88A 1S5LE 2B87B 1VPCA 2C9NY 1ZLLA 2L5GB 3L74G 1RF1A 1KV4A 1GK4A 3H1HG 5M1BA 1G1IA 3AECC 5KLVG 2Q3EA 3O6QA 2LXCB 3EFGA 3L70E 1LTJA 2IZ0A 5H2FE 1QGKB 2QJKC 2BCCJ 1DH3A 1NAFA 4Z1MH 2P1JA 5AW0B 2YIUB 5AW5B 3AE5C 1SQBE 3VMAA 5GTHE 1SP4A 1N7LA 5DJUB 3JC22 4BRYA 3CX5H 4WY4D 1USDA 1DX7A 1ZRTE 1W2BO 3A0HH 5APQA 3H1KJ 3RL0g 1T3UA 4N3YB 3SFEC 1ZOYC 3M9QA 2OTJP 4UB8E 3CXHD 1OIPA 1Y47A 4JYBA 1RF0A 4PD4E 1RQVA 4R4LA 1MUUA 5CCGD 2D2CB 3H25A 1Q81Q 1KYOE 1SQBK 1N2DC 4U3FJ 2N1TC 1S5LH 3Q2YA 3GF3A 5BU5A 1L4AD 1L0LD 2HODA 1FC2C 4WBAA 3FGAD 2YIUC 3A0BH 2E5YA 1SQQJ 3KHUA 1OW7A 2YO3A 3B5ND 1RQUA 2WSEJ 1R5LA 5H2FH 4NPFX 1EQ7A 3SSUA 1MV8A 1M7LA 1PGPA 4D6TG 4H0LC 1MKMA 1BSNA 2HFED 1JCDA 2W6JH 5GTHH 1EDIA 1URQB 1KTMA 1PGQA 1ZW0A 2ZYDA 1VDFA 5AVUB 1NTKJ 1NTZE 3C8VA 4UB8H 3WU2E 3B71A 4PD4I 4L74A 1BCCD 3H1KD 4PD4H 4KHXA 1AJYA 1BGYE 1KYOI 2JO1A 2Q9IA 2FFDA 2Q3IA 5APSA 1YHQP 1NTME 1YQ3C 3SWYA 2HODB 4LC1A 4U3FD 3VMXA 3L71E 1BSHA 2ZXEB 1QVFO 1IFNA 2A45I 1MFZA 2WSFJ 1SQQD 3L70G 2PRRA 1M56D 2KLVA 5CCHC 2AXCA 4XFJA 1NTMK 5AW7B 1AQTA 3V5BA 4HB1A 2YO2A 2Z5IA 1SQBG 3P32A 1OVRA 2NPSD 1JY2P 2Y9YA 1LT9B 2W83C 3WUVA 5AW4B 2YKOA 3AEGC 2JDIH 3WU2H 1PFIA 1IJDB 1WMKA 1ZR4A 2VRSA 3NMDA 2IYPA 5APUA 3Q3DA 2IFMA 1S1CX 2N9BA 1N7SC 3RBXA 4Y99B 2NZ2A 2K88A 1PIXA 3AEFC 3RK2D 1OW8A 1JMBA 1LTIC 1NHLA 2KS1A 2YXRB 1YJWP 3LIDA 2HPCA 4XA4A 2QVAA 2Y0CA 3Q1MA 2WWWA 2KXPB 3E7KA 2KZJA 2O1KA 3VTPC 5KLIB 4DT0A 4EOTA 3V2QA 2HG5D 2V4HA 1KYOD 2V7QJ 1OX3A 3G9RA 4I7ZB 3GW6A 1AQ5A 4GIFA 1YYCA 2FYZA 4IL6E 5AVXB 1GL2A 1HWTC 1KB9H 1PP9E 2FYNC 4Y99C 1GMJA 2OYHC 1NTZG 4GODA 5APYA 3RGUA 3OJAB 1KILA 1LWUC 1E5WA 1M8OB 2QEXP 5CMZA 1BGYG 1OZHA 3JCUE 1JY2O 4JYCA 2K9JA 1RHZB 1NTMG 2J5UA 3FX0A 2KIKA 3H1JG 3L71G 1X22A 4I7ZC 3TDKA 1Z56A 1FDMA 3M91A 1EDKA 4UB6H 1M1JA 4IFDK 2IBZE 3TGUD 2JJLA 1QX8A 3CXHE 3F89A 3AE3C 2E76B 1U57A 3L73J 1CW5A 1KMIZ 1EDLA 5DJTB 2BEZF 3HD7B 2A06D 1SFCB 3PRJA 1GW3A 2W90A 1QEXA 2H8PD 2YMYA 1M1KQ 2UWJE 4IL6H 1DD3A 1BE3J 1EXJA 1VQLP 3L71D 5B5EE 4GDOA 1IC2A 3M0AA 2H89C 1JOCA 2KLUA 1VF5B 2ZJSE 1RY3A 1USEA 2RH0A 1VQ6P 3LIEA 1OW6A 1XTGB 2OTLP 1FE6A 3A7OA 3JCUH 3UIAA 4JPZB 2E42A 5AVTB 1X79B 2ZT9C 1WRGA 3GG2A 2KUBA 2B87A 2BCCE 2FYUJ 3BCCJ 1JTHB 1SFCC 1IFPA 1JNMA 1AVOA 2IBZI 1LTSC 1OMIA 1N86A 2C9LY 3CXHH 1N73C 1KQSO 2WSCH 1BCCE 1JY3P 3H1KE 1ZMEC 1FZCB 2IX7C 3E1IA 3SWKA 4C7NB 1IK9A 4K3AA 3R4YA 4Y28J 2KK7A 2WQYC 4I6MC 3KPEA 2AXTE 3TF5A 4AQRD 2W27A 5B5EH 4U3FE 3V4QA 2LKMA 4H44D 1JO5A 2O1JA 3CI9A 1NGMB 4N6JA 1JUNA 2K3RA 1TU3F 3L74J 2WITA 1SQQE 5TJHA 2OYIC 4WY4C 4YXWH 1N8RQ 1CSBA 2JWDA 1CI6A 1HBWA 2OARA 1FBMA 3HE4B 1FZCC 3PH0A 1JY3N 4YPCA 4PV1D 1P84I 1DD4A 3CWBJ 5CCGC 1T2KC 1W5CE 1PP9D 3BCCD 1SQQK 2IBZG 1GDTA 4LGDE 1L4AC 4YXDC 1NTKE 3N7NA 2Q1KA 3CCVP 2N1TB 1KC8Q 4ASVA 1KILD 2H7HA 1K8AQ 2AXTH 3B5NC 1T8ZA 1L0LG 3CCEP 2ZVNB 3L75J 5APXA 1URQA 4W7YA 1DEEG 4L73A 1JY3O 2JKVA 1NTKK 5CCHA 2IBZD 4H13C 3L72J 2P10A 5L8RJ 4H0LB 1VQ9P 4JQ0D 4NPDA 2KOGA 1T2KD 1CI6B 2E75D 1GK6A 4ZKPA 3FWNA 2WSEH 4WVZA 1VQKP 2FXOA 3CPWO 5CHXA 2BCCG 3NXSA 2WZ7A 5BVZA 4PJ0E 4BXLA 2NPSB 3TSIA 1J1DC 5AVWB 3WUUA 4OGQD 1BCCG 3H1KG 4IFMA 4HJGH 4C7RA 2KI7B 2SPZA 5KTBA 1EDJA 3H1LJ 3CMEP 2FKWB 2Y9ZA 1S9KD 4WB4A 2ZFCA 1X9VA 1FS0E 2KSEA 1RE4C 4H13D 2HYNA 2BCCD 1QLED 4U3FG 1LT9A 3IR9A 1KFMA 4RJTA 4RKUJ 1P84D 1IO4A 3L75D 3RK2B 3G6EP 2JEEA 1VQMP 4GOFA 1DEBA 3FXEA 3TGUE 1SQQG 1RE3C 2NPSC 3L35A 3BASA 2P58A 3L72D 1FJKA 2CK3H 2WSFH 1KZUB 1KYOH 5KKZC 2CPBA 3ZDMA 2A06E 2M8RA 3TNUB 4W7ZA 3PHLA 1L2PA 1RF1C 3NTNA 3CCUP 2R32A 4PJ0H 2XNXA 2E74D 3I5CA 1HF9A 5KAIE 2W6AA 1SQPK 3VMZA 1VQNP 2HLOA 1KORA 2IYOA 5AVSB 5AVQB 2WT7B 1LGHB 1LTJC 3GF7A 2A45H 3RK2C 3HE5B 3CL3D 1N7SB 3PTZA 1Q90D 2FXPA 1SQVJ 3A3YB 2OYOA 2D2CD 1U7JA 1R8EA 3CCLP 1UIXA 1RF0C 1PZQA 5APVA 1NAYA 1VQ4P 1GZLA 1NTKD 4K35A 4M3LA 1VQ5P 3QH9A 2W8ZA 3AEDC 2KSJA 4QMAA 2OGUA 2WSSH 1HH0A 3U1AA 3LW5J 2B89A 2H88C 2IPPA 3AE4C 5KJ7A 3TYYA 3W67A 1S5LX 2FYNB 1J2JB 5TISE 2OYHB 2R3CA 2V7QH 1FDIA 1VQOP 2OQQA 1LWUB 3B4SA 2N9YB 1IZNB 5KAIH 1SQPJ 1BE3E 1EXIA 3GHGB 3CC7P 2C0WA 4XE5B 4EDFA 2A45G 3RL0D 1OFCX 3A5TA 2ZYAA 3BVHA 3H1IJ 2XU6A 1OXZA 2GUVA 4ZNCA 3HD7A 1KFNA 5AW6B 1SFCA 2YXQB 2QE7H 5AW9B 2QJYC 3D70A 2GM4A 3BCCE 2R44A 2WTYA 2YMKA 3TGUG 3H1JJ 2R3SA 4EI2A 1ZP0C 2J59M 2FFDC 2YKPA 3GHGC 2H43A 2JR8A 1L0NJ 4A7PA 1UIIA 1FZEA 3AE8C 2A06G 2DW3A 1KILE 2P7JA 2B88A 4OVNF 5TISH 3MIWA 1HGVA 3VP8A 3ITKA 2FYUK 1JTHA 3FXDA 1S2EA 1T3JA 3KYQA 5BU8B 2PAJA 1LNQA 2IFNA 1SQPD 3HTKB 1FZCA 2ZT9B 4KJMA 4GOEA 2KB7P 4C7NA 3EWKA 3Q5SA 2XDJA 1FDOA 4L75A 2I1KA 2Z5HA 1PPJD 3H1ID 5CCGA 3CMAP 1NU1J 2XZRA 2KP8A 1N73B 1SQXJ 2FBWC 2QIWA 1G2CB 2IDBA 3H32B 1FZAA 3GMAA 3CWBE 5AVZB 1K04A 3NFQA 1J1EC 4H44C 1BDDA 1AFOA 5C39A 1IFJA 3HUSB 2QM8A 3HE4A 1S9KE 1FU1A 1L0ND 1IFIA 1LJ2A 2I1JA 1JM0A 4OH8B 1QVGO 3AE7C 3IAOA 1P84E 1BE3G 3MD0A 3L75E 5K5GB 2OYIB 5CJ4A 4WY4B 3RK3D 2WPRA 5AVRB 4RESB 3U1CA 4AUWA 1NWQA 4DJGA 2QRXA 4PV1C 1G1JA 2N1TA 3L72E 1NYHA 1YTZI 2KZIA 3L73D 3G71P 2CPSA 4KT0J 3CCQP 1LP1B 3S4RA 1FZFA 1GL2C 2O01J 2NRGA 1YJNP 3HUSC 2YNYA 1MFTA 3CCRP 1KQFB 1L4AB 1PP9G 1NU1D 1KILC 3BCCG 1AV1A 3MUDC 1BE3D 1NO4A 2QSIA 1SQXD 1Y9BA 1QL1A 1NOHA 2B9BA 3B5NB 3H1HJ 1RE4A 1GU5A 4U7JA 5KLVJ 2ITAA 1M57D 2WSCJ 4TT3H 2JWAA 3IF4A 3AEBC 3AEEC 3H1LE 2E76D 1NH4A 3S9OA 1D7MA 3HD7D 4H13B 2E75C 2NPSA 1P84H 2M5AB 2FYUD 3I56P 2Q6QA 3PP5A 1L0LJ 1H0TB 3II6A 3CCSP 3Q5PA 1GL2D 5KAFE 1GU4A 1VF5D 2QM7A 2RMZA 3A0BE 1S72P 4OGQC 2KNCB 2W6BA 5AVYB 2R5BA 1J1DB 1AVYA 1ZV8A 2HR3A 1VL2A 3T97B 2RN0A 4IL6X 1YI2P 3CLQA 3KDPB 1OWAA 5GTIE 1SLQA 1CZQA 3CWBG 4R4MA 2E74B 2I8DA 1EC5A 3QWOC 1W2EA 3CX5I 2MJZA 3K5BA 3L74D 3N4XA 1BCCJ 4OWFA 3TNUA 3H1HD 1Q2NA 5CBNA 1HJ0A 1OVUA 2BASA 1MZ9A 5KLVD 2JP3A 3OA7A 4BWNA 1SQVE 1VQPP 1PL5A 3L75G 4D6TJ 2PFXA 3CWBD 1PGOA 3VOPA 2WT7A 3D6ZA 2QJPB 3MP7B 5KAFH 5KKZB 3L72G 3HE5A 1N7SA 1DIPA 2E74C 4HKZH 1RF1B 2AEJA 3P8MC 3V4WA 1K9MQ 1SQVK 3IFMA 1YTZT 3EFFK 3AE2C 3ABVC 3O6QB 2XNDH 1LTJB 3RBZA 5GTIH 3AE1C 3O8ZA 3CC2P 3SFDC 3M9BA 4IFFA 3P7KA 1LTGC 1HJBA 1A02J 5CJ0A 2P67A 3M0DC 2D2CC 3L36A 1SQPE 3USSA 4CPGA 5AW8B 2Q7CA 3RL0B 4BRYB 3V2NA 2QJPC 2QA4P 3C9IA 3SWFA 3H1LG 2Y0EA 1PPJE 3OAKA 2G3AA 3H1IE 3L70J 2N1TD 5AW1B 2OYHA 3MZWB 4WWIA 1FOSF 2Y0DA 1LWUA 3MHVA 1SQBJ 1NKZB 3GHGA 1S4XA 1JB0J 4D6TD 3V6IA 1ZXGA 1NTKG 2M0BA 2KYVA 2ZYGA 3FWLA 1HVVA 3H1JE 1HTLC 4IOIH 1NTZK 3CX5D 1HGZA 2ZXXA 3G3ZA 1X0TA 1IFMA 3H1LD 1L0NE 1GW4A 2GA1A 4H0LD 4JBZA 1URQC 3RL0C 4I2LC 3V2PA 3OW2O 3P8CE 1KQGB 1ZN5A 3LW5H 4N78D 5B66E 2K37A 4GKGA 3CD6P 3RK3E 3D71A 1YQ4C 2FXMA 4EYYQ 3U59A 2E5TA 2WPVB 2LXBA 3KQGA 1VQ7P 1H8AA 1E79H 2RKLA 1L0NK 3E1RA 3PLNA 1KN7A 1OVVA 1KB9E 2QJYB 3L73E 1ZR2A 1SS1A 3HRNA 4HH2A 1A02F 1SQVG 2WMMA 5AVVB 3L70D 1KD1Q 1NU1E 2YKQA 3R2PA 3VP9A 1EZVE 2FFDB 3VN0A 1HUCA 1SQXE 4W80A 1SQBD 1URQD 3HTKA 4O9BA 1X8YA 1NTZJ 5CCHD 1ZRTD 1FAVA 3TGUJ 3EQ2A 3JSVC 3L37A 1FZGA 1JMMA 4UB6E 1U7MA 1LT9C 2O01N 1AA0A 4LLHA 1BGYJ 3H6PA 1JY2N 1NU1K 4PD4D 2E43A 1SQVD 2Q5UA 3G4SP 5B66H 1N73A 1YIJP 1SQXK 1G2CA 1NTMJ 2FYUE 3H32A 3BATA 1VQ8P 3MGNA 1NJIQ 3L71J 3GLMA 1QL2A 1SQPG 2FY8A 2ZAEB 3RK3B 1M90Q 4C46A 4ZKUA 5E79E 2G8YA 3BRVB 1KB9I 4ASWA 1SVFA 4JF7A 3HUSA 2LR2A 2PP6A 1YJ9P 1PPJG 3H1IG 3KZIE 2WPSA 2AEMA 1JEKA 1N7SD 3S1KA 1GD2E 3MUDA 5EFWB 4B86A 1IFDA 5AW3B 3AE6C 1R5SA 3M9HA 1S3JA 3MTUE 1EZVI 1JCCA 2ZVOB 1YITP 2MKVA 2QG4A 2OYIA 4WY4A 5KLIC 1J1EB 2GUSA 4H44B 4HYTB 1LTBC 1YBKA 3L74E 2KS1B 3WUTA 3F5HA 4YTPC 3RK3C 2HPCB 3TK1A 1L0NG 1NTZD 4EIJA 3H1HE 1LP1A 4L76A 1NVOA 5KLVE 3VMYA 1BGYD 1LTAC 3KXDA 1BDCA 1L4AA 4DZOA 4AYCA 2M3BA 1Q86Q 4PV1B 3A2AA 1Q82Q 2C0XA 3IN6A 1NKNA 4DCKA 1NTMD 1RH5B 2WPQA 3B8EB 2K9YA 1Y8AA 1L0LE 5E79H 3H1JD 3B5NA 3CCJP 1GL2B 5APWA 5KJ7C 5KLVK 3KZIH 3L73G 2POHA 5CBOA 5AW2B 2K1AA 1KILB 3P8CD 3VYIA 3I55P 2BEQD 1K05A 1NU1G 3L4FA 2O01H 2M5AA 3AEAC 4RO0A 1EZVG 3M06A 3PJSK 1L0LK 2K9JB 1SQXG 2E76C 1H0TA
chains in the Genus database with same CATH topology
4CPGA 1S3JA 4HB1A 1MFTA 4ZMDA 1SS1A 2JWDA 2I8DA 2WMMA 4NPFX 1OVRA 1EC5A 3QWOC 3PH0A 4GODA 3RGUA 4ZNCA 4BXLA 4MN4C 1LT1A 2LXCB 3MZWB 4WWIA 2KS1B 1Q2NA 3MHVA 1EDIA 4HJGH 5CBNA 1OVUA 2KUBA 2B87A 2KI7B 1ZW0A 2SPZA 1EDJA 1LP1A 1NVOA 2R44A 5DJUB 1ZXGA 2M0BA 1U7JA 1BDDA 2Q1KA 1U7MA 2KIKA 5C39A 1BDCA 4IOIH 4ASVA 1X0TA 2M5AB 1EDKA 1Y47A 1JM0A 4JBZA 4HKZH 1JMBA 4K3AA 1H0TB 4K35A 4GOFA 4NPEA 3FXEA 2B88A 2OTKE 2QVAA 1DEEG 5K5GB 2KZJA 2ZAEB 1EDLA 3FXDA 2B89A 2P58A 5DJTB 5CBOA 4ASWA 4EYYQ 2QRXA 1FC2C 2LR2A 3ZDMA 2LXBA 2HR3A 2UWJE 4NPDA 2M5AA 2RKLA 2K3RA 2KZIA 3S1KA 2B87B 5EFWB 4KJMA 1OVVA 4GOEA 1LP1B 1H0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CPG A;  1S3J A;  4HB1 A;  1MFT A;  4ZMD A;  1SS1 A;  2JWD A;  2I8D A;  2WMM A;  4NPF X;  1OVR A;  1EC5 A;  3QWO C;  3PH0 A;  4GOD A;  3RGU A;  4ZNC A;  4BXL A;  4MN4 C;  1LT1 A;  2LXC B;  3MZW B;  4WWI A;  2KS1 B;  1Q2N A;  3MHV A;  1EDI A;  4HJG H;  5CBN A;  1OVU A;  2KUB A;  2B87 A;  2KI7 B;  1ZW0 A;  2SPZ A;  1EDJ A;  1LP1 A;  1NVO A;  2R44 A;  5DJU B;  1ZXG A;  2M0B A;  1U7J A;  1BDD A;  2Q1K A;  1U7M A;  2KIK A;  5C39 A;  1BDC A;  4IOI H;  4ASV A;  1X0T A;  2M5A B;  1EDK A;  1Y47 A;  1JM0 A;  4JBZ A;  4HKZ H;  1JMB A;  4K3A A;  1H0T B;  4K35 A;  4GOF A;  4NPE A;  3FXE A;  2B88 A;  2OTK E;  2QVA A;  1DEE G;  5K5G B;  2KZJ A;  2ZAE B;  1EDL A;  3FXD A;  2B89 A;  2P58 A;  5DJT B;  5CBO A;  4ASW A;  4EYY Q;  2QRX A;  1FC2 C;  2LR2 A;  3ZDM A;  2LXB A;  2HR3 A;  2UWJ E;  4NPD A;  2M5A A;  2RKL A;  2K3R A;  2KZI A;  3S1K A;  2B87 B;  5EFW B;  4KJM A;  1OVV A;  4GOE A;  1LP1 B;  1H0T A; 
#chains in the Genus database with same CATH topology
 2PGD A;  2M3E A;  1KQL A;  4ZMD A;  1PP9 J;  3HD7 C;  3W68 A;  1KB9 D;  1FOS E;  4MN4 C;  2Z4E A;  1LT1 A;  1LTT C;  3CCM P;  2KNC A;  1M1J B;  3CXH I;  2E75 B;  4I1L A;  3C1L A;  1VF5 C;  1PGJ A;  3T97 A;  1H89 A;  1PV3 A;  3BRT B;  2FYU G;  2XKM A;  3V2R A;  2AEF A;  1EZV D;  5APT A;  5KJ7 D;  2L91 A;  1XTC C;  1GTW A;  4D6T E;  3Q5R A;  1Q7Y Q;  2O3J A;  1FZB A;  4OGQ B;  2IZ1 A;  1FJP A;  2WVR A;  1K73 Q;  2P2U A;  3CX5 E;  3CC4 P;  2R5D A;  3A0H E;  4TLF A;  2ZT9 D;  4NPE A;  3AE9 C;  2OTK E;  2QJK B;  4N78 E;  1M1J C;  3WMM 0;  3M0D A;  1WT6 A;  4DOJ A;  1SFC D;  1IK7 A;  1RE3 A;  1T6A A;  2J58 A;  2XV5 A;  3D6Y A;  4GT1 A;  1H88 A;  1S5L E;  2B87 B;  1VPC A;  2C9N Y;  1ZLL A;  2L5G B;  3L74 G;  1RF1 A;  1KV4 A;  1GK4 A;  3H1H G;  5M1B A;  1G1I A;  3AEC C;  5KLV G;  2Q3E A;  3O6Q A;  2LXC B;  3EFG A;  3L70 E;  1LTJ A;  2IZ0 A;  5H2F E;  1QGK B;  2QJK C;  2BCC J;  1DH3 A;  1NAF A;  4Z1M H;  2P1J A;  5AW0 B;  2YIU B;  5AW5 B;  3AE5 C;  1SQB E;  3VMA A;  5GTH E;  1SP4 A;  1N7L A;  5DJU B;  3JC2 2;  4BRY A;  3CX5 H;  4WY4 D;  1USD A;  1DX7 A;  1ZRT E;  1W2B O;  3A0H H;  5APQ A;  3H1K J;  3RL0 g;  1T3U A;  4N3Y B;  3SFE C;  1ZOY C;  3M9Q A;  2OTJ P;  4UB8 E;  3CXH D;  1OIP A;  1Y47 A;  4JYB A;  1RF0 A;  4PD4 E;  1RQV A;  4R4L A;  1MUU A;  5CCG D;  2D2C B;  3H25 A;  1Q81 Q;  1KYO E;  1SQB K;  1N2D C;  4U3F J;  2N1T C;  1S5L H;  3Q2Y A;  3GF3 A;  5BU5 A;  1L4A D;  1L0L D;  2HOD A;  1FC2 C;  4WBA A;  3FGA D;  2YIU C;  3A0B H;  2E5Y A;  1SQQ J;  3KHU A;  1OW7 A;  2YO3 A;  3B5N D;  1RQU A;  2WSE J;  1R5L A;  5H2F H;  4NPF X;  1EQ7 A;  3SSU A;  1MV8 A;  1M7L A;  1PGP A;  4D6T G;  4H0L C;  1MKM A;  1BSN A;  2HFE D;  1JCD A;  2W6J H;  5GTH H;  1EDI A;  1URQ B;  1KTM A;  1PGQ A;  1ZW0 A;  2ZYD A;  1VDF A;  5AVU B;  1NTK J;  1NTZ E;  3C8V A;  4UB8 H;  3WU2 E;  3B71 A;  4PD4 I;  4L74 A;  1BCC D;  3H1K D;  4PD4 H;  4KHX A;  1AJY A;  1BGY E;  1KYO I;  2JO1 A;  2Q9I A;  2FFD A;  2Q3I A;  5APS A;  1YHQ P;  1NTM E;  1YQ3 C;  3SWY A;  2HOD B;  4LC1 A;  4U3F D;  3VMX A;  3L71 E;  1BSH A;  2ZXE B;  1QVF O;  1IFN A;  2A45 I;  1MFZ A;  2WSF J;  1SQQ D;  3L70 G;  2PRR A;  1M56 D;  2KLV A;  5CCH C;  2AXC A;  4XFJ A;  1NTM K;  5AW7 B;  1AQT A;  3V5B A;  4HB1 A;  2YO2 A;  2Z5I A;  1SQB G;  3P32 A;  1OVR A;  2NPS D;  1JY2 P;  2Y9Y A;  1LT9 B;  2W83 C;  3WUV A;  5AW4 B;  2YKO A;  3AEG C;  2JDI H;  3WU2 H;  1PFI A;  1IJD B;  1WMK A;  1ZR4 A;  2VRS A;  3NMD A;  2IYP A;  5APU A;  3Q3D A;  2IFM A;  1S1C X;  2N9B A;  1N7S C;  3RBX A;  4Y99 B;  2NZ2 A;  2K88 A;  1PIX A;  3AEF C;  3RK2 D;  1OW8 A;  1JMB A;  1LTI C;  1NHL A;  2KS1 A;  2YXR B;  1YJW P;  3LID A;  2HPC A;  4XA4 A;  2QVA A;  2Y0C A;  3Q1M A;  2WWW A;  2KXP B;  3E7K A;  2KZJ A;  2O1K A;  3VTP C;  5KLI B;  4DT0 A;  4EOT A;  3V2Q A;  2HG5 D;  2V4H A;  1KYO D;  2V7Q J;  1OX3 A;  3G9R A;  4I7Z B;  3GW6 A;  1AQ5 A;  4GIF A;  1YYC A;  2FYZ A;  4IL6 E;  5AVX B;  1GL2 A;  1HWT C;  1KB9 H;  1PP9 E;  2FYN C;  4Y99 C;  1GMJ A;  2OYH C;  1NTZ G;  4GOD A;  5APY A;  3RGU A;  3OJA B;  1KIL A;  1LWU C;  1E5W A;  1M8O B;  2QEX P;  5CMZ A;  1BGY G;  1OZH A;  3JCU E;  1JY2 O;  4JYC A;  2K9J A;  1RHZ B;  1NTM G;  2J5U A;  3FX0 A;  2KIK A;  3H1J G;  3L71 G;  1X22 A;  4I7Z C;  3TDK A;  1Z56 A;  1FDM A;  3M91 A;  1EDK A;  4UB6 H;  1M1J A;  4IFD K;  2IBZ E;  3TGU D;  2JJL A;  1QX8 A;  3CXH E;  3F89 A;  3AE3 C;  2E76 B;  1U57 A;  3L73 J;  1CW5 A;  1KMI Z;  1EDL A;  5DJT B;  2BEZ F;  3HD7 B;  2A06 D;  1SFC B;  3PRJ A;  1GW3 A;  2W90 A;  1QEX A;  2H8P D;  2YMY A;  1M1K Q;  2UWJ E;  4IL6 H;  1DD3 A;  1BE3 J;  1EXJ A;  1VQL P;  3L71 D;  5B5E E;  4GDO A;  1IC2 A;  3M0A A;  2H89 C;  1JOC A;  2KLU A;  1VF5 B;  2ZJS E;  1RY3 A;  1USE A;  2RH0 A;  1VQ6 P;  3LIE A;  1OW6 A;  1XTG B;  2OTL P;  1FE6 A;  3A7O A;  3JCU H;  3UIA A;  4JPZ B;  2E42 A;  5AVT B;  1X79 B;  2ZT9 C;  1WRG A;  3GG2 A;  2KUB A;  2B87 A;  2BCC E;  2FYU J;  3BCC J;  1JTH B;  1SFC C;  1IFP A;  1JNM A;  1AVO A;  2IBZ I;  1LTS C;  1OMI A;  1N86 A;  2C9L Y;  3CXH H;  1N73 C;  1KQS O;  2WSC H;  1BCC E;  1JY3 P;  3H1K E;  1ZME C;  1FZC B;  2IX7 C;  3E1I A;  3SWK A;  4C7N B;  1IK9 A;  4K3A A;  3R4Y A;  4Y28 J;  2KK7 A;  2WQY C;  4I6M C;  3KPE A;  2AXT E;  3TF5 A;  4AQR D;  2W27 A;  5B5E H;  4U3F E;  3V4Q A;  2LKM A;  4H44 D;  1JO5 A;  2O1J A;  3CI9 A;  1NGM B;  4N6J A;  1JUN A;  2K3R A;  1TU3 F;  3L74 J;  2WIT A;  1SQQ E;  5TJH A;  2OYI C;  4WY4 C;  4YXW H;  1N8R Q;  1CSB A;  2JWD A;  1CI6 A;  1HBW A;  2OAR A;  1FBM A;  3HE4 B;  1FZC C;  3PH0 A;  1JY3 N;  4YPC A;  4PV1 D;  1P84 I;  1DD4 A;  3CWB J;  5CCG C;  1T2K C;  1W5C E;  1PP9 D;  3BCC D;  1SQQ K;  2IBZ G;  1GDT A;  4LGD E;  1L4A C;  4YXD C;  1NTK E;  3N7N A;  2Q1K A;  3CCV P;  2N1T B;  1KC8 Q;  4ASV A;  1KIL D;  2H7H A;  1K8A Q;  2AXT H;  3B5N C;  1T8Z A;  1L0L G;  3CCE P;  2ZVN B;  3L75 J;  5APX A;  1URQ A;  4W7Y A;  1DEE G;  4L73 A;  1JY3 O;  2JKV A;  1NTK K;  5CCH A;  2IBZ D;  4H13 C;  3L72 J;  2P10 A;  5L8R J;  4H0L B;  1VQ9 P;  4JQ0 D;  4NPD A;  2KOG A;  1T2K D;  1CI6 B;  2E75 D;  1GK6 A;  4ZKP A;  3FWN A;  2WSE H;  4WVZ A;  1VQK P;  2FXO A;  3CPW O;  5CHX A;  2BCC G;  3NXS A;  2WZ7 A;  5BVZ A;  4PJ0 E;  4BXL A;  2NPS B;  3TSI A;  1J1D C;  5AVW B;  3WUU A;  4OGQ D;  1BCC G;  3H1K G;  4IFM A;  4HJG H;  4C7R A;  2KI7 B;  2SPZ A;  5KTB A;  1EDJ A;  3H1L J;  3CME P;  2FKW B;  2Y9Z A;  1S9K D;  4WB4 A;  2ZFC A;  1X9V A;  1FS0 E;  2KSE A;  1RE4 C;  4H13 D;  2HYN A;  2BCC D;  1QLE D;  4U3F G;  1LT9 A;  3IR9 A;  1KFM A;  4RJT A;  4RKU J;  1P84 D;  1IO4 A;  3L75 D;  3RK2 B;  3G6E P;  2JEE A;  1VQM P;  4GOF A;  1DEB A;  3FXE A;  3TGU E;  1SQQ G;  1RE3 C;  2NPS C;  3L35 A;  3BAS A;  2P58 A;  3L72 D;  1FJK A;  2CK3 H;  2WSF H;  1KZU B;  1KYO H;  5KKZ C;  2CPB A;  3ZDM A;  2A06 E;  2M8R A;  3TNU B;  4W7Z A;  3PHL A;  1L2P A;  1RF1 C;  3NTN A;  3CCU P;  2R32 A;  4PJ0 H;  2XNX A;  2E74 D;  3I5C A;  1HF9 A;  5KAI E;  2W6A A;  1SQP K;  3VMZ A;  1VQN P;  2HLO A;  1KOR A;  2IYO A;  5AVS B;  5AVQ B;  2WT7 B;  1LGH B;  1LTJ C;  3GF7 A;  2A45 H;  3RK2 C;  3HE5 B;  3CL3 D;  1N7S B;  3PTZ A;  1Q90 D;  2FXP A;  1SQV J;  3A3Y B;  2OYO A;  2D2C D;  1U7J A;  1R8E A;  3CCL P;  1UIX A;  1RF0 C;  1PZQ A;  5APV A;  1NAY A;  1VQ4 P;  1GZL A;  1NTK D;  4K35 A;  4M3L A;  1VQ5 P;  3QH9 A;  2W8Z A;  3AED C;  2KSJ A;  4QMA A;  2OGU A;  2WSS H;  1HH0 A;  3U1A A;  3LW5 J;  2B89 A;  2H88 C;  2IPP A;  3AE4 C;  5KJ7 A;  3TYY A;  3W67 A;  1S5L X;  2FYN B;  1J2J B;  5TIS E;  2OYH B;  2R3C A;  2V7Q H;  1FDI A;  1VQO P;  2OQQ A;  1LWU B;  3B4S A;  2N9Y B;  1IZN B;  5KAI H;  1SQP J;  1BE3 E;  1EXI A;  3GHG B;  3CC7 P;  2C0W A;  4XE5 B;  4EDF A;  2A45 G;  3RL0 D;  1OFC X;  3A5T A;  2ZYA A;  3BVH A;  3H1I J;  2XU6 A;  1OXZ A;  2GUV A;  4ZNC A;  3HD7 A;  1KFN A;  5AW6 B;  1SFC A;  2YXQ B;  2QE7 H;  5AW9 B;  2QJY C;  3D70 A;  2GM4 A;  3BCC E;  2R44 A;  2WTY A;  2YMK A;  3TGU G;  3H1J J;  2R3S A;  4EI2 A;  1ZP0 C;  2J59 M;  2FFD C;  2YKP A;  3GHG C;  2H43 A;  2JR8 A;  1L0N J;  4A7P A;  1UII A;  1FZE A;  3AE8 C;  2A06 G;  2DW3 A;  1KIL E;  2P7J A;  2B88 A;  4OVN F;  5TIS H;  3MIW A;  1HGV A;  3VP8 A;  3ITK A;  2FYU K;  1JTH A;  3FXD A;  1S2E A;  1T3J A;  3KYQ A;  5BU8 B;  2PAJ A;  1LNQ A;  2IFN A;  1SQP D;  3HTK B;  1FZC A;  2ZT9 B;  4KJM A;  4GOE A;  2KB7 P;  4C7N A;  3EWK A;  3Q5S A;  2XDJ A;  1FDO A;  4L75 A;  2I1K A;  2Z5H A;  1PPJ D;  3H1I D;  5CCG A;  3CMA P;  1NU1 J;  2XZR A;  2KP8 A;  1N73 B;  1SQX J;  2FBW C;  2QIW A;  1G2C B;  2IDB A;  3H32 B;  1FZA A;  3GMA A;  3CWB E;  5AVZ B;  1K04 A;  3NFQ A;  1J1E C;  4H44 C;  1BDD A;  1AFO A;  5C39 A;  1IFJ A;  3HUS B;  2QM8 A;  3HE4 A;  1S9K E;  1FU1 A;  1L0N D;  1IFI A;  1LJ2 A;  2I1J A;  1JM0 A;  4OH8 B;  1QVG O;  3AE7 C;  3IAO A;  1P84 E;  1BE3 G;  3MD0 A;  3L75 E;  5K5G B;  2OYI B;  5CJ4 A;  4WY4 B;  3RK3 D;  2WPR A;  5AVR B;  4RES B;  3U1C A;  4AUW A;  1NWQ A;  4DJG A;  2QRX A;  4PV1 C;  1G1J A;  2N1T A;  3L72 E;  1NYH A;  1YTZ I;  2KZI A;  3L73 D;  3G71 P;  2CPS A;  4KT0 J;  3CCQ P;  1LP1 B;  3S4R A;  1FZF A;  1GL2 C;  2O01 J;  2NRG A;  1YJN P;  3HUS C;  2YNY A;  1MFT A;  3CCR P;  1KQF B;  1L4A B;  1PP9 G;  1NU1 D;  1KIL C;  3BCC G;  1AV1 A;  3MUD C;  1BE3 D;  1NO4 A;  2QSI A;  1SQX D;  1Y9B A;  1QL1 A;  1NOH A;  2B9B A;  3B5N B;  3H1H J;  1RE4 A;  1GU5 A;  4U7J A;  5KLV J;  2ITA A;  1M57 D;  2WSC J;  4TT3 H;  2JWA A;  3IF4 A;  3AEB C;  3AEE C;  3H1L E;  2E76 D;  1NH4 A;  3S9O A;  1D7M A;  3HD7 D;  4H13 B;  2E75 C;  2NPS A;  1P84 H;  2M5A B;  2FYU D;  3I56 P;  2Q6Q A;  3PP5 A;  1L0L J;  1H0T B;  3II6 A;  3CCS P;  3Q5P A;  1GL2 D;  5KAF E;  1GU4 A;  1VF5 D;  2QM7 A;  2RMZ A;  3A0B E;  1S72 P;  4OGQ C;  2KNC B;  2W6B A;  5AVY B;  2R5B A;  1J1D B;  1AVY A;  1ZV8 A;  2HR3 A;  1VL2 A;  3T97 B;  2RN0 A;  4IL6 X;  1YI2 P;  3CLQ A;  3KDP B;  1OWA A;  5GTI E;  1SLQ A;  1CZQ A;  3CWB G;  4R4M A;  2E74 B;  2I8D A;  1EC5 A;  3QWO C;  1W2E A;  3CX5 I;  2MJZ A;  3K5B A;  3L74 D;  3N4X A;  1BCC J;  4OWF A;  3TNU A;  3H1H D;  1Q2N A;  5CBN A;  1HJ0 A;  1OVU A;  2BAS A;  1MZ9 A;  5KLV D;  2JP3 A;  3OA7 A;  4BWN A;  1SQV E;  1VQP P;  1PL5 A;  3L75 G;  4D6T J;  2PFX A;  3CWB D;  1PGO A;  3VOP A;  2WT7 A;  3D6Z A;  2QJP B;  3MP7 B;  5KAF H;  5KKZ B;  3L72 G;  3HE5 A;  1N7S A;  1DIP A;  2E74 C;  4HKZ H;  1RF1 B;  2AEJ A;  3P8M C;  3V4W A;  1K9M Q;  1SQV K;  3IFM A;  1YTZ T;  3EFF K;  3AE2 C;  3ABV C;  3O6Q B;  2XND H;  1LTJ B;  3RBZ A;  5GTI H;  3AE1 C;  3O8Z A;  3CC2 P;  3SFD C;  3M9B A;  4IFF A;  3P7K A;  1LTG C;  1HJB A;  1A02 J;  5CJ0 A;  2P67 A;  3M0D C;  2D2C C;  3L36 A;  1SQP E;  3USS A;  4CPG A;  5AW8 B;  2Q7C A;  3RL0 B;  4BRY B;  3V2N A;  2QJP C;  2QA4 P;  3C9I A;  3SWF A;  3H1L G;  2Y0E A;  1PPJ E;  3OAK A;  2G3A A;  3H1I E;  3L70 J;  2N1T D;  5AW1 B;  2OYH A;  3MZW B;  4WWI A;  1FOS F;  2Y0D A;  1LWU A;  3MHV A;  1SQB J;  1NKZ B;  3GHG A;  1S4X A;  1JB0 J;  4D6T D;  3V6I A;  1ZXG A;  1NTK G;  2M0B A;  2KYV A;  2ZYG A;  3FWL A;  1HVV A;  3H1J E;  1HTL C;  4IOI H;  1NTZ K;  3CX5 D;  1HGZ A;  2ZXX A;  3G3Z A;  1X0T A;  1IFM A;  3H1L D;  1L0N E;  1GW4 A;  2GA1 A;  4H0L D;  4JBZ A;  1URQ C;  3RL0 C;  4I2L C;  3V2P A;  3OW2 O;  3P8C E;  1KQG B;  1ZN5 A;  3LW5 H;  4N78 D;  5B66 E;  2K37 A;  4GKG A;  3CD6 P;  3RK3 E;  3D71 A;  1YQ4 C;  2FXM A;  4EYY Q;  3U59 A;  2E5T A;  2WPV B;  2LXB A;  3KQG A;  1VQ7 P;  1H8A A;  1E79 H;  2RKL A;  1L0N K;  3E1R A;  3PLN A;  1KN7 A;  1OVV A;  1KB9 E;  2QJY B;  3L73 E;  1ZR2 A;  1SS1 A;  3HRN A;  4HH2 A;  1A02 F;  1SQV G;  2WMM A;  5AVV B;  3L70 D;  1KD1 Q;  1NU1 E;  2YKQ A;  3R2P A;  3VP9 A;  1EZV E;  2FFD B;  3VN0 A;  1HUC A;  1SQX E;  4W80 A;  1SQB D;  1URQ D;  3HTK A;  4O9B A;  1X8Y A;  1NTZ J;  5CCH D;  1ZRT D;  1FAV A;  3TGU J;  3EQ2 A;  3JSV C;  3L37 A;  1FZG A;  1JMM A;  4UB6 E;  1U7M A;  1LT9 C;  2O01 N;  1AA0 A;  4LLH A;  1BGY J;  3H6P A;  1JY2 N;  1NU1 K;  4PD4 D;  2E43 A;  1SQV D;  2Q5U A;  3G4S P;  5B66 H;  1N73 A;  1YIJ P;  1SQX K;  1G2C A;  1NTM J;  2FYU E;  3H32 A;  3BAT A;  1VQ8 P;  3MGN A;  1NJI Q;  3L71 J;  3GLM A;  1QL2 A;  1SQP G;  2FY8 A;  2ZAE B;  3RK3 B;  1M90 Q;  4C46 A;  4ZKU A;  5E79 E;  2G8Y A;  3BRV B;  1KB9 I;  4ASW A;  1SVF A;  4JF7 A;  3HUS A;  2LR2 A;  2PP6 A;  1YJ9 P;  1PPJ G;  3H1I G;  3KZI E;  2WPS A;  2AEM A;  1JEK A;  1N7S D;  3S1K A;  1GD2 E;  3MUD A;  5EFW B;  4B86 A;  1IFD A;  5AW3 B;  3AE6 C;  1R5S A;  3M9H A;  1S3J A;  3MTU E;  1EZV I;  1JCC A;  2ZVO B;  1YIT P;  2MKV A;  2QG4 A;  2OYI A;  4WY4 A;  5KLI C;  1J1E B;  2GUS A;  4H44 B;  4HYT B;  1LTB C;  1YBK A;  3L74 E;  2KS1 B;  3WUT A;  3F5H A;  4YTP C;  3RK3 C;  2HPC B;  3TK1 A;  1L0N G;  1NTZ D;  4EIJ A;  3H1H E;  1LP1 A;  4L76 A;  1NVO A;  5KLV E;  3VMY A;  1BGY D;  1LTA C;  3KXD A;  1BDC A;  1L4A A;  4DZO A;  4AYC A;  2M3B A;  1Q86 Q;  4PV1 B;  3A2A A;  1Q82 Q;  2C0X A;  3IN6 A;  1NKN A;  4DCK A;  1NTM D;  1RH5 B;  2WPQ A;  3B8E B;  2K9Y A;  1Y8A A;  1L0L E;  5E79 H;  3H1J D;  3B5N A;  3CCJ P;  1GL2 B;  5APW A;  5KJ7 C;  5KLV K;  3KZI H;  3L73 G;  2POH A;  5CBO A;  5AW2 B;  2K1A A;  1KIL B;  3P8C D;  3VYI A;  3I55 P;  2BEQ D;  1K05 A;  1NU1 G;  3L4F A;  2O01 H;  2M5A A;  3AEA C;  4RO0 A;  1EZV G;  3M06 A;  3PJS K;  1L0L K;  2K9J B;  1SQX G;  2E76 C;  1H0T A; 
#chains in the Genus database with same CATH homology
 4CPG A;  1S3J A;  4HB1 A;  1MFT A;  4ZMD A;  1SS1 A;  2JWD A;  2I8D A;  2WMM A;  4NPF X;  1OVR A;  1EC5 A;  3QWO C;  3PH0 A;  4GOD A;  3RGU A;  4ZNC A;  4BXL A;  4MN4 C;  1LT1 A;  2LXC B;  3MZW B;  4WWI A;  2KS1 B;  1Q2N A;  3MHV A;  1EDI A;  4HJG H;  5CBN A;  1OVU A;  2KUB A;  2B87 A;  2KI7 B;  1ZW0 A;  2SPZ A;  1EDJ A;  1LP1 A;  1NVO A;  2R44 A;  5DJU B;  1ZXG A;  2M0B A;  1U7J A;  1BDD A;  2Q1K A;  1U7M A;  2KIK A;  5C39 A;  1BDC A;  4IOI H;  4ASV A;  1X0T A;  2M5A B;  1EDK A;  1Y47 A;  1JM0 A;  4JBZ A;  4HKZ H;  1JMB A;  4K3A A;  1H0T B;  4K35 A;  4GOF A;  4NPE A;  3FXE A;  2B88 A;  2OTK E;  2QVA A;  1DEE G;  5K5G B;  2KZJ A;  2ZAE B;  1EDL A;  3FXD A;  2B89 A;  2P58 A;  5DJT B;  5CBO A;  4ASW A;  4EYY Q;  2QRX A;  1FC2 C;  2LR2 A;  3ZDM A;  2LXB A;  2HR3 A;  2UWJ E;  4NPD A;  2M5A A;  2RKL A;  2K3R A;  2KZI A;  3S1K A;  2B87 B;  5EFW B;  4KJM A;  1OVV A;  4GOE A;  1LP1 B;  1H0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...