1EC5A

Crystal structure of four-helix bundle model
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
48
structure length
48
Chain Sequence
DYLRELLKLELQLIKQYREALEYVKLPVLAKILEDEEKHIEWLETILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inaugural article: retrostructural analysis of metalloproteins: application to the design of a minimal model for diiron proteins.
pubmed doi rcsb
molecule tags De novo protein
molecule keywords PROTEIN (FOUR-HELIX BUNDLE MODEL)
total genus 20
structure length 48
sequence length 48
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2000-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1ec5A00
1LT1A 2ZAEB 1X0TA 4HJGH 1NVOA 1S3JA 2KZJA 4K3AA 5CBOA 2B87B 2R44A 2I8DA 2KUBA 1LP1B 3QWOC 2K3RA 2JWDA 1MFTA 1U7MA 4WWIA 2M5AB 1ZW0A 5C39A 4CPGA 2QRXA 1OVRA 4NPFX 1OVVA 4K35A 2KS1B 2OTKE 3FXDA 3MHVA 2M0BA 2LXCB 4EYYQ 4NPDA 4MN4C 3FXEA 2M5AA 2SPZA 1LP1A 1JM0A 1FC2C 3MZWB 1EDIA 4HB1A 4GOEA 2P58A 1ZXGA 1EC5A 1U7JA 5DJUB 4GOFA 4ASVA 4ZNCA 1BDDA 4ASWA 4GODA 2KIKA 5DJTB 2KI7B 2HR3A 2Q1KA 2LR2A 3RGUA 1Q2NA 2WMMA 1EDJA 2B89A 4KJMA 3ZDMA 1H0TA 4IOIH 3S1KA 2UWJE 2RKLA 2LXBA 4ZMDA 2KZIA 1EDKA 3PH0A 4NPEA 1JMBA 2B87A 1OVUA 1SS1A 1DEEG 2QVAA 4JBZA 5CBNA 2B88A 5EFWB 1EDLA 1BDCA 1Y47A 4BXLA 1H0TB 4HKZH 5K5GB
chains in the Genus database with same CATH superfamily
5CCHC 1LT1A 1X0TA 3H1LJ 1PGPA 2QJYB 1IFPA 2IDBA 1NVOA 1S3JA 3OA7A 4JPZB 4W7YA 5AVTB 3CCUP 1IO4A 2WITA 2YKQA 3BRTB 3IAOA 3AE4C 3Q5SA 4DT0A 1SLQA 3GHGC 1KB9E 3L72J 3HE4A 5CBOA 3F89A 2B87B 1EZVI 2P1JA 3M0AA 5KLVE 1GU4A 1X9VA 1Y9BA 3H1HJ 1Q81Q 2A45I 3EQ2A 1Z56A 1LTTC 2Q5UA 2AEMA 3QWOC 1LT9A 3E1IA 1VPCA 3G71P 4D6TE 1KILD 3ABVC 5APUA 2C0XA 2K9JB 1KYOI 1Y8AA 3MUDC 3R2PA 4IFDK 3RBZA 2M5AB 5B66E 3H1JE 4N78D 2KNCA 3CCJP 2BEQD 2E75D 3E1RA 3H1KD 4WY4A 3SWYA 3ITKA 3L75E 4JYCA 1YTZT 3L72E 2WWWA 3BRVB 1OVRA 3Q3DA 1RF1C 1JY2O 2KXPB 3GW6A 3RL0B 5GTIH 2WPVB 2OQQA 1IFJA 2KS1B 4IFMA 3C1LA 4OVNF 1LWUB 5CMZA 3R4YA 2XZRA 5KJ7D 1NTKK 2J58A 1YTZI 3A0BE 4HH2A 1LTJB 1QVGO 1VDFA 2QJKB 4EI2A 1VQLP 1J1EB 3L75G 1EZVE 1RE3A 3V2QA 5BVZA 1LT9C 4WY4C 3VP9A 1LTBC 2ZVOB 1NAFA 3CX5I 1GK6A 1NU1G 2K9JA 1FU1A 4JF7A 5APTA 3UIAA 2O3JA 3VN0A 3HUSC 3JCUH 4LGDE 3FXEA 3HRNA 5KKZB 2IPPA 2SPZA 2YMKA 2KNCB 1A02F 2A06E 1JCDA 4Y28J 2Z5HA 2K88A 1FJKA 1M1JC 3MZWB 2KOGA 1KB9D 1L0LG 2KB7P 2ZYAA 3A0HH 1VF5C 1EZVG 1FZCB 1N73B 1SQBJ 2R5DA 4W80A 3B71A 1BE3G 3L71D 4PV1C 1NTZD 3BVHA 3LW5J 1RE3C 1RY3A 1L0LD 4GOEA 1LWUA 3V4WA 1BSHA 2RMZA 1VQMP 3L70J 1SFCD 1LTIC 1SQXK 5AW0B 4YXWH 3KQGA 1YBKA 1SQPD 3L71J 4IFFA 1VQ7P 3TNUB 5L8RJ 1RQVA 1SQPK 3TSIA 1KMIZ 1SQXD 4HYTB 4ASVA 1J2JB 3SFEC 3CXHH 1MKMA 3VYIA 3Q5PA 3MP7B 1SVFA 4GODA 3VTPC 1PFIA 1N7SA 2ZXXA 1NTZK 5AW5B 3H1LG 1K9MQ 1M90Q 3H32B 1USEA 3SSUA 3H1HD 3I55P 2C9NY 1HWTC 4QMAA 4R4LA 3V6IA 5BU8B 1W2BO 2A45G 2Q1KA 1QL1A 1E5WA 2Q3EA 4Y99C 1T3JA 2FYNC 2BEZF 3CCMP 1ZR4A 2WQYC 1LTSC 2FYUE 2QJPC 2QE7H 5CJ4A 2WMMA 4L75A 2B89A 1FZBA 3CXHE 1LJ2A 2O01H 3L73D 1SFCA 3B5NA 4L74A 2QIWA 3PRJA 4KT0J 2XU6A 3CX5D 4U3FE 5APVA 1JNMA 4KJMA 4DCKA 1LTJC 1SQVJ 2M3EA 1NTMG 3RK2C 2FFDC 1H0TA 3L73G 3B8EB 1FZGA 4ZKUA 1IJDB 1VQKP 3L70E 1KYOD 4EOTA 1UIIA 2M3BA 5APYA 1SQXE 1IFNA 1MZ9A 1NTMD 1SQQK 2WSCJ 3H1IG 2B9BA 3TGUJ 4ZMDA 2YXQB 3VMZA 3W68A 3SWKA 4N6JA 1ZP0C 3TK1A 2WT7A 1JCCA 3PH0A 4NPEA 1Q7YQ 3CX5H 1BGYG 1YQ4C 3A5TA 1OVUA 1VQOP 1S9KE 3HUSA 3H1HE 3EFFK 3CCSP 5EFWB 1PP9E 3A0BH 5AW4B 1M1JA 1FAVA 1BDCA 3GHGA 3G9RA 4C46A 2FFDB 3L75J 4OGQC 1H0TB 4OGQD 3BATA 3IR9A 2E75C 3AECC 2XV5A 4C7NB 4PJ0E 3MD0A 3CX5E 2ZAEB 5CJ0A 3V5BA 1M56D 1EZVD 2ZYDA 1VQ9P 4U3FD 1NYHA 2KZJA 1LTGC 1BCCD 2ZT9D 4O9BA 2IBZE 2J59M 3II6A 4K3AA 2XNDH 1XTGB 3KZIE 1FZFA 1EXJA 3M0DC 1P84E 5KAFE 1BSNA 1R5LA 3D6ZA 4AYCA 4JQ0D 3TF5A 4AUWA 2I8DA 1HGZA 1BE3J 1NTME 1QVFO 3B5NC 2O1KA 1YYCA 2R5BA 1KQSO 3CD6P 4IL6H 1HTLC 2JWDA 4DJGA 3BASA 3FGAD 2CPSA 1M7LA 3NFQA 1ZRTD 1MFTA 1NTZJ 2HFED 2HODB 1U57A 1L4AC 1W2EA 3AE3C 1OXZA 3FX0A 3I5CA 2FYUJ 3LIEA 2KK7A 2E5YA 4WWIA 4C7NA 5CCGD 1KN7A 1YITP 3BCCJ 4UB8E 3IN6A 1URQA 1YIJP 1AVYA 1SQPG 1JTHA 4CPGA 2BASA 3H25A 4W7ZA 1CI6B 2QRXA 2XNXA 3P8CE 3WUUA 1OW7A 1ZOYC 2M8RA 3O6QA 1EXIA 3CCVP 2IBZD 3AE9C 4H0LC 1CW5A 1SQBD 3M91A 3U1CA 3L35A 3MUDA 2XDJA 1N7SB 1JY3O 1RE4A 2M0BA 2RH0A 5KKZC 3CCEP 5TISH 2WPRA 1HBWA 4D6TG 1NKZB 4I7ZC 1YHQP 2LXCB 1FZCA 2J5UA 1KD1Q 2NPSA 1PP9G 4NPDA 1KV4A 1SQVG 2Y0DA 4MN4C 3AE5C 1LP1A 2FYNB 3L73J 3EWKA 4N3YB 4D6TD 1HF9A 1LT9B 1OZHA 1SFCB 2CPBA 1HVVA 3L4FA 3Q1MA 1GD2E 1T8ZA 1WT6A 3CCRP 1H8AA 1OX3A 5AVRB 3O6QB 3H1HG 3M9HA 3M9QA 1KC8Q 5H2FE 1KQLA 1USDA 3AE1C 3AE7C 1MUUA 1QEXA 3L72D 3TYYA 1BGYJ 2E76B 1SQQD 3L75D 3JC22 1ZXGA 3HD7C 3PP5A 4RO0A 3CMAP 2XKMA 1IZNB 1GMJA 2GUSA 1ZRTE 2WSFH 3FWLA 3AEBC 3H1KG 1JY3P 4BRYA 2Y9ZA 2Q9IA 3GG2A 2WT7B 1JY2N 3M06A 2AXTH 2H88C 3G3ZA 3N7NA 3TDKA 2QM7A 1FDIA 2ZT9C 1DX7A 1BDDA 5AVUB 2N1TB 2FXPA 1Q82Q 2FY8A 3WUVA 1VQNP 5AW1B 2V7QJ 3CI9A 3U59A 1YQ3C 4XA4A 1NTZE 3A7OA 2H8PD 4I6MC 4GDOA 2LR2A 4DZOA 3RGUA 1GL2D 1GTWA 1Q2NA 4UB6H 3KZIH 1SQBK 2FKWB 2WSEH 3V2NA 2JEEA 2HG5D 3N4XA 1KFNA 1EDJA 3GLMA 2YKPA 2FYUK 3C8VA 3KPEA 3KHUA 1FOSF 1KORA 1AVOA 2K1AA 4H13C 3RK3C 2QJKC 2KSJA 1RHZB 1GL2B 1SQPE 2W27A 1S5LH 2UWJE 2RKLA 1NOHA 1E79H 1GK4A 2QM8A 1AQTA 3L74J 2KZIA 1SQPJ 2W6AA 1T2KC 1SQBG 3AEAC 2YXRB 4L76A 1FOSE 1JB0J 1VQ8P 2C9LY 3MGNA 2YIUC 1ZN5A 2Q3IA 1SS1A 1HH0A 1DEEG 1SP4A 1GDTA 2BCCD 2L91A 3L70G 4L73A 4I7ZB 1YJWP 1BE3D 1S5LE 2FYZA 3L71G 5CBNA 1CI6A 2N1TC 2OYIC 1EDLA 1OW8A 3LW5H 1Y47A 3RK2B 3AE2C 1R5SA 2IFMA 3IF4A 5APQA 5K5GB 3L73E 3CWBJ 2K37A 4LLHA 2H89C 1QL2A 1IFDA 2ITAA 3PTZA 1OWAA 4D6TJ 3HE5B 1AV1A 2KP8A 2ZYGA 2OYHA 1NTKE 1RF0C 5APXA 3SFDC 1BGYD 1HGVA 2MKVA 1PIXA 5AVVB 3T97B 1GU5A 3PLNA 1AFOA 1X79B 1X22A 2V4HA 2Y0EA 2R44A 3USSA 1YI2P 3NMDA 4XFJA 1L2PA 1PGJA 2E74C 2KUBA 1LP1B 2Q7CA 1JMMA 1WRGA 2PRRA 5B5EH 1N73C 3B4SA 1VQPP 4GIFA 5KAIE 2N9YB 2OTLP 4BWNA 4PV1D 4PD4D 1IK9A 2KLVA 3H1IE 1ZLLA 3H1KJ 1NJIQ 1G2CB 1U7MA 1H88A 2AXTE 1ZW0A 5C39A 5CCGC 3HUSB 2H43A 2H7HA 1N7SD 1N7SC 3AEDC 3V2PA 2OYHC 2BCCE 4BRYB 3CXHI 5KAIH 1N73A 1NAYA 1VF5B 4WY4D 3HE4B 1X8YA 3OAKA 4GT1A 1FZCC 1L0NG 2P2UA 1P84D 3GF3A 4K35A 2ZFCA 5M1BA 1L4AA 3F5HA 1FZEA 2OTKE 3EFGA 3FXDA 3MHVA 1NH4A 1SQQJ 2O1JA 1G1IA 3TNUA 1JOCA 4EYYQ 1KILE 2R32A 1LNQA 2IZ0A 1GZLA 4PJ0H 3L74D 2GA1A 2W83C 2FBWC 5KJ7C 3VOPA 2M5AA 2JWAA 3WU2H 2IYOA 1JO5A 2NZ2A 3H1JD 1R8EA 4B86A 1VQ4P 1J1DB 3AEFC 2E5TA 1GL2C 2O01N 1MV8A 1NTKJ 4U3FJ 2KLUA 2WTYA 1YJNP 1XTCC 2QA4P 2FYUD 5CCHA 2KS1A 3HTKB 1NGMB 5APWA 2HPCB 1JTHB 5AW9B 1H89A 1TU3F 1KB9I 2A06G 1FJPA 3WU2E 2O01J 1EC5A 1KILC 1NTZG 1U7JA 2VRSA 1CSBA 4RESB 5AVSB 1M1KQ 2YNYA 2HPCA 2CK3H 4I1LA 2BCCG 1IC2A 2QJYC 2A06D 3A0HE 3BCCG 3L70D 4UB8H 4TT3H 1BE3E 1DEBA 1T3UA 2IBZI 5AVWB 3V2RA 3W67A 1T2KD 3MTUE 1OW6A 3CWBG 2KIKA 3KXDA 1ZV8A 3RK2D 1SQXJ 4OGQB 1Q90D 1PL5A 4YXDC 3BCCD 1FBMA 2OTJP 1K73Q 5DJTB 1S2EA 3D70A 2YO2A 1N7LA 2D2CB 1NTKD 2KI7B 3CWBD 4KHXA 3MIWA 4OWFA 2IZ1A 1RH5B 2ZT9B 1S72P 1GW4A 3D6YA 1VL2A 1G1JA 3HTKA 1DD3A 3CC7P 1SQVD 5TISE 3HE5A 4IL6X 2ZXEB 3AE6C 1IK7A 5B5EE 1PP9J 1T6AA 1SQVK 1K04A 5APSA 3ZDMA 2E74D 3RBXA 3CPWO 1JY3N 2AEJA 1PZQA 5AVXB 1RF0A 4PV1B 3CL3D 4H13B 2JP3A 3RK3E 3S1KA 3TGUE 2OYHB 1URQC 1D7MA 1PP9D 2LXBA 4PD4E 2MJZA 1VQ6P 4AQRD 3CXHD 2OYIB 3H32A 2W6BA 1SFCC 1EDKA 4LC1A 5AW8B 2QEXP 2WSSH 3LIDA 5H2FH 4Y99B 1KTMA 4WB4A 1JMBA 2Y0CA 2QJPB 4OH8B 2E42A 3PJSK 5GTIE 1KQFB 1KYOH 2PFXA 5KLVD 1BCCE 3AE8C 1VF5D 3A3YB 3BCCE 3QH9A 1NHLA 2NPSD 4WY4B 3WMM0 1NU1E 3WUTA 1P84H 3V4QA 1L4AD 1SQQG 3L36A 3M0DA 3SWFA 2HODA 1RE4C 2WPQA 1QX8A 3P7KA 2C0WA 4HKZH 5GTHE 5KTBA 4U7JA 1S1CX 2OARA 1NU1J 2V7QH 2FXOA 3VMXA 1M8OB 4IL6E 1N8RQ 3JCUE 2NPSC 2NRGA 4HJGH 3CLQA 3RL0g 2N9BA 3RK3B 1W5CE 4H44D 1SQVE 3VMYA 1IFMA 3NTNA 3Q2YA 1S9KD 1L0LJ 2QSIA 2WPSA 3E7KA 3PHLA 4U3FG 1BCCJ 2HYNA 4RKUJ 1FDMA 2OGUA 5BU5A 2ZJSE 5KLVJ 2Q6QA 3Q5RA 3I56P 5AVQB 3RK3D 2K3RA 3S4RA 2JDIH 1Q86Q 1OMIA 1M1JB 2E76D 1NWQA 4I2LC 1N2DC 3GHGB 3VMAA 2FFDA 2ZVNB 1PV3A 1KFMA 4YPCA 2WSCH 3H1LD 1FZAA 3JSVC 4RJTA 2BCCJ 1NU1D 1KQGB 1QLED 5KAFH 3L74G 1OFCX 2YIUB 1YJ9P 1DD4A 4M3LA 5TJHA 3H1JJ 4DOJA 1L0LE 1LWUC 3H6PA 3OW2O 1J1EC 1SQXG 4NPFX 1L0NK 1OVVA 1PPJE 2DW3A 2L5GB 2N1TD 2Y9YA 3AEEC 3C9IA 3L71E 4H0LB 1ZR2A 5AW6B 1K8AQ 1A02J 2P10A 1PGOA 1RF1B 1SQQE 3U1AA 1KILA 1FE6A 2HLOA 2D2CD 2GM4A 3KDPB 1BGYE 2JR8A 3RL0C 1GW3A 2AXCA 3B5ND 3H1KE 1J1DC 3S9OA 3VP8A 4PD4H 3GF7A 3T97A 1PPJG 5KJ7A 1CZQA 4WBAA 3RL0D 2RN0A 2WSEJ 2D2CC 3H1ID 1NTMK 3K5BA 1NTMJ 2IX7C 5CCHD 1RQUA 1JM0A 1N86A 1NU1K 1SQBE 2OYOA 1JY2P 2AEFA 1FC2C 5CHXA 3H1LE 3NXSA 3B5NB 4WVZA 3L72G 4H13D 1M57D 3H1IJ 1L0ND 3TGUG 3TGUD 2WVRA 5AW3B 3L37A 2W8ZA 1DH3A 2P67A 2I1KA 1EDIA 1FDOA 1G2CA 2JO1A 2G3AA 2FXMA 4HB1A 5E79E 1RF1A 1KILB 2WZ7A 2P58A 2KYVA 1KZUB 2POHA 1KYOE 2E76C 5AW2B 2OYIA 1K05A 3L74E 4C7RA 1AA0A 2IYPA 4EDFA 2E75B 4UB6E 5B66H 1HJ0A 1IFIA 1WMKA 2NPSB 3A2AA 1GL2A 2W90A 3HD7B 4GOFA 5DJUB 2A45H 5KLIC 5GTHH 4A7PA 4ZNCA 1L4AB 2IFNA 4ASWA 1VQ5P 2YO3A 5E79H 4YTPC 1LTJA 4JYBA 2Z4EA 2KSEA 2R3CA 1LTAC 3CCQP 5KLIB 1NO4A 4H44C 4Z1MH 1L0NJ 2HR3A 1FS0E 3HD7D 2E74B 2LKMA 1PGQA 2G8YA 3KYQA 1L0LK 1BCCG 1S4XA 4ZKPA 1JUNA 2W6JH 3FWNA 1L0NE 4PD4I 4XE5B 1OIPA 2QG4A 1MFZA 2JKVA 5KLVG 3CCLP 4GKGA 2PAJA 3M9BA 3CMEP 4R4MA 3HD7A 1UIXA 1AQ5A 4IOIH 5KLVK 2PP6A 2P7JA 3CC2P 1URQD 2FYUG 2N1TA 1S5LX 2PGDA 3P32A 4TLFA 3P8MC 3AEGC 3D71A 1NTKG 5AVYB 5CCGA 2IBZG 1ZMEC 5AVZB 1JEKA 3IFMA 3O8ZA 1DIPA 3H1JG 2E43A 1HJBA 1EQ7A 2B87A 2YMYA 3GMAA 4EIJA 3CC4P 2I1JA 2K9YA 1QGKB 1P84I 2WSFJ 4H0LD 1URQB 2QVAA 4JBZA 1HUCA 2YKOA 5AW7B 1PPJD 3G4SP 2B88A 2GUVA 4N78E 4H44B 1KB9H 3P8CD 3CWBE 2Z5IA 4BXLA 1NKNA 1LGHB 2JJLA 2R3SA 3G6EP 3OJAB 1AJYA
chains in the Genus database with same CATH topology
1LT1A 2ZAEB 1X0TA 4HJGH 1NVOA 1S3JA 2KZJA 4K3AA 5CBOA 2B87B 2R44A 2I8DA 2KUBA 1LP1B 3QWOC 2K3RA 2JWDA 1MFTA 1U7MA 4WWIA 2M5AB 1ZW0A 5C39A 4CPGA 2QRXA 1OVRA 4NPFX 1OVVA 4K35A 2KS1B 2OTKE 3FXDA 3MHVA 2M0BA 2LXCB 4EYYQ 4NPDA 4MN4C 3FXEA 2M5AA 2SPZA 1LP1A 1JM0A 1FC2C 3MZWB 1EDIA 4HB1A 4GOEA 2P58A 1ZXGA 1EC5A 1U7JA 5DJUB 4GOFA 4ASVA 4ZNCA 1BDDA 4ASWA 4GODA 2KIKA 5DJTB 2KI7B 2HR3A 2Q1KA 2LR2A 3RGUA 1Q2NA 2WMMA 1EDJA 2B89A 4KJMA 3ZDMA 1H0TA 4IOIH 3S1KA 2UWJE 2RKLA 2LXBA 4ZMDA 2KZIA 1EDKA 3PH0A 4NPEA 1JMBA 2B87A 1OVUA 1SS1A 1DEEG 2QVAA 4JBZA 5CBNA 2B88A 5EFWB 1EDLA 1BDCA 1Y47A 4BXLA 1H0TB 4HKZH 5K5GB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LT1 A;  2ZAE B;  1X0T A;  4HJG H;  1NVO A;  1S3J A;  2KZJ A;  4K3A A;  5CBO A;  2B87 B;  2R44 A;  2I8D A;  2KUB A;  1LP1 B;  3QWO C;  2K3R A;  2JWD A;  1MFT A;  1U7M A;  4WWI A;  2M5A B;  1ZW0 A;  5C39 A;  4CPG A;  2QRX A;  1OVR A;  4NPF X;  1OVV A;  4K35 A;  2KS1 B;  2OTK E;  3FXD A;  3MHV A;  2M0B A;  2LXC B;  4EYY Q;  4NPD A;  4MN4 C;  3FXE A;  2M5A A;  2SPZ A;  1LP1 A;  1JM0 A;  1FC2 C;  3MZW B;  1EDI A;  4HB1 A;  4GOE A;  2P58 A;  1ZXG A;  1EC5 A;  1U7J A;  5DJU B;  4GOF A;  4ASV A;  4ZNC A;  1BDD A;  4ASW A;  4GOD A;  2KIK A;  5DJT B;  2KI7 B;  2HR3 A;  2Q1K A;  2LR2 A;  3RGU A;  1Q2N A;  2WMM A;  1EDJ A;  2B89 A;  4KJM A;  3ZDM A;  1H0T A;  4IOI H;  3S1K A;  2UWJ E;  2RKL A;  2LXB A;  4ZMD A;  2KZI A;  1EDK A;  3PH0 A;  4NPE A;  1JMB A;  2B87 A;  1OVU A;  1SS1 A;  1DEE G;  2QVA A;  4JBZ A;  5CBN A;  2B88 A;  5EFW B;  1EDL A;  1BDC A;  1Y47 A;  4BXL A;  1H0T B;  4HKZ H;  5K5G B; 
#chains in the Genus database with same CATH topology
 5CCH C;  1LT1 A;  1X0T A;  3H1L J;  1PGP A;  2QJY B;  1IFP A;  2IDB A;  1NVO A;  1S3J A;  3OA7 A;  4JPZ B;  4W7Y A;  5AVT B;  3CCU P;  1IO4 A;  2WIT A;  2YKQ A;  3BRT B;  3IAO A;  3AE4 C;  3Q5S A;  4DT0 A;  1SLQ A;  3GHG C;  1KB9 E;  3L72 J;  3HE4 A;  5CBO A;  3F89 A;  2B87 B;  1EZV I;  2P1J A;  3M0A A;  5KLV E;  1GU4 A;  1X9V A;  1Y9B A;  3H1H J;  1Q81 Q;  2A45 I;  3EQ2 A;  1Z56 A;  1LTT C;  2Q5U A;  2AEM A;  3QWO C;  1LT9 A;  3E1I A;  1VPC A;  3G71 P;  4D6T E;  1KIL D;  3ABV C;  5APU A;  2C0X A;  2K9J B;  1KYO I;  1Y8A A;  3MUD C;  3R2P A;  4IFD K;  3RBZ A;  2M5A B;  5B66 E;  3H1J E;  4N78 D;  2KNC A;  3CCJ P;  2BEQ D;  2E75 D;  3E1R A;  3H1K D;  4WY4 A;  3SWY A;  3ITK A;  3L75 E;  4JYC A;  1YTZ T;  3L72 E;  2WWW A;  3BRV B;  1OVR A;  3Q3D A;  1RF1 C;  1JY2 O;  2KXP B;  3GW6 A;  3RL0 B;  5GTI H;  2WPV B;  2OQQ A;  1IFJ A;  2KS1 B;  4IFM A;  3C1L A;  4OVN F;  1LWU B;  5CMZ A;  3R4Y A;  2XZR A;  5KJ7 D;  1NTK K;  2J58 A;  1YTZ I;  3A0B E;  4HH2 A;  1LTJ B;  1QVG O;  1VDF A;  2QJK B;  4EI2 A;  1VQL P;  1J1E B;  3L75 G;  1EZV E;  1RE3 A;  3V2Q A;  5BVZ A;  1LT9 C;  4WY4 C;  3VP9 A;  1LTB C;  2ZVO B;  1NAF A;  3CX5 I;  1GK6 A;  1NU1 G;  2K9J A;  1FU1 A;  4JF7 A;  5APT A;  3UIA A;  2O3J A;  3VN0 A;  3HUS C;  3JCU H;  4LGD E;  3FXE A;  3HRN A;  5KKZ B;  2IPP A;  2SPZ A;  2YMK A;  2KNC B;  1A02 F;  2A06 E;  1JCD A;  4Y28 J;  2Z5H A;  2K88 A;  1FJK A;  1M1J C;  3MZW B;  2KOG A;  1KB9 D;  1L0L G;  2KB7 P;  2ZYA A;  3A0H H;  1VF5 C;  1EZV G;  1FZC B;  1N73 B;  1SQB J;  2R5D A;  4W80 A;  3B71 A;  1BE3 G;  3L71 D;  4PV1 C;  1NTZ D;  3BVH A;  3LW5 J;  1RE3 C;  1RY3 A;  1L0L D;  4GOE A;  1LWU A;  3V4W A;  1BSH A;  2RMZ A;  1VQM P;  3L70 J;  1SFC D;  1LTI C;  1SQX K;  5AW0 B;  4YXW H;  3KQG A;  1YBK A;  1SQP D;  3L71 J;  4IFF A;  1VQ7 P;  3TNU B;  5L8R J;  1RQV A;  1SQP K;  3TSI A;  1KMI Z;  1SQX D;  4HYT B;  4ASV A;  1J2J B;  3SFE C;  3CXH H;  1MKM A;  3VYI A;  3Q5P A;  3MP7 B;  1SVF A;  4GOD A;  3VTP C;  1PFI A;  1N7S A;  2ZXX A;  1NTZ K;  5AW5 B;  3H1L G;  1K9M Q;  1M90 Q;  3H32 B;  1USE A;  3SSU A;  3H1H D;  3I55 P;  2C9N Y;  1HWT C;  4QMA A;  4R4L A;  3V6I A;  5BU8 B;  1W2B O;  2A45 G;  2Q1K A;  1QL1 A;  1E5W A;  2Q3E A;  4Y99 C;  1T3J A;  2FYN C;  2BEZ F;  3CCM P;  1ZR4 A;  2WQY C;  1LTS C;  2FYU E;  2QJP C;  2QE7 H;  5CJ4 A;  2WMM A;  4L75 A;  2B89 A;  1FZB A;  3CXH E;  1LJ2 A;  2O01 H;  3L73 D;  1SFC A;  3B5N A;  4L74 A;  2QIW A;  3PRJ A;  4KT0 J;  2XU6 A;  3CX5 D;  4U3F E;  5APV A;  1JNM A;  4KJM A;  4DCK A;  1LTJ C;  1SQV J;  2M3E A;  1NTM G;  3RK2 C;  2FFD C;  1H0T A;  3L73 G;  3B8E B;  1FZG A;  4ZKU A;  1IJD B;  1VQK P;  3L70 E;  1KYO D;  4EOT A;  1UII A;  2M3B A;  5APY A;  1SQX E;  1IFN A;  1MZ9 A;  1NTM D;  1SQQ K;  2WSC J;  3H1I G;  2B9B A;  3TGU J;  4ZMD A;  2YXQ B;  3VMZ A;  3W68 A;  3SWK A;  4N6J A;  1ZP0 C;  3TK1 A;  2WT7 A;  1JCC A;  3PH0 A;  4NPE A;  1Q7Y Q;  3CX5 H;  1BGY G;  1YQ4 C;  3A5T A;  1OVU A;  1VQO P;  1S9K E;  3HUS A;  3H1H E;  3EFF K;  3CCS P;  5EFW B;  1PP9 E;  3A0B H;  5AW4 B;  1M1J A;  1FAV A;  1BDC A;  3GHG A;  3G9R A;  4C46 A;  2FFD B;  3L75 J;  4OGQ C;  1H0T B;  4OGQ D;  3BAT A;  3IR9 A;  2E75 C;  3AEC C;  2XV5 A;  4C7N B;  4PJ0 E;  3MD0 A;  3CX5 E;  2ZAE B;  5CJ0 A;  3V5B A;  1M56 D;  1EZV D;  2ZYD A;  1VQ9 P;  4U3F D;  1NYH A;  2KZJ A;  1LTG C;  1BCC D;  2ZT9 D;  4O9B A;  2IBZ E;  2J59 M;  3II6 A;  4K3A A;  2XND H;  1XTG B;  3KZI E;  1FZF A;  1EXJ A;  3M0D C;  1P84 E;  5KAF E;  1BSN A;  1R5L A;  3D6Z A;  4AYC A;  4JQ0 D;  3TF5 A;  4AUW A;  2I8D A;  1HGZ A;  1BE3 J;  1NTM E;  1QVF O;  3B5N C;  2O1K A;  1YYC A;  2R5B A;  1KQS O;  3CD6 P;  4IL6 H;  1HTL C;  2JWD A;  4DJG A;  3BAS A;  3FGA D;  2CPS A;  1M7L A;  3NFQ A;  1ZRT D;  1MFT A;  1NTZ J;  2HFE D;  2HOD B;  1U57 A;  1L4A C;  1W2E A;  3AE3 C;  1OXZ A;  3FX0 A;  3I5C A;  2FYU J;  3LIE A;  2KK7 A;  2E5Y A;  4WWI A;  4C7N A;  5CCG D;  1KN7 A;  1YIT P;  3BCC J;  4UB8 E;  3IN6 A;  1URQ A;  1YIJ P;  1AVY A;  1SQP G;  1JTH A;  4CPG A;  2BAS A;  3H25 A;  4W7Z A;  1CI6 B;  2QRX A;  2XNX A;  3P8C E;  3WUU A;  1OW7 A;  1ZOY C;  2M8R A;  3O6Q A;  1EXI A;  3CCV P;  2IBZ D;  3AE9 C;  4H0L C;  1CW5 A;  1SQB D;  3M91 A;  3U1C A;  3L35 A;  3MUD A;  2XDJ A;  1N7S B;  1JY3 O;  1RE4 A;  2M0B A;  2RH0 A;  5KKZ C;  3CCE P;  5TIS H;  2WPR A;  1HBW A;  4D6T G;  1NKZ B;  4I7Z C;  1YHQ P;  2LXC B;  1FZC A;  2J5U A;  1KD1 Q;  2NPS A;  1PP9 G;  4NPD A;  1KV4 A;  1SQV G;  2Y0D A;  4MN4 C;  3AE5 C;  1LP1 A;  2FYN B;  3L73 J;  3EWK A;  4N3Y B;  4D6T D;  1HF9 A;  1LT9 B;  1OZH A;  1SFC B;  2CPB A;  1HVV A;  3L4F A;  3Q1M A;  1GD2 E;  1T8Z A;  1WT6 A;  3CCR P;  1H8A A;  1OX3 A;  5AVR B;  3O6Q B;  3H1H G;  3M9H A;  3M9Q A;  1KC8 Q;  5H2F E;  1KQL A;  1USD A;  3AE1 C;  3AE7 C;  1MUU A;  1QEX A;  3L72 D;  3TYY A;  1BGY J;  2E76 B;  1SQQ D;  3L75 D;  3JC2 2;  1ZXG A;  3HD7 C;  3PP5 A;  4RO0 A;  3CMA P;  2XKM A;  1IZN B;  1GMJ A;  2GUS A;  1ZRT E;  2WSF H;  3FWL A;  3AEB C;  3H1K G;  1JY3 P;  4BRY A;  2Y9Z A;  2Q9I A;  3GG2 A;  2WT7 B;  1JY2 N;  3M06 A;  2AXT H;  2H88 C;  3G3Z A;  3N7N A;  3TDK A;  2QM7 A;  1FDI A;  2ZT9 C;  1DX7 A;  1BDD A;  5AVU B;  2N1T B;  2FXP A;  1Q82 Q;  2FY8 A;  3WUV A;  1VQN P;  5AW1 B;  2V7Q J;  3CI9 A;  3U59 A;  1YQ3 C;  4XA4 A;  1NTZ E;  3A7O A;  2H8P D;  4I6M C;  4GDO A;  2LR2 A;  4DZO A;  3RGU A;  1GL2 D;  1GTW A;  1Q2N A;  4UB6 H;  3KZI H;  1SQB K;  2FKW B;  2WSE H;  3V2N A;  2JEE A;  2HG5 D;  3N4X A;  1KFN A;  1EDJ A;  3GLM A;  2YKP A;  2FYU K;  3C8V A;  3KPE A;  3KHU A;  1FOS F;  1KOR A;  1AVO A;  2K1A A;  4H13 C;  3RK3 C;  2QJK C;  2KSJ A;  1RHZ B;  1GL2 B;  1SQP E;  2W27 A;  1S5L H;  2UWJ E;  2RKL A;  1NOH A;  1E79 H;  1GK4 A;  2QM8 A;  1AQT A;  3L74 J;  2KZI A;  1SQP J;  2W6A A;  1T2K C;  1SQB G;  3AEA C;  2YXR B;  4L76 A;  1FOS E;  1JB0 J;  1VQ8 P;  2C9L Y;  3MGN A;  2YIU C;  1ZN5 A;  2Q3I A;  1SS1 A;  1HH0 A;  1DEE G;  1SP4 A;  1GDT A;  2BCC D;  2L91 A;  3L70 G;  4L73 A;  4I7Z B;  1YJW P;  1BE3 D;  1S5L E;  2FYZ A;  3L71 G;  5CBN A;  1CI6 A;  2N1T C;  2OYI C;  1EDL A;  1OW8 A;  3LW5 H;  1Y47 A;  3RK2 B;  3AE2 C;  1R5S A;  2IFM A;  3IF4 A;  5APQ A;  5K5G B;  3L73 E;  3CWB J;  2K37 A;  4LLH A;  2H89 C;  1QL2 A;  1IFD A;  2ITA A;  3PTZ A;  1OWA A;  4D6T J;  3HE5 B;  1AV1 A;  2KP8 A;  2ZYG A;  2OYH A;  1NTK E;  1RF0 C;  5APX A;  3SFD C;  1BGY D;  1HGV A;  2MKV A;  1PIX A;  5AVV B;  3T97 B;  1GU5 A;  3PLN A;  1AFO A;  1X79 B;  1X22 A;  2V4H A;  2Y0E A;  2R44 A;  3USS A;  1YI2 P;  3NMD A;  4XFJ A;  1L2P A;  1PGJ A;  2E74 C;  2KUB A;  1LP1 B;  2Q7C A;  1JMM A;  1WRG A;  2PRR A;  5B5E H;  1N73 C;  3B4S A;  1VQP P;  4GIF A;  5KAI E;  2N9Y B;  2OTL P;  4BWN A;  4PV1 D;  4PD4 D;  1IK9 A;  2KLV A;  3H1I E;  1ZLL A;  3H1K J;  1NJI Q;  1G2C B;  1U7M A;  1H88 A;  2AXT E;  1ZW0 A;  5C39 A;  5CCG C;  3HUS B;  2H43 A;  2H7H A;  1N7S D;  1N7S C;  3AED C;  3V2P A;  2OYH C;  2BCC E;  4BRY B;  3CXH I;  5KAI H;  1N73 A;  1NAY A;  1VF5 B;  4WY4 D;  3HE4 B;  1X8Y A;  3OAK A;  4GT1 A;  1FZC C;  1L0N G;  2P2U A;  1P84 D;  3GF3 A;  4K35 A;  2ZFC A;  5M1B A;  1L4A A;  3F5H A;  1FZE A;  2OTK E;  3EFG A;  3FXD A;  3MHV A;  1NH4 A;  1SQQ J;  2O1J A;  1G1I A;  3TNU A;  1JOC A;  4EYY Q;  1KIL E;  2R32 A;  1LNQ A;  2IZ0 A;  1GZL A;  4PJ0 H;  3L74 D;  2GA1 A;  2W83 C;  2FBW C;  5KJ7 C;  3VOP A;  2M5A A;  2JWA A;  3WU2 H;  2IYO A;  1JO5 A;  2NZ2 A;  3H1J D;  1R8E A;  4B86 A;  1VQ4 P;  1J1D B;  3AEF C;  2E5T A;  1GL2 C;  2O01 N;  1MV8 A;  1NTK J;  4U3F J;  2KLU A;  2WTY A;  1YJN P;  1XTC C;  2QA4 P;  2FYU D;  5CCH A;  2KS1 A;  3HTK B;  1NGM B;  5APW A;  2HPC B;  1JTH B;  5AW9 B;  1H89 A;  1TU3 F;  1KB9 I;  2A06 G;  1FJP A;  3WU2 E;  2O01 J;  1EC5 A;  1KIL C;  1NTZ G;  1U7J A;  2VRS A;  1CSB A;  4RES B;  5AVS B;  1M1K Q;  2YNY A;  2HPC A;  2CK3 H;  4I1L A;  2BCC G;  1IC2 A;  2QJY C;  2A06 D;  3A0H E;  3BCC G;  3L70 D;  4UB8 H;  4TT3 H;  1BE3 E;  1DEB A;  1T3U A;  2IBZ I;  5AVW B;  3V2R A;  3W67 A;  1T2K D;  3MTU E;  1OW6 A;  3CWB G;  2KIK A;  3KXD A;  1ZV8 A;  3RK2 D;  1SQX J;  4OGQ B;  1Q90 D;  1PL5 A;  4YXD C;  3BCC D;  1FBM A;  2OTJ P;  1K73 Q;  5DJT B;  1S2E A;  3D70 A;  2YO2 A;  1N7L A;  2D2C B;  1NTK D;  2KI7 B;  3CWB D;  4KHX A;  3MIW A;  4OWF A;  2IZ1 A;  1RH5 B;  2ZT9 B;  1S72 P;  1GW4 A;  3D6Y A;  1VL2 A;  1G1J A;  3HTK A;  1DD3 A;  3CC7 P;  1SQV D;  5TIS E;  3HE5 A;  4IL6 X;  2ZXE B;  3AE6 C;  1IK7 A;  5B5E E;  1PP9 J;  1T6A A;  1SQV K;  1K04 A;  5APS A;  3ZDM A;  2E74 D;  3RBX A;  3CPW O;  1JY3 N;  2AEJ A;  1PZQ A;  5AVX B;  1RF0 A;  4PV1 B;  3CL3 D;  4H13 B;  2JP3 A;  3RK3 E;  3S1K A;  3TGU E;  2OYH B;  1URQ C;  1D7M A;  1PP9 D;  2LXB A;  4PD4 E;  2MJZ A;  1VQ6 P;  4AQR D;  3CXH D;  2OYI B;  3H32 A;  2W6B A;  1SFC C;  1EDK A;  4LC1 A;  5AW8 B;  2QEX P;  2WSS H;  3LID A;  5H2F H;  4Y99 B;  1KTM A;  4WB4 A;  1JMB A;  2Y0C A;  2QJP B;  4OH8 B;  2E42 A;  3PJS K;  5GTI E;  1KQF B;  1KYO H;  2PFX A;  5KLV D;  1BCC E;  3AE8 C;  1VF5 D;  3A3Y B;  3BCC E;  3QH9 A;  1NHL A;  2NPS D;  4WY4 B;  3WMM 0;  1NU1 E;  3WUT A;  1P84 H;  3V4Q A;  1L4A D;  1SQQ G;  3L36 A;  3M0D A;  3SWF A;  2HOD A;  1RE4 C;  2WPQ A;  1QX8 A;  3P7K A;  2C0W A;  4HKZ H;  5GTH E;  5KTB A;  4U7J A;  1S1C X;  2OAR A;  1NU1 J;  2V7Q H;  2FXO A;  3VMX A;  1M8O B;  4IL6 E;  1N8R Q;  3JCU E;  2NPS C;  2NRG A;  4HJG H;  3CLQ A;  3RL0 g;  2N9B A;  3RK3 B;  1W5C E;  4H44 D;  1SQV E;  3VMY A;  1IFM A;  3NTN A;  3Q2Y A;  1S9K D;  1L0L J;  2QSI A;  2WPS A;  3E7K A;  3PHL A;  4U3F G;  1BCC J;  2HYN A;  4RKU J;  1FDM A;  2OGU A;  5BU5 A;  2ZJS E;  5KLV J;  2Q6Q A;  3Q5R A;  3I56 P;  5AVQ B;  3RK3 D;  2K3R A;  3S4R A;  2JDI H;  1Q86 Q;  1OMI A;  1M1J B;  2E76 D;  1NWQ A;  4I2L C;  1N2D C;  3GHG B;  3VMA A;  2FFD A;  2ZVN B;  1PV3 A;  1KFM A;  4YPC A;  2WSC H;  3H1L D;  1FZA A;  3JSV C;  4RJT A;  2BCC J;  1NU1 D;  1KQG B;  1QLE D;  5KAF H;  3L74 G;  1OFC X;  2YIU B;  1YJ9 P;  1DD4 A;  4M3L A;  5TJH A;  3H1J J;  4DOJ A;  1L0L E;  1LWU C;  3H6P A;  3OW2 O;  1J1E C;  1SQX G;  4NPF X;  1L0N K;  1OVV A;  1PPJ E;  2DW3 A;  2L5G B;  2N1T D;  2Y9Y A;  3AEE C;  3C9I A;  3L71 E;  4H0L B;  1ZR2 A;  5AW6 B;  1K8A Q;  1A02 J;  2P10 A;  1PGO A;  1RF1 B;  1SQQ E;  3U1A A;  1KIL A;  1FE6 A;  2HLO A;  2D2C D;  2GM4 A;  3KDP B;  1BGY E;  2JR8 A;  3RL0 C;  1GW3 A;  2AXC A;  3B5N D;  3H1K E;  1J1D C;  3S9O A;  3VP8 A;  4PD4 H;  3GF7 A;  3T97 A;  1PPJ G;  5KJ7 A;  1CZQ A;  4WBA A;  3RL0 D;  2RN0 A;  2WSE J;  2D2C C;  3H1I D;  1NTM K;  3K5B A;  1NTM J;  2IX7 C;  5CCH D;  1RQU A;  1JM0 A;  1N86 A;  1NU1 K;  1SQB E;  2OYO A;  1JY2 P;  2AEF A;  1FC2 C;  5CHX A;  3H1L E;  3NXS A;  3B5N B;  4WVZ A;  3L72 G;  4H13 D;  1M57 D;  3H1I J;  1L0N D;  3TGU G;  3TGU D;  2WVR A;  5AW3 B;  3L37 A;  2W8Z A;  1DH3 A;  2P67 A;  2I1K A;  1EDI A;  1FDO A;  1G2C A;  2JO1 A;  2G3A A;  2FXM A;  4HB1 A;  5E79 E;  1RF1 A;  1KIL B;  2WZ7 A;  2P58 A;  2KYV A;  1KZU B;  2POH A;  1KYO E;  2E76 C;  5AW2 B;  2OYI A;  1K05 A;  3L74 E;  4C7R A;  1AA0 A;  2IYP A;  4EDF A;  2E75 B;  4UB6 E;  5B66 H;  1HJ0 A;  1IFI A;  1WMK A;  2NPS B;  3A2A A;  1GL2 A;  2W90 A;  3HD7 B;  4GOF A;  5DJU B;  2A45 H;  5KLI C;  5GTH H;  4A7P A;  4ZNC A;  1L4A B;  2IFN A;  4ASW A;  1VQ5 P;  2YO3 A;  5E79 H;  4YTP C;  1LTJ A;  4JYB A;  2Z4E A;  2KSE A;  2R3C A;  1LTA C;  3CCQ P;  5KLI B;  1NO4 A;  4H44 C;  4Z1M H;  1L0N J;  2HR3 A;  1FS0 E;  3HD7 D;  2E74 B;  2LKM A;  1PGQ A;  2G8Y A;  3KYQ A;  1L0L K;  1BCC G;  1S4X A;  4ZKP A;  1JUN A;  2W6J H;  3FWN A;  1L0N E;  4PD4 I;  4XE5 B;  1OIP A;  2QG4 A;  1MFZ A;  2JKV A;  5KLV G;  3CCL P;  4GKG A;  2PAJ A;  3M9B A;  3CME P;  4R4M A;  3HD7 A;  1UIX A;  1AQ5 A;  4IOI H;  5KLV K;  2PP6 A;  2P7J A;  3CC2 P;  1URQ D;  2FYU G;  2N1T A;  1S5L X;  2PGD A;  3P32 A;  4TLF A;  3P8M C;  3AEG C;  3D71 A;  1NTK G;  5AVY B;  5CCG A;  2IBZ G;  1ZME C;  5AVZ B;  1JEK A;  3IFM A;  3O8Z A;  1DIP A;  3H1J G;  2E43 A;  1HJB A;  1EQ7 A;  2B87 A;  2YMY A;  3GMA A;  4EIJ A;  3CC4 P;  2I1J A;  2K9Y A;  1QGK B;  1P84 I;  2WSF J;  4H0L D;  1URQ B;  2QVA A;  4JBZ A;  1HUC A;  2YKO A;  5AW7 B;  1PPJ D;  3G4S P;  2B88 A;  2GUV A;  4N78 E;  4H44 B;  1KB9 H;  3P8C D;  3CWB E;  2Z5I A;  4BXL A;  1NKN A;  1LGH B;  2JJL A;  2R3S A;  3G6E P;  3OJA B;  1AJY A; 
#chains in the Genus database with same CATH homology
 1LT1 A;  2ZAE B;  1X0T A;  4HJG H;  1NVO A;  1S3J A;  2KZJ A;  4K3A A;  5CBO A;  2B87 B;  2R44 A;  2I8D A;  2KUB A;  1LP1 B;  3QWO C;  2K3R A;  2JWD A;  1MFT A;  1U7M A;  4WWI A;  2M5A B;  1ZW0 A;  5C39 A;  4CPG A;  2QRX A;  1OVR A;  4NPF X;  1OVV A;  4K35 A;  2KS1 B;  2OTK E;  3FXD A;  3MHV A;  2M0B A;  2LXC B;  4EYY Q;  4NPD A;  4MN4 C;  3FXE A;  2M5A A;  2SPZ A;  1LP1 A;  1JM0 A;  1FC2 C;  3MZW B;  1EDI A;  4HB1 A;  4GOE A;  2P58 A;  1ZXG A;  1EC5 A;  1U7J A;  5DJU B;  4GOF A;  4ASV A;  4ZNC A;  1BDD A;  4ASW A;  4GOD A;  2KIK A;  5DJT B;  2KI7 B;  2HR3 A;  2Q1K A;  2LR2 A;  3RGU A;  1Q2N A;  2WMM A;  1EDJ A;  2B89 A;  4KJM A;  3ZDM A;  1H0T A;  4IOI H;  3S1K A;  2UWJ E;  2RKL A;  2LXB A;  4ZMD A;  2KZI A;  1EDK A;  3PH0 A;  4NPE A;  1JMB A;  2B87 A;  1OVU A;  1SS1 A;  1DEE G;  2QVA A;  4JBZ A;  5CBN A;  2B88 A;  5EFW B;  1EDL A;  1BDC A;  1Y47 A;  4BXL A;  1H0T B;  4HKZ H;  5K5G B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...