1ECMA

Atomic structure of the buried catalytic pocket of escherichia coli chorismate mutase
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
91
structure length
91
Chain Sequence
NPLLALREKISALDEKLLALLAERRELAVEVGKAKLLSHRPVRDIDRERDLLERLITLGKAHHLDAHYITRLFQLIIEDSVLTQQALLQQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ATOMIC-STRUCTURE OF THE BURIED CATALYTIC POCKET OF ESCHERICHIA-COLI CHORISMATE MUTASE.
pubmed rcsb
source organism Escherichia coli
molecule tags Chorismate mutase
molecule keywords ENDO-OXABICYCLIC TRANSITION STATE ANALOGUE
total genus 40
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature ec 4.2.1.51: Prephenate dehydratase.
pdb deposition date 1994-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01817 CM_2 Chorismate mutase type II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.59.10 Mainly Alpha Up-down Bundle Chorismate Mutase Domain, subunit A Chorismate mutase 1ecmA00
2W19C 1YBZA 3HGXA 2D8DA 3NVTA 1ECMA 2QBVA 3TFCA 3RETA 3REMA 2H9DA 3RMIA 2H9CA 5CKXC 2W1AC 2GTVX 3HGWA 2VKLA 2D8EA
chains in the Genus database with same CATH superfamily
1YBZA 2D8DA 3NVTA 1ECMA 3TFCA 3RETA 1WY5A 2H9DA 3A2KA 2H9CA 2GTVX 2D8EA 3HGXA 3REMA 3RMIA 5CKXC 1NI5A 2VKLA 2W19C 2QBVA 2E21A 2W1AC 2E89A 3HGWA
chains in the Genus database with same CATH topology
2W19C 1YBZA 3HGXA 2D8DA 3NVTA 1ECMA 2QBVA 3TFCA 3RETA 3REMA 2H9DA 3RMIA 2H9CA 5CKXC 2W1AC 2GTVX 3HGWA 2VKLA 2D8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W19 C;  1YBZ A;  3HGX A;  2D8D A;  3NVT A;  1ECM A;  2QBV A;  3TFC A;  3RET A;  3REM A;  2H9D A;  3RMI A;  2H9C A;  5CKX C;  2W1A C;  2GTV X;  3HGW A;  2VKL A;  2D8E A; 
#chains in the Genus database with same CATH topology
 1YBZ A;  2D8D A;  3NVT A;  1ECM A;  3TFC A;  3RET A;  1WY5 A;  2H9D A;  3A2K A;  2H9C A;  2GTV X;  2D8E A;  3HGX A;  3REM A;  3RMI A;  5CKX C;  1NI5 A;  2VKL A;  2W19 C;  2QBV A;  2E21 A;  2W1A C;  2E89 A;  3HGW A; 
#chains in the Genus database with same CATH homology
 2W19 C;  1YBZ A;  3HGX A;  2D8D A;  3NVT A;  1ECM A;  2QBV A;  3TFC A;  3RET A;  3REM A;  2H9D A;  3RMI A;  2H9C A;  5CKX C;  2W1A C;  2GTV X;  3HGW A;  2VKL A;  2D8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...