1ECRA

Escherichia coli replication terminator protein (tus) complexed with dna
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
305
structure length
305
Chain Sequence
DLVDRLNTTFRQMEQELAIFAAHLEQHKLLVARVFSLPEVKKEDEHNPLNRIEVKQHLGNDAQSLALRHFRHLFIQQQSENRSSKAAVRLPGVLCYQVDNLSQAALVSHIQHINKLKTTFEHIVTVESELPTAARFEWVHRHLPGLITLNAYRTLTVLHDPATLRFGWANKHIIKNLHRDEVLAQLEKSLKSPRSVAPWTREEWQRKLEREYQDIAALPQNAKLKIKRPVKVQPIARVWYKGDQKQVQHACPTPLIALINRDNGAGVPDVGELLNYDADNVQHRYKPQAQPLRLIIPRLHLYVAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a replication-terminator protein complexed with DNA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Replication/dna
molecule keywords DNA (5'-D(*TP*TP*AP*GP*TP*TP*AP*CP*AP*AP*CP*AP*TP*AP*CP*T)-3
total genus 85
structure length 305
sequence length 305
ec nomenclature
pdb deposition date 1996-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05472 Ter DNA replication terminus site-binding protein (Ter protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.54.10 Alpha Beta 2-Layer Sandwich Replication Terminator Protein; Chain A, domain 2 Replication Terminator Protein; Chain A, domain 2 1ecrA02
3.50.14.10 Alpha Beta 3-Layer(bba) Sandwich Replication Terminator Protein (Tus); Chain A, domain 1 Replication terminator Tus, domain 1 superfamily/Replication terminator Tus 1ecrA01
2I06A 4XR0A 1ECRA 4XR3A 4XR2A 4XR1A 2EWJA 2I05A
chains in the Genus database with same CATH superfamily
2ZZGA 4XR0A 4XR2A 2EWJA 1V7OA 2ZZEA 2I05A 2I06A 2ZTGA 1V4PA 3WQZA 1TKYA 1TKEA 1TJEA 1WNUA 1ECRA 1WXOA 4XR3A 3RHUA 2ZZFA 1TKGA 3RFNA 4XR1A 1QF6A
chains in the Genus database with same CATH topology
2ZZGA 4XR0A 4XR2A 2EWJA 1V7OA 2ZZEA 2I05A 2I06A 2ZTGA 1V4PA 3WQZA 1TKYA 1TKEA 1TJEA 1WNUA 1ECRA 1WXOA 4XR3A 3RHUA 2ZZFA 1TKGA 3RFNA 4XR1A 1QF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I06 A;  4XR0 A;  1ECR A;  4XR3 A;  4XR2 A;  4XR1 A;  2EWJ A;  2I05 A; 
#chains in the Genus database with same CATH topology
 2ZZG A;  4XR0 A;  4XR2 A;  2EWJ A;  1V7O A;  2ZZE A;  2I05 A;  2I06 A;  2ZTG A;  1V4P A;  3WQZ A;  1TKY A;  1TKE A;  1TJE A;  1WNU A;  1ECR A;  1WXO A;  4XR3 A;  3RHU A;  2ZZF A;  1TKG A;  3RFN A;  4XR1 A;  1QF6 A; 
#chains in the Genus database with same CATH homology
 2ZZG A;  4XR0 A;  4XR2 A;  2EWJ A;  1V7O A;  2ZZE A;  2I05 A;  2I06 A;  2ZTG A;  1V4P A;  3WQZ A;  1TKY A;  1TKE A;  1TJE A;  1WNU A;  1ECR A;  1WXO A;  4XR3 A;  3RHU A;  2ZZF A;  1TKG A;  3RFN A;  4XR1 A;  1QF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...