1ECZA

Protease inhibitor ecotin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
142
structure length
142
Chain Sequence
AESVQPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTMMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECOTIN
publication title Crystal structure analyses of uncomplexed ecotin in two crystal forms: implications for its function and stability.
pubmed rcsb
source organism Escherichia coli
molecule tags Protease inhibitor
total genus 14
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03974 Ecotin Ecotin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.550 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1eczA00
1FI8C 4NIYE 1N8OE 1SLWA 1XXFC 4IW4C 1ID5I 1XX9C 1EZUA 1AZZC 1P0SE 2Y6TE 1ECZA 1SLUA 1EZSA 1IFGA 1SLVA 1XXDC 1ECYA 1SLXA
chains in the Genus database with same CATH superfamily
1BD2B 1WZ1H 3PS6A 4MZ3A 2JB6A 1A4JB 1IIKA 2PWGA 5ILTL 1UT1A 1UOLA 3QWRA 4KNSA 5H35B 2KPNA 3Q2CA 1KWKA 2IDFA 3WO4B 5FOBB 1AHWA 2YAFA 4N6RB 4XVUC 3U48A 3MBWA 2H9GB 1PTZA 2Z3FA 5T1DL 4I2XE 4U1KB 3D87B 5EBMB 5AAMC 1A47A 3ATEA 3WSQH 1FZJB 1JN6B 1E4XH 4IDJL 4ZFFA 3K6DA 2NR6A 5EZOL 1VGKB 3O9WD 5GRVK 3RNKA 1A8JH 2FEEL 3SJVA 1DBJL 4IDLA 5HDRA 1QA9A 2EZ0D 2APXA 3DV6B 2WXOA 3O6LL 4O51A 4BSVB 1QR1B 3NFPA 1FNAA 3WNMA 1SJEA 1TETH 3Q1SH 2DMKA 3GMQA 4N2AA 2VISB 1JPEA 4AVJA 1K2DA 5ADPL 1DL7L 5DTFB 2R29H 3HFML 3PGFH 4GMTH 4JO2L 4QT5B 1CGXA 5K9QG 3JWDL 2HPTA 4W9EC 4BUGA 5JW4Q 4F58H 4HZAA 2NW2A 1XH2A 1FG2B 4PREA 1F1AA 2PO6B 1EJ8A 1MUJB 3CDZB 2BMKB 3KEDA 3OZLA 1WBYB 3CFCH 2FEDD 4ZQKB 5GPRA 4F7CB 1Z9SA 4EIUA 3WELA 4R0LA 5FYKD 3VB8A 4L4TA 3QO0B 4OZGB 1RZGB 4QRRA 5A2BA 2RMNA 2L3BA 1S7UA 4PP1D 1F1GA 4I1NB 2E5EA 4PJXA 3HRZB 2XPZA 2JF1A 4P04A 5F1IB 2TSAA 4UIKL 2N7AA 1J5OH 1JF1B 5FO9A 3WKMH 4AIOA 4S1DD 1I7ZB 2QGDA 2DBLH 4D8PA 1SXSA 2GFBB 4HS6A 4NNPL 4XODA 4RAVA 4K9JA 2B2XH 3FN0L 4XMPH 4ZUVA 1BFSA 1VB9A 3BAEH 1OVZA 2ICWI 3KD4A 1MIML 3BAXA 4Y2NA 3WE6B 3MRQB 4YSOA 4ZXBC 3L4CA 4M7ZB 3RWCB 3KPNA 1V7MH 2VDML 1JGVL 4FG6D 4DGWC 3EH1A 2H6PA 4K5OA 4FQHA 4XH2B 4JCMA 1EA9C 2C34A 4FZEH 1PLGL 2BY3A 3T0XA 1BECA 3QFDA 4RAUA 2C7UA 1G7JA 1H6EA 3MREB 4KJYA 4OD3H 4BFIB 2RQEA 1JNLH 3B7SA 4WEBH 3VJ6A 4AQ1B 4HKJA 2VN5A 2PNDA 4G5ZL 4PR5B 4A6YA 1SHMA 4YDIH 2FTAA 1WEJL 3C8DA 2KI6A 4YHZH 1V3KA 1WWCA 2V4LA 5G4NA 3VFVA 5F7UA 4X6EB 5SX5K 3ARGA 3NZHL 4H0HB 4LVOB 2BPBA 2VM3A 4UM9B 1Y6MR 3VXRB 4I18A 4QXGL 4RMTA 5BQDA 4QTHA 1T1YB 3SDCD 1EK3A 1XAUA 2RACA 3U1QA 1P6FA 5KYUA 3B9KD 3JBG7 4JZNB 1IKNA 1SYVA 1I1CA 2H1XA 3BKMH 4NXKA 4P5SA 5BUPA 4KK9D 4RA0C 4HS8L 1TKWB 3FU7A 5D1ZD 2UY6A 2YEVB 3RVUD 2BVQB 1JYXA 4JHWH 2GT9A 4HJIA 4MNGB 3IGKA 4WFEE 5C0DB 3IDUA 3BIKB 3EOAA 3W82A 3MYJA 4M56A 4Z9KB 2AZAA 1ZJBA 5JXEC 3CSGA 3FW6A 2CALA 1NLBL 1UJ3A 5AOLA 2YEZB 4HLJA 2BSDA 4OLVL 4ZT1A 5DJAB 2NYYC 3VG9C 5HI3D 4ZMLA 4E68A 1MY5A 1NUNB 4UCFA 5KSUA 1WIOA 1QZNA 4XCYA 2W88A 2N1KA 1LK3H 2EIZA 3VO0A 4PB0H 2D0GA 2NY3B 4AIXA 4A63A 4PJAE 3UBGA 2PETA 3IDMB 5TH2A 5GISL 3FSWA 2EDLA 1PF3A 1WO2A 1CGVA 1JZDC 3T8VA 2R56L 1UVQA 3ZTEA 1HESA 4G7SB 3V9CA 2AXHA 3I02B 4WHYH 2V5TA 1DQMH 4AVKA 3NCYS 4PVLA 4TXVB 4EN3D 4DUWA 4PFEA 3UTZB 5F89B 5AD0B 5KAQG 2NXZD 5E23A 1EVUA 1GKOA 4G6AD 4P4RA 3E7JA 4PW3A 2OYLA 2VN6A 4JPKH 5H94A 1E9OB 1UKSA 5HD8C 3QIBC 2FJHA 4R4ND 3UTOA 1A4KA 2AV7A 3LOWA 4B96A 2AJXH 4X6DF 1A7OH 4F7EB 3OR6B 3OX8B 3DXAE 4WV1B 2GJ6A 2GUOB 1RZKC 4JO5A 2CRYA 5CGTA 2HH0H 2FRGP 2PKDA 4YXKL 3SO5A 3F7VB 3QDGD 1KCVL 1DSWA 5EBWA 4NKIH 3RDJA 3C08H 3DX9B 3WEXA 3CVIH 2F54E 1RCYA 5GS0D 3WFHA 5FM4A 3ILQD 4ENED 1KACB 4FG2A 1OEZW 2HVBA 3JWNC 3PHQB 5ACZA 2PCPB 1RZIA 2Q6WA 1MQKH 1SYSA 2P8LB 3V0WL 3SE9H 3MBEB 1EJFA 2VZVA 2L7UA 2ZCHH 3OJ2C 4XNYL 3QEGL 5PCYA 1M7UA 1Y0LB 2CDFA 4FCAA 3ARBB 2DWTA 2UZIL 4ODHL 3ZDWA 4D9LL 1GS7A 2MCG1 1OOAA 4V2BA 4QTIH 5DR5H 2IGFL 2WJ7A 2FEEI 3D2TA 3TO4A 5IMLA 3CLEH 3FUFA 2ARJQ 1XO8A 3P4OB 4XO8A 3OLDA 1OTTC 3VQ1C 1N0LA 4LKCA 4WVRA 5I74C 3T9WA 3AREC 5DVNA 1FFOB 5DVKA 4JFVA 3S3JA 5I6OA 2X09A 3U30C 1BOGB 1LE9B 2HX9A 3ES6B 4TQEL 1AY1H 1UH3A 1T0NA 3BMWA 2EXYC 3AY4C 4EI5D 3N3EA 2A5UA 3APNA 3FNKA 4JG0H 4PJ6A 5FDWA 1T0MA 1P2CB 2BNUB 4MBOA 5EPMB 1VENA 2BOCB 1ORQB 2WGXA 2IOOA 4KKZA 3SQBB 2APBA 1KTDB 3O2VH 3ATAA 4OZHA 3U36A 4ZX6A 1PG7L 4Y1AA 4JFYB 4M7JH 3SDAB 2CXKA 3OGCA 4G59C 4ZQTA 3T77A 1WA2X 6TAAA 4DKEL 3ABKB 3PFQA 4LSUH 2Z65C 4F2EA 4K55A 2L04A 5FLUA 1NC4D 4Z95L 5IW3A 4N9OB 1WBZA 4DOHE 1G7PB 3S36L 1FZMA 2OI9C 3FH5A 4LLVA 3WEMA 4BUHA 2V2XB 4WEUD 1AGBA 4RSVA 1ZT4B 2DTMH 3FFDA 1YEGL 3HE7A 4QXUH 5F1SA 3SD2A 3GGWB 1I3RA 4PWJA 5I9QC 3LKQB 3BSGA 5E6RB 2JB5L 5D7KE 5FUCC 4RFNB 2D0HA 4A55A 2IWEA 2C9VA 1RD6A 2O26U 5J1AA 5GGUB 3UP1A 1RMFH 3JXAA 4TNFA 2VLMD 4HUMB 4Y1SA 5HSFA 1QD0A 1B4TA 4JFXB 4DP0X 3BH8A 1M53A 4XR8C 2EDKA 1ZPUA 5BOZG 4GAGL 4BFBD 1LO2H 4I77L 3X11B 5KVDL 2P5ED 3U0WH 1YYML 1UD4A 2CO1A 3GMOB 1KIUA 4DEPB 2APFA 1I1AC 5ENWA 3L81A 4OM0H 3HG2A 4LHJB 3ZT6A 3BWUF 3KLAB 1A9EA 2VLKA 2AANA 3VNYA 2YPVH 1QLRB 1KPUB 5BS0E 5JYMA 4ORGB 3VGAB 3A23A 5M94B 2H1PH 3ZE2E 5DFWH 2IXQB 2NLJB 3BPLB 1CLZH 2X4RA 2WV3A 2VXVL 4J8QA 4UT9A 5CR8A 2HJKB 4N0UA 5AKVA 1F0LA 3IDNB 1HT6A 4I0PD 3ZY7A 3O4OB 1F2XK 3OKDB 5G5DB 5BO1H 4CSPA 4XPAL 5CGBA 1HZKA 5KW9H 1G1OA 2PW2B 5GZOC 3NK4A 2EIEA 2VMCA 4I5BB 3W1ZA 3S5LB 3ZL4H 3KPSA 4KQ4L 5KYXA 3ETBF 1A5FL 5I76B 4PJGA 4Z7UA 5C0CE 2B0SL 4JQIH 3UG4A 4Q7DA 4TLTA 4N8VB 4L1BA 1Z9MA 3NRPA 1IEBB 4IU3B 1WC7A 5LG1A 2XQ0A 4LIQE 4R3SB 3BP4B 4KZCA 4E5XG 4K73A 5CEZH 5IHZB 3OKKA 4PRPA 1GPOL 1H3PL 2KERA 4NKDA 5EOQH 1T03H 2A7BA 4M5YH 2P5WA 4OFYD 2E7MA 2HFFB 4Q52A 2W9EL 2O93L 2MCPL 2UWEB 3JWDC 3SDXB 4EVNB 2O61B 3C09B 1ZXKA 4S1RL 3KM1A 1YG9A 4NPYA 4W70A 4NUQA 3E3QE 1JHLH 5H37G 1AGEB 2R83A 4Q6YA 4JKKA 1F42A 3QJZA 5IW6B 1S7QB 1D6EA 3NESA 3QWQB 2O30A 1ZGLB 3HAEB 1EPFA 3IETB 4HFUH 5AB1A 4LVEA 2BXYA 15C8L 4HKBB 1HWHB 3CFMA 1S7SA 1MCKA 2BOBA 2ZKYA 3GS4A 4GAYB 5GIRB 4YFLF 4AM0B 4DK5A 2ZXQA 5KBLA 2YFOA 3BWAB 2BC4B 3PU7A 4M8QA 1A6VL 4FG4A 2ZX6A 3PWPE 2WBJA 3BGFC 5DGQA 2Y2WA 2VLLB 2IH8A 4PLKD 5DUJA 3ESPA 4XB8A 4C56D 2JTYA 4G6MH 4FFTA 2H7WA 1KXHA 3S34L 4J1UA 4NJ9L 4LSQH 5GXBB 2KUTA 4TS6A 2XA3A 4O9HL 5I6LA 3C6LD 3M1BA 4RZCA 1NH6A 4WI7A 3R1GH 3NSDA 3DVFA 4Q6IC 4IU2B 2HTKD 4RGMC 4AYDC 3CHPA 4WDIB 2WYTA 5IB1A 3Q0HA 4CN1A 4YQXL 4XP9H 4HXBL 2VM9A 2ZJSL 5L0QB 1KLUB 4UUJB 4PS8A 4LGPB 4LVHC 3Q06A 4D0DA 3NJIA 4XI5C 2WY3B 1J8HA 3JV6A 2X5PA 4U1IA 4FFZL 1YEJL 2I32A 3CSTA 3GBMH 3LMJH 3IE9A 1A3LH 4HEPG 1YAIA 3VXOB 4K8RL 3DX1A 4NM8L 4NQTA 1UKQA 3F7RA 5EU6D 2YXVA 3CK0H 1IT9L 3L9YA 4RFEB 4MD5B 5DJYA 5IWLA 1L5GB 3SBPA 4S1SL 3GK8H 4F7TA 2AC0A 1NA8A 1C7SA 1JXKA 1UJTA 3RFZA 1C12A 3SOBL 3UMNA 1P7QB 3L9EA 4KO7A 5LDSA 2FJUB 4XMZA 1GH7A 3VU1A 3NN8A 2ZWKA 3QPXL 1DJHA 2WLMA 2DBJA 1Z7JA 2Q10A 2YPKB 2HCZX 4OUOA 4KAQH 3VD3A 4JG5A 3HB3D 2G2NA 1FAKT 1LE5A 2VW7A 4HG4K 3O6FD 2Z4TA 2WSDA 1EO5A 1NGQH 5L4FA 4OZFH 1UWGH 4HUKB 4N2OA 2EYSB 5D72H 5AVWB 4OCYH 3T3PB 2A99A 2AABH 2G4EA 3DDGA 2FBJH 3O3AA 3JWOH 4NQSA 4HCIA 2HG5A 5E2VH 1BVZA 5IV2A 1BQHG 3CZFB 1FIEA 4LOUD 4FDWA 2PWEA 2DWDA 2R4SH 5D1XB 2XJKA 1S6NA 2DYRB 3GMPA 5B7FA 3BKJL 4OJCA 2XG5A 4W9DC 3VRLF 5DJCA 1IUZA 2GHZA 2YPLB 3KG5A 5ICZB 4IRZH 3FTXA 5TTRA 4U3SB 4X8GA 4GRMB 5A2FA 2VO5A 1FGVH 2EEXA 1YYLL 4B9KC 5MEQA 1KJ2H 1QSEE 1MY7A 3LRLA 3W9DB 3QJSB 5DMKB 4M9OA 4L8SA 5E7FA 1OSZB 2H41A 1FDLL 1XF1A 5DURD 3PQYD 2HFTA 1T20B 2G2PA 5ETUA 2OR8A 5D55A 4E2OA 5J6GB 1CE1H 3F84A 5FV2A 4TUOA 1IE4A 5KS9B 1WA0X 3QR2A 4QRBA 2ICWB 4CW1B 4ODXB 1XH0A 2VQ1A 3WEOA 3HIZA 4MMXA 4ZDHA 5E2TL 1NMBL 2TAAA 7CGTA 2VQTA 4EZMA 2H32B 3S35H 3OF6D 1NEUA 3IXAA 3LX9A 1Q0YL 3NSXA 1UCTA 1TQBB 1Y18B 1GGBL 1Q9LA 1YPZA 3B6SB 3OWRA 4OBSA 4FADA 4N1HB 1FNEB 4BRJA 4J23A 2AHIA 3TBSA 1JNHB 1YNKL 5EO1B 5E8EB 2F1AA 3PIQA 4O4YH 1KCKA 5E4OA 5IHWA 2ED8A 1ZVNA 3TFKD 3V8CA 3RX5A 2Z31A 1KB3A 43C9A 2JI3A 3V5HB 4WFHD 4MNHA 5B38G 3HG4A 4J3OG 4M29A 4GW4A 4PTTA 4U1HB 1C1EL 4HIEA 3N40F 3BEVB 3SY0A 2R7EB 3CX2A 4ICWA 3VDAA 2PW1B 3IJEA 1IBYA 4N24A 3HPJA 2QVKA 2V8MA 5IG7A 1XIWD 1FORL 1R6VA 3ABGA 5CSGA 4PS7A 3RWFA 1T83C 4CMMA 1CFBA 1NGPL 4H88H 3FT3A 3MA9L 3QCTH 5DEJA 4UIMB 5IMKA 1E9QA 3SYCA 5I74B 4F37K 2VT0A 4NCC1 1XXDC 3U7YL 1MCCA 2N0MA 2WVSA 3U30B 4PI0A 2XQYK 3WYRA 3QXDA 4HKXA 1LWHA 1KEGL 1DSFL 2P45B 2AITA 4ZYKA 3FU8A 1XF2A 3NFNA 1NDTA 1WSST 3N44F 5JW4R 3CV5A 1B0GB 2HKAA 4AITA 4LEOA 3VE0A 3VXQB 1SF3A 5LCVH 3P0VL 2QZ5A 3CD4A 3K5SA 1G0YR 2WQWA 3L08A 3MNMA 3CGTA 3OB0K 4J8RB 5DHYA 5T1KB 1L9NA 4E41D 1F56A 1F11A 5ESVA 4YLQT 3QT2A 2PP7A 2FK9A 3F8UB 5FA4A 3VXPB 4YDJA 3EJZC 3PWVB 2OI9B 1M4KA 4FLSA 2X6MA 5FM5M 4ZX5A 3RVWD 3WG7B 4AYMC 1Y1UA 4MB5A 4I2XA 1W72B 4ODVH 3TP4A 3J2PA 2FT7A 3X13A 4JDEA 4P23A 4YX2L 4AX3A 3PV6A 5MHSD 4XMTA 4Z8FL 3QK0A 1ZSDB 1M1SA 1JMZA 3OLIA 4PJDA 2P46B 3LN5A 3EFFA 3UJTH 5G2NA 5D4JA 2EEDA 2EDQA 2K6ZA 5DMYA 3RI5K 2BY2A 3CFJA 4PLJC 5EBGA 4NM4H 2WUCH 3UBFA 3SDYH 4QRQB 1CXIA 3C6SB 3BP6A 2IPTH 4KQ3H 3MFFB 2UZYA 1GC1L 4JZOA 3H0TA 5F7EH 1QQDA 1OAQH 4UAHA 4IRSB 5KOMC 2X4QA 3E8VA 1BJ1J 1DDHA 3PDOA 2B9BA 2GJZA 3SBQA 1X5GA 4IEFB 4JW3A 1D5BA 1NFIA 4Z7QF 3OHXA 1NEZA 4DIXA 2A83A 1FO0A 4MJID 4CU8A 5AW4B 2QVIA 4XVSH 1IM3D 2Y7QB 5HGGS 4F57L 1JWMA 3TXAA 1E5CA 1F2QA 1I1AB 3UAEA 1OO2A 3PREA 3IGAB 1ADQL 3BMVA 3DYOA 3FTSA 1EMTH 3EOTH 5BRZA 1YMMB 2JWYA 2KLTA 3GMMA 3OR7B 5E4EB 1DUZB 2J57A 1LO4H 1TCRA 4GB9A 4E42B 4AJ0A 4NQDA 5I1DA 5I18L 2O5YH 1WS7A 2XX0A 4ZAKC 2DLHA 3RDTC 5ALCH 2VLRB 3U9PH 1MIEL 1BVKB 2KMWA 3TFBA 1HE8A 2W95A 2B1HL 3VXUA 3DHMA 3QUXC 2WIIA 1KTCA 1IFHH 4P3DB 1AMYA 1RVFL 4RMBA 3EHBC 2CM6A 2BP5M 4W6YB 2BVTA 5FW6A 5C09A 1RZFH 4A7GF 4D7PA 2DQIL 4Q2ZB 4JY4A 2X4TB 1FYTE 1BMZA 3T6ZA 2FYVA 1C7TA 2G2RA 3VYPA 3E6HA 5F9OH 1OGAB 3T3MF 4XCCL 4BFKA 1BYNA 3H6AA 4PJBF 4JCWA 2VN7A 5IFHH 3MKKA 1MRCH 2AXFA 1KCBA 2FSDA 4OQ1A 4Q9CA 2A6DA 5DYFA 5GRZA 5GGSA 1WHOA 3DIFA 3RTQB 1IJNA 4K7PX 5INCB 1ET5A 3VFNA 4HK0A 2XWBB 1LO3L 2J25A 3AU0A 3MNWA 2E74C 2WYHA 4JREC 3MRNA 1JDAA 2HKHL 2NY0B 3K6SA 4QLWA 2W0FB 3D25B 3D2UD 3FUIA 4ZMVA 3A6BH 5TD4A 4BRVA 5A7BA 1YY8A 4B41A 4Z5RB 3OAZH 3DOSA 1XCTB 1JG9A 4NRXA 5KYYA 1HXKA 3NCMA 1NCBL 3EBAA 2YHGA 3WKPA 5KSAA 3CZKA 3WLWC 4HPOL 4OD2A 3ASOB 4JFEB 1QNZH 3G5VB 5A7EA 5HI4C 4HJGB 4EIZC 2AS5M 32C2B 3LZPA 1EGJA 3L7EA 2XN1A 5D7JC 1CDUA 1BLIA 2YN3A 2D7MA 3WIHH 2GBVA 1V05A 2X28A 1K4CB 2YRPA 1HQ4A 5KSBB 4EMZA 1FNFA 5L7XL 4K23H 2VDMB 4PTUA 1TO5A 4U31A 4X4ZA 4L3ED 1F4AA 3SPHA 2PR9A 2X70B 4NBZB 3SE3C 4UQBA 1I3GH 5FYJE 5GGTH 3L2MA 4OLUL 1D7FA 1RP8A 4JANA 3IFOB 1LL1A 2M2DA 5A43C 3OD3A 1BLNA 5HYEA 3VGDA 5TF0A 1G7QA 4KX7A 1N64L 4K8RC 4EJ1C 1U8CB 3CSYA 5DMJB 3UX9B 1KIPA 4RDBA 5D1QE 3AG4B 4G42B 2XVGA 3GNML 4HUCA 2NT1A 4K3GA 4FYRA 4K07A 2AGJL 1KGJA 1ACCA 3BW9B 1XTLA 2ESVD 3GI8H 2G9HB 5EF2A 4OLYH 3L3IB 1FZKA 1BMWA 4NCDA 1E7VA 4OFPA 4NENB 4TKWA 2IAND 3BDYH 3BEWA 1REIA 4QKXB 2Z0UA 3V4PL 3U2JA 4AQAA 3MLZH 2PP8A 4MJ5A 2YK1H 1ZT1A 1HKLL 4L4VE 1YECH 2BZ7A 3LS4L 5A1AA 1PL3A 2VABA 1A64A 3CIAA 3MLYH 3DPBB 2CUMA 3WY1A 4CN6A 1CBVL 4PJFF 1MFAL 1MVUA 1DYZA 2E7BA 2BLFA 1C08B 3CMOH 3EOBA 3QUYC 1IGCL 4HUUA 1CF8H 5DC9B 5CCJA 5BV7C 3GSVB 2KKQA 4NSKB 3QDMB 1L7TL 5HY9B 1Q8MA 1RZ7L 4MNQB 1XCXA 1R9FA 5FYLH 2RJMA 4F8LA 1NIBA 5AL8A 1GYAA 2FQFA 5DJ6A 3FT2A 2XRAH 4WW2B 1JV5A 1RZ8A 2ZOKB 5IR1A 5SWZE 2OMUB 3FT0A 5C0JB 3NJXA 2JKRM 5GS1B 4MA3A 4GQPH 1A6TB 3LKOA 3RZWA 1CZ8L 4IJ3C 1PZ2A 1XGRB 2W65A 4FL4C 1CQKA 1L3NA 1CF1A 3IT8D 2DQTL 1KN4H 4I0KA 5DHMC 3CSBA 1VHPA 3GM0A 4JB9L 3UC0H 3TPUB 1HAWA 3UZEA 4D9RD 4PJHF 4H8QA 1CXKA 2N4IA 3BC9A 1PSKH 4K3DH 4RCAA 2CJ3A 4IKKA 4AGPA 5L8LB 4AH2B 2JKLA 1NL0H 3U6RB 2SEBB 1D9KC 1G6RA 2HYMA 3QJUB 3LH2L 4JM4H 5J89A 2HMID 4RZKA 5HDWA 4F1SA 2V17L 3QEQB 4YVNA 5BPPA 5AVQB 3D4GA 4FTVE 1AO7E 4YHLH 5GRXG 2IQ9H 2MOQA 5E99H 1LK2A 2G30A 4J3UA 3QULA 1V5JA 4HPYL 5AWNL 5IROD 3ISRA 1U2YA 1IC1A 1Q90A 3HUJA 4CSSA 5HDQH 2P80D 3V0FA 1QEWB 3AC0A 4EAEA 1RURL 2P8PA 2BFVL 7PCYA 3IFNH 3MV7A 4JFDE 1P4BL 4QAWA 1QSZA 4DZ8A 2WYIA 4Y4HD 4LLUB 1MCDA 1BPVA 2ATKA 4DKFL 2Q3AA 2VZ3A 4KRLB 4RISH 5ISZB 1DJIA 3QS2A 3U46B 2F7OA 4K7FB 4R4BB 1ZEAH 3PWJA 1TT6A 4X9BA 2P44B 1HEZA 3KS0J 4IIQC 4UQ3A 1OB0A 5FYKE 1C9SA 3B43A 3CHRA 3F5WB 3UBXG 2LFGA 2OX5A 1BF8A 1K5WA 2CQVA 1ZWIA 2BCKA 1ECZA 1E0OB 2QADB 3FMGH 4N2CA 4ODTH 4DKDC 5C08D 1BD2A 1FGNH 3DHPA 4ZNEA 3U82B 2VGLM 1INEL 4H44C 3BKCH 3QI9D 5ANMA 1DBBH 1A4JA 3QC6X 3RAJL 2YLKA 1CTMA 5F71A 4EPSA 3LAFA 3WENA 2VDQL 4G9FE 3TYGL 4O2EB 2LABA 2AJYL 4N6RA 5FOBA 1UOVA 3HZMB 2YSSA 3H55A 3RGVC 2H9GA 4TVPE 4UU9A 1F18A 5JHLL 3EUDA 4U1KA 5EBMA 1SY6H 2DF3A 2Q7NA 3LZFH 4PHXA 2H26B 5CO1A 1CFQA 25C8H 1FZJA 4JRXB 1JN6A 4X6CF 3ZE0E 2FX9H 2ICEC 3AFLA 5KYWB 2NNAA 4I8DA 4R97C 4XWGH 1BXUA 4B9GA 4KV5F 1VGKA 4FQQB 2QPDB 3T4AA 3BPCB 4ISVB 2EP6A 1MJUH 4KJPC 3DV6A 3PGDB 3V6ZB 4BSVA 1QR1A 4LAQL 4DUXA 4PV8B 3NIFF 1MCIA 2KH2B 2WVVB 1WT5C 1TQTA 4WUKH 2BSRB 1JHKL 3R06B 5DZJA 5DTFA 1UC6A 3L3GB 4QT5A 2G5BB 3E3QC 4PSRA 1FL3B 2JNZA 1OZUA 1A1MB 5DJ2A 3SGDH 3ZTNL 3K2KA 3ELQA 3BFOA 1L9SA 2E9GA 3DOIA 1FG2A 2WNWA 1HOCA 1KEML 2PO6A 1MUJA 3CDZA 2BMKA 4OGQC 4YNYB 1WBYA 3OJDB 4ZQKA 4EQ2A 3CBKB 3ABMB 1FPTH 4A6YH 3FSZA 3QPQD 1OB1B 4OZGA 1RZGA 5DHXB 2E7CA 5SX4I 1YHPA 5C0CA 4JLRA 2ZWSA 3AS1A 4Z0BH 5F1IA 3V0JA 5HVFB 1JF1A 3DNKA 4PD4K 3TT3L 1A7RL 1G1CA 2GFBA 5EUKB 4RBPH 3ZL2A 3WE6A 4KZEH 3MRQA 3SCMC 1SOQA 3RWCA 4YDNA 4AIEA 3UGXA 1A02N 2W38A 5AVVB 3VSVA 1KYOK 4M3KB 2ATPA 3DIDA 4XH2A 3LH9A 2JMRA 4XPGH 3M46A 4LARH 1WFMA 3DX7B 5FYJL 2M83A 4TL4A 2BDNL 2EEFA 4KNTA 5F7YC 4BFIA 3GSWB 1HINL 2ZD0A 4KVNL 3A24A 3V7AE 4AQ1A 4P57B 5CLYA 1YY9D 4PR5A 4KJQC 2MRYA 3V6OA 1KFAH 4G8EB 3RUGF 4N86A 2EVHA 5AKTA 1QRKA 2ADFH 2Z4QB 4Y1TA 2Q8BH 2XLLA 2X6AA 3T0WA 4AEHH 4ZZKA 2ZTBA 4UM9A 4A66A 4RESB 3VXRA 4EUPH 1SXNA 5I8KL 2XACC 3LB6C 2E56A 2IG2L 3RDTB 1T1YA 3NH7L 3KW8A 2XWRA 4OW6A 5KG9B 1RV6X 4PRID 4Y16C 4JZNA 3HS0B 3IN2A 4HT1H 3G7TA 5G4MA 1NAMB 4WU7B 2FIKB 5L6YH 3UAAA 3O4LD 3K71B 3LHPL 3T0DA 1TKWA 2NY1C 4QHPA 4H0IA 4YSRA 2BVQA 2MHAB 1EJOH 1G87A 4MNGA 4AYID 1E3ZA 5C0DA 2MQ3A 3BIKA 3ARFD 4LL1A 4MMZC 4XNDA 2DKSA 5GS3A 3C8HA 4PJ7E 2YEZA 5CJ8A 2NUPB 3DO7B 4LAJH 4I9XA 3S8WA 2AEIT 4U0QB 1P4IH 2YGQA 1DVYA 4CBZA 5HHMD 2CHDA 5TF1H 3NPZB 2E86A 3VVVA 2HLAB 4Y4KC 2HXAA 5IOKA 5E2UH 1K9TA 2OL3H 4N8CL 4P2RD 3KHOA 3IDMA 4Q9RL 1HH6B 3NIDB 2CU9A 4ODSH 1UACH 3I6SA 5DRWB 3K74B 3NPSB 4F1ZA 1NKGA 2YUWA 5JQ6L 1AYRA 4UMGA 4FXLA 3UTZA 4YBQD 1N3NB 3GHEL 5F89A 5AD0A 5D70L 2RBLA 2W0KA 4P3CL 1UGNA 1KB5H 1QX1A 3I9IA 4CADB 1MCWW 3CZJA 5CEZD 4CJ1A 4GEJA 1E9OA 1A22B 5HVHB 4HS3B 3IS1X 4Z0XB 1NCDL 1UZ8B 2BHFA 3DMMC 3SOTA 4ES9A 3EYVA 5JPMC 5I17B 4R8WL 4XZUA 4MA7H 5DZPA 4OV6F 3OR6A 4LHUB 4OFVA 3OX8A 4F7EA 4I89A 3CXDL 4WV1A 4WSGA 3UFIA 3T71A 2OMXB 3N43B 5LXGH 1EXGA 2Q0ZX 3L1FA 3LN4B 3UTQB 1BM3H 1NCWL 4HZLB 1EAPB 3ZKQD 5T3XE 5D7LB 3RB5A 3HI6L 4JM2F 2QMKA 4GYBA 1J10A 3DBXB 3WJJC 2F74B 4PJCE 1SHXA 1F4WH 1XSJA 3CC5B 5J6SA 3DX9A 4MB1A 1IBBA 2GVYA 2ZSVB 1MH5B 5T8IA 4G1EB 3TZVD 3EXJA 2LW3A 5FYKL 3SBRA 2OQJB 2IFGA 5TE7L 2ZQKA 3PHQA 4OCSH 4LQFL 2PCPA 2P8LA 2BNRD 1HHGA 2ZCLL 1HXMB 4RIRB 3Q48A 4TNVK 3MBEA 4LQ1A 3WXVL 2Y1YA 1Y0LA 3ARBA 4UV4H 5IBTH 5FKAA 3P11L 2UXVA 4KGJA 4XPBH 1TVHB 2PCXA 3FB8B 4G6FB 3LRMA 3PP3H 2VJ0A 3P4OA 4XP5H 1KTBA 2PYED 1A14L 1NWOA 2EACA 1IL1B 3BN9C 2ZT9C 5T5FL 1FFOA 1LE9A 5IB5B 1N59B 1BOGA 4WI2A 3ES6A 5IQ7L 4PJIB 5ECGA 2VN4A 3L4TA 5KOVC 4KFZC 4P5MB 3CTTA 3IJSA 4RRPA 1J9SA 5JR1L 4N4YB 2BY1A 2BNUA 3DTXA 5DHEA 3VXSD 4P46C 3QUZB 4WUUD 2BOCA 1ORQA 3BP5B 3C2AH 5EPMA 5AW2B 3SQBA 1PEZA 1KTDA 5ICXB 5GRYA 1L0PA 1QFOA 2CMRL 1SBBA 3EW3B 1G6VK 3FTZA 4IBTA 4QRSB 3RJQB 1U3HB 5LQBH 2ZOLA 3MPCA 2ICES 4HG4J 2JK5B 3OB8A 1DE4B 2C3XA 5J13C 5C9JB 2XJLA 4WO0A 3ILEA 4QWWD 1SUJA 1JERA 4PGZA 5IUSA 4QJ4B 4K3EH 1BSIA 4APXA 3PL6A 2Z6FA 1S8DB 3VFWB 4ELME 4D94A 3QEUB 1IO4C 1ZT4A 3GSOB 2V7HB 4N0YH 4IBVA 2DQUL 1UYWH 1TTAA 1OL0A 1PZCA 4ZW6A 2K6WA 3P40A 3RPBA 5TQ2H 3GGWA 3IEAA 3C87A 2OR9L 5A6LA 5K69A 3LKQA 3VA2C 3OPUA 1ILUA 3UJIL 2P1YA 1P7KB 5DK0B 3PAUA 2QKIB 3IF1A 3C6EA 2OSWA 4OLZH 3UTSD 4JFXA 3LKNB 4I3RH 2BRRH 3ASNB 5E6YA 4FFYH 4G43B 4LCYA 2A1WL 1QLEH 2J1YA 3WDHA 1A6ZB 4FC3E 4CVXB 4FQIL 1NDGB 2ORBL 3L3JA 3FXIC 5ABDE 5C2BL 4EEEA 4YHML 4ZUSB 5FB8A 4MCZB 3GMOA 3BQUC 1H6FA 1IAIL 1QEXA 3LNHA 4Q58C 4W6WB 1U8PB 3KLAA 4QHNB 4M8UA 4KROB 5HVWA 4LPVA 1IAIM 1KPUA 1QPXA 5CCKH 4ORGA 3VG0H 1A21A 1JFQH 2ED7A 2IXQA 2NLJA 4MAUL 4YWGH 4A7TA 4C56E 2F18A 4PB9H 4H13C 3JZYA 4QNPF 5EEYA 4LCCB 3OKDA 5G5DA 5DD0L 5ILTH 1VADB 2PW2A 1RJCA 3OZ9L 4N2BA 5IKCB 3DIVA 2VDRL 2DICA 4GMSH 4I5BA 4DN3H 5JXAH 4U2YA 4HF5H 1INQB 2K70A 1WD9A 3C60D 5EIVA 1AFVL 2CKBB 3ML8A 3CZNA 3TBYB 1PIFA 1PYWB 3X17A 2HT3C 5I76A 2NZ9C 4R7XA 3TA3B 2C3HA 2XVBA 5DU7A 4XP1L 2QV4A 5F2FA 1Q94B 3P9WB 1FG9C 3NFSL 3H53A 1IEBA 2FWSA 1FUNA 4IU3A 2VZ1A 4Z7VE 3GXDA 5BVPL 4R97B 1W2KT 4R3SA 5B7MA 1MHPH 5EEWA 1BWWA 5IHZA 1U8LB 1WCBB 4JRWA 5HP5A 4P2QE 2AP2A 5IK3B 2IAMD 4DHLA 5F21B 1S78D 5HJBA 2FLMA 2XVLA 1PJ9A 2OTUB 3RVTD 1MCOH 1MPAH 2HFFA 4GKOA 4WHDA 5BZWA 1CDHA 4I88A 4KHTL 4AC4A 4ZRGA 4UAOB 3U0TB 3SDXA 2UWEA 2Q2LA 3CAFA 4M1CD 4EVNA 1FBIH 1IC5L 3P54A 5I1LB 3Q1EA 3W0WE 1DL7H 2YGOA 3HFMH 4JO2H 4J3BA 2WBXA 1NBZB 5EEXA 5GS0L 4JO1H 1AGEA 2YR3A 5JOPE 4LEEA 5SWSB 4Z7NB 1BEXA 5IW6A 1S7QA 1AI1H 3QORC 3PJSB 2VLJB 1I1FB 5ICYB 1ZGLA 1FZOB 3IETA 1CGSL 4JO3H 3DOHA 5DK2B 4GAYA 5GIRA 1I75A 4AM0A 1K4DB 1TITA 2ZPKL 2HFEB 2R59A 1DQDL 3BWAA 3TT1L 3LV3A 2Z1PA 2BS71 4NUGL 4X9HA 4P5TA 5IVZA 2VLLA 2ZUVA 4HXAL 4AK2A 4YK4C 4UIKH 5ABZA 4WI6A 2QDWA 5JZ7C 2CAKA 2AEOA 4X4YA 5BOJA 2Y36L 1TIUA 3VI3E 2KQNA 1O7DC 2VDPH 2R9HD 5JIDA 3H2WA 3NABH 4YZFE 5C0AD 4JM2D 3FN0H 3STLB 4BH8A 3RZCC 2YRLA 2GK0B 4KI1A 3VB9A 3HFFA 4IU2A 2WP3T 4QJ3B 3ZDZF 2YKLH 1YYCA 1AKJA 1KLUA 4A2DA 2Q9OA 3MLTB 4UINL 4L9LC 4Z76B 2ITCA 4NGHL 3ESUF 2PLTA 4X9FA 1ERNA 1JZIA 2YD5A 5C0BD 4UTAL 1FJ1B 2ZUXA 5EU3B 5KVGE 2EEAA 4FQ2L 4RMSA 2J6EA 4XCNB 3GJFH 5F0LB 2HRPH 5JW5B 4LCWD 3DI2B 4ETQB 5D1QC 5T3XL 4MD5A 4WY7L 4DAGL 2G3NA 4Y5VC 1L5GA 3NQKA 3VSTA 4C83B 3P73B 1WA1X 2JFCA 3RWIB 5BXFB 3KNBB 2HT4C 3PDGA 4AJVA 3HW7A 3PQYE 2EXTA 5ERWB 4KJWD 5CINH 4M8VA 1ESOA 2HUEA 1G4RA 1ZHLB 4X4ME 1R3LB 5DWPA 1XMWA 4XWOD 1T2JA 1Q0EA 4MRCA 2Q86A 2YPKA 5T1LD 4MA1C 3RU8L 2NY1B 1FRGL 4QLRA 3SBWC 1A7PL 1L6XA 3JZ7A 4XNZC 1NC2D 3ARDC 1YJDH 2LU4A 4L1DA 2FX7L 2X4PA 3H3KA 4UILL 4BSWB 5GGVY 5CUSL 3V52L 2X7LB 2IV8A 2JJUA 1QPKA 3GMLA 1SHSA 1BX2B 5F0JB 4J6RH 1NMAL 4BK5A 1NLBH 2XBTA 1A7NL 4KO5A 2W94A 1PD6A 2GTZB 1U93B 2ZXAA 5DZOA 1BJMA 4M9PA 1WTLA 3O3DB 3CZFA 3O3BB 4G8GB 4F80A 1WBXB 2BP0B 3GEFA 4UQEA 1JZ5A 3JUZA 2FQGA 2C1PB 5D1XA 4K9EL 2XSKA 4X7TB 1T04B 2ITDA 3ESMA 1DQLH 1BZ7B 3VRJB 2AK4E 1BF2A 2ZAHA 3BHBB 5LG6A 1IGFL 4DO5A 4Y4KB 5DS8B 5IEHA 1GYUA 4BDVB 3BPOB 2VZSA 2YPLA 2WP3O 3NIGB 4HMEA 1P9MA 2DQFB 4U3SA 4R7LA 3SKNB 5D1ZI 4PBXA 3WIIH 2R56H 3GXIA 4GRMA 2NUTB 3T0ED 4Y4FB 5JOFB 5I1JH 2J8UB 3QFGA 3P2BA 1QI5A 1A9BB 5FKPB 3R7RA 5DMKA 1OD9A 2ZXDA 3F58L 4QHUB 4P07A 5I1HH 4H8VA 2W0LA 1IGTB 1T20A 2DV6A 2JLPA 5J6GA 1TEYA 1OP9A 5FO7B 1ASOA 2BIPA 3R18A 1TCMA 4AZUA 4OZIF 4PJ5D 5KS9A 1XGQB 4C4UA 3EZJB 4CW1A 2ICWA 3LEYH 4PIRF 1X5JA 4K5PA 4RGNE 3ZBMA 3WJLA 2OW7A 2FQDA 3QAZB 1IAII 2ZXEB 4IK7A 2H32A 4PJXF 2EUZA 4N9GB 3C5ZB 3KBPA 1KCVH 5FGBC 4QOKD 4W68A 1FNEA 5CSBA 4KH9A 2CLZA 4PWHA 5E8EA 1EX0A 3FYIB 4L0YA 2DI9A 2Y3NA 2TRHA 4PG2A 4UZSA 3V5HA 5MHSE 4MAYD 3ULVH 4GXVL 4XP6H 3V0WH 5FX3A 4U1HA 4H0LC 2DD8H 3H9HB 1F3DJ 3BEVA 5FA3A 4JY5L 3QEGH 4UTCA 2C9SA 4FTVA 2PW1A 2UZIH 5IVXF 4TOYH 1HSBB 1ZD6A 2EILB 2IGFH 1OCZB 3R8BB 1X7QB 3V0DA 2HTLD 3MJGX 4YSUA 4UIMA 3HG1B 1M9WA 5CILH 5E6SB 4WNQB 3L3OC 2LT9A 4JFDA 2DM4A 3G6AB 2DRUA 3BVWA 4TQEH 3T3MB 2YD1A 1TJXA 5FUOL 2VN3A 4E9SA 5HYJE 3K72B 1U3NA 2JCCB 5TDOB 1IBDA 3O2DL 4J3WA 1B0GA 1EHKB 3RWDB 4NIYE 2AJSL 3VXQA 1PG7H 4O02B 2YARA 3K46A 4H20L 5KANI 1HVXA 1D5ZB 1PJWA 2OMYB 5T1KA 1CQYA 4TM9A 3AQDA 3B9KC 4J3VA 5LAXB 5J13B 2XX1A 5G4OA 1KTLB 3MZGB 3QFJD 4OSUH 2BIQA 4OF8A 1I7RB 3VXPA 5AOMA 1E28B 4G9FA 1D5RA 1UOKA 2PWDA 3S36H 4ZG1A 3PWVA 5F97E 3VFOB 1NCHA 2DH2A 4XPFH 3ULSB 4XO5A 5D1ZC 1B4JL 1IARB 4UBDD 1TR7A 3WNKA 1YEGH 2W9LA 3AG1B 3APCA 4E9XA 4YO0B 2AEQL 1CLOH 4IOFD 2VXQA 2OMBA 4OJFH 5L4MA 5EWIL 1ZSDA 1XVSA 5I6KA 4WTQA 1H19A 1HK6A 1BXVA 1YDPB 2VSKB 5D8JL 1BXXA 5FYLD 4NQCE 4XB3A 3KH3A 3C6SA 5HI3C 3SYOA 3TVMB 3ZXAC 2HT2C 3MFFA 1EFXD 1G84A 2NX5B 3OAYH 3BJLA 4IRSA 1RUML 3FH7A 1MJ7H 4IEFA 3AXHA 1RIUL 3JV4B 3NJFA 4X7CC 5BZZA 3TPKA 4KKPA 3NCCB 2HX8A 2L7EA 5CP7A 2Y7QA 1ZLWK 3QQ9D 3BQUB 2D31B 1B0IA 4CSTA 3UIYA 1TZIB 1YMMA 1DUZA 3BVNB 3J07A 2OJ1A 5C07E 2A9NH 1YA5A 4GBXB 2VXVH 4E42A 2ITEA 2X6UA 3M1OA 2Y9RT 2DYPD 3MNVB 4WK0B 2D03H 2NXZC 4G6AC 1MKFA 1WFNA 1AD0B 3HI1B 3JSSA 3MV8D 3MROB 5GZND 2VLRA 2LAGB 3UAJC 1BVKA 1WWWX 4DERA 1R3IL 4KQ4H 2B5IC 5JW4N 1RJLB 4JFUA 4RMVA 3WNJA 1JK9B 3MACH 5E8NB 1E4WL 2A6KB 4CGUB 1P5VA 4BYHA 4E9VA 3LEXA 4Q2ZA 2X4TA 1Z5LB 3QXTA 4PVBA 1TPXC 1HQRB 1OGAA 2XWJB 2BSSA 4KKNA 2QZQA 4P2OC 3VXME 4C8XA 3TN0C 3IMTA 5AB9A 1CLCA 1ASPA 4OCMC 5HJDA 4PMFA 3EO9L 3O45B 5EC2A 1H3UA 1KXVA 3FQ2A 2PP9A 4TSAH 4XN5A 2NY2D 2ENJA 4MB3A 1GZPA 3RTQA 2F53D 3FCUB 1IKFL 2MCPH 5GS0C 4PJ9B 3RLSA 3QBTB 1ICTA 2XWBA 4S1RH 4XNUL 4FQXA 3PXJA 4GRLB 4WHTB 2VDNL 3BUQA 4TV3A 2BM3A 2JIXB 1N0XL 2ESVE 3OLEA 4LSRL 4K94L 1MVFA 1TTBA 2Z1KA 1JYVA 2W0FA 2ZKWA 4N5ED 2F7PA 4X9GA 4OGXH 1FSKC 1W80A 4JBSA 5JHMA 5HYQB 1IEHA 2VSDA 4LK4A 4Z5RA 3ZDXF 3MRKA 1D5IL 4ETYA 1A6VH 3GSNH 3NK3A 3ZE1E 3RJOA 3I50L 4XVUD 3FO0H 3QZOA 4HCRA 4XN8A 5F6IC 4JFEA 5IFJB 4QRRD 4U3HA 4HJGA 5LGJB 1MRDL 3S34H 32C2A 4DK6A 2J2ZB 5JHDD 3P9MB 2EDRA 1JZHA 4EZKA 3JTSA 4O9HH 1K4CA 3PP4L 5KSBA 3DX3A 3VX0A 1JNNH 2ZOWA 5JW4M 3CHXA 3HZKB 1S9XA 3FHEA 2X70A 5MENB 1B2WL 1QBML 4KMLB 4OM1H 5CIPA 3H9SE 4YQXH 4HXBH 1H6UA 2JKTM 2YXFA 4Y7MA 4NYLA 1JL8A 3IAPA 2VM4A 4FFZH 1YEJH 4F7PA 1U8CA 2EQDA 2ENPA 1XTMA 4HPHA 4U6XB 4D9RE 3IFLL 4K8RH 1MZYA 4YLCA 4NM8H 3SDDA 4I9WD 3LXUX 5D1QB 1IM9B 3EFDH 3H4HA 1IT9H 4G42A 2CO7B 1PNDA 5GJSH 3CLWA 2VR9A 2VOTA 4S1SH 4Z7QE 4KHXL 2F58H 1KYOJ 1ZHBB 4HJJH 4XCFL 3BW9A 2G9HA 4U0RC 1SLXA 2X53A 3IPBA 2CBTA 1G1KA 3SOBH 4X7FC 4NENA 2QHRL 4KTDH 1KG0B 2CWRA 2RHEA 2QKSA 4LSVL 4DPCX 2WWOA 5L9DL 4LEXL 3QDHA 4F15B 1A3RL 2A4CA 4HUWB 2EUXA 5T1MB 4DNLA 2WXPA 5B1JA 1ZTXL 5CZVH 4LHQB 43CAB 4H7VA 3CZUB 1S2EA 4ZXBD 3MRGA 1C08A 2MKWA 4WO4A 1BMGA 3RG1C 1C5BL 3GSVA 1KGIA 1GW6A 3NDZE 4NSKA 1CICB 3QDMA 4IYKA 1WP6A 4MNQA 5F7NC 3MR9B 5BV7H 4P48A 4Y2OB 2V5MA 2EVIA 3NMEA 3GSQA 1BJ1H 3S97C 5F93C 4WW2A 4K9EC 2ZOKA 5C08E 1UFUA 1XL6A 3AABA 4ZOAA 2OMUA 3MRCA 2C9AA 3BE1H 4JN2B 1PY0A 2JV6A 2K1MA 3P3UA 5GS1A 1A6TA 3PV7A 2LU7A 3B2UD 2NQ3A 3GYRA 5I26A 2NY4D 4HLZH 4HAKA 1XGRA 2X9XA 3FHAA 3K91A 4UQ2A 1BQSA 3HE6C 2DQDL 2OZ4L 5E2WL 4HAGA 5K9QI 4D0BB 5JUEH 1IBGL 3LPWA 4JQXC 1ITBB 1Z5YD 3B8YA 3QUHA 4DP5X 2W07B 1EO7A 3WIFB 1EDQA 4J5VA 5JQHC 1YYLH 3C9NB 3VFMB 3ZO9A 3L16A 4AH2A 2IJ0C 2SEBA 3O9WB 1JD7A 1O5PA 3L54A 3QEQA 1FDLH 1OAZL 1M05B 1FL5B 2PR4L 5E9DE 1SN5A 2NXYD 3I6LE 4N2MA 1OZTG 1U42A 1QEWA 3M88A 3GHBL 4FXTA 3WMSA 4PWGA 3IVKA 1R3HB 3RTLA 4KZDL 1F02I 1WTGT 2NYYD 4LLUA 5J11C 2GJ6D 3B9EA 1Q0YH 3KWUA 2B08A 3U46A 4K7FA 1T1ZB 4LPXA 1J7VR 2GJPA 4R4BA 3EDEA 4NN5C 5ID1A 3DV4B 3F5WA 4OJAA 4RMQA 3BSZA 2VIRB 1J0ZA 2NNFA 1G1YA 3S3DB 3V4VB 2K9UA 4TVSa 3VGBA 1JZEA 1CFTA 3PHOA 4N1CA 3DX2A 4WU5B 4ELMA 1R3JB 2YC1A 2F8OA 4U6HB 5EIIG 1B6DA 4R5XA 1F4XL 1C1EH 1E4XL 1YC8A 1AXIB 2DL2A 3C6LC 1NDMB 2D7PA 3OJMB 2JJVA 3FU6A 1NGWB 1NEZG 3HZMA 4H1LA 4BHUA 4UT6A 1FORH 1NCIA 4NHUB 4POZC 1I1YA 2H26A 1F6FB 4OJDH 1URZA 3QIBD 3Q1SL 3MA9H 4FHJA 1LMIA 4JRXA 1GGYA 1I85A 1MCQA 1KV3A 4B3EA 3BPCA 3U7YH 1D6VH 3PGFL 4GMTL 4ISVA 3BH9B 5BUAA 3PGDA 4LIQH 1KEGH 1DSFH 1UA6H 2BSEA 3A21A 3ARXA 3K2UH 4PV8A 1NQBA 4F58L 4Z7WB 3D18B 2Y7SA 2Z35B 2WVVA 1JGDB 3EIFA 4XE5B 5D2LF 5D7IE 4NNYB 2BSRA 4RNRB 4UNVA 4Z1PA 3GRWA 3R06A 5K93A 4PJFE 3L3GA 3P0VH 4NOFA 1X5ZA 2EICA 3MHZA 1N6QH 3ZRFC 3EXLA 3KLSA 2J4WL 2WWKT 4GO9A 2D8KA 3SDCB 5L8KB 3B9KB 3VDCA 2ZUQB 3PWLB 5EOTB 4YNYA 4KTEL 1OB1A 3P3RA 4X7EC 2VJXA 1F13A 3V8OA 3D4ZA 4U6YB 2B2XL 3HB3C 4XHJC 4XMPL 3IDIA 1OCCB 2R0WL 3Q6GL 5KBPA 3O6FC 4FABH 1UD6A 4FMKA 4LZKA 5I73B 4TSBH 3NJMA 3HE7D 4YFLI 3A5VA 1OTTD 1G43A 4OIBA 4P8QA 2CPUA 4QO1B 5EUKA 2DQEH 3V6BR 4PJHE 2VXTH 1G7IB 1DLHB 1XH3B 4OD3L 2J44A 8PAZA 4LOUC 1UD2A 1G0XA 2R23B 1UT9A 4W9CC 2R39A 2F5BL 3MMEB 3DX7A 4XVJL 2WLYA 3FFOA 4LPYA 4S0TD 1GYCA 2DWSA 3KMDA 3U9WA 2IQAB 4XNXH 4P57A 3RNQB 5FWQA 3I84A 1KGCE 4L8CA 1EUTA 2DLIA 2IDSA 1ZXQA 2B16A 1PFCA 4G8EA 3IPEA 3BXNB 5IFAL 4E0RA 3ZDYB 3KCWA 4EN3B 2Z4QA 3BKML 3INOA 2EABA 2XPGB 4CNIB 2VDRB 5I18H 4PY7B 2LOEA 4PG9B 5DJDA 2NXZB 5D2NA 4LF3B 4J3TA 3WMPA 3PJLA 3RDTA 1MIEH 1GGTA 1UASA 2X2YA 4JFFB 4W6XB 5J1TC 5KG9A 2B1HH 4JHWL 3K6FA 1QBAA 1S9WB 4ZUWB 4ZMAT 3HS0A 5KUKA 1YRKA 1NAMA 4PVMA 3HKZA 2FIKA 4MKMA 1GRWA 3NCJH 3WI9A 3K71A 3CDGB 5GHWL 1JZ4A 2EH7H 1ND0A 1FL6B 3CQPA 4HJ1A 4JEGB 4R83A 5I1GL 1TPXB 1J0KA 2WWKO 4NC1E 4XCCH 4HIJB 1EIBA 3FFCD 2IVFC 3UTTE 3CFNA 2WLIB 5IQMA 3ELAT 2DEYX 3ZZSA 5FUZH 3QDGB 4AQOA 2B39A 4QXTB 3VWJB 3JVGC 4G7YH 4PRPD 1LK3L 2NUPA 3DO7A 2P5WD 2EJ1A 2XVKA 2P9RA 3TFKC 1LO3H 4FLOA 1R24B 4K94C 4X6CE 4OF7A 4I1RA 4YSSA 4LBAA 4KV5E 2BNRE 3PFUA 2EKSB 4N2FA 4NERA 2RQ8A 3GQFA 3QNYB 3KS0H 2HLAA 2J1KA 1I9IL 4QD2E 2XWCA 1JI1A 3UROR 1HH6A 5IJKA 1BA9A 1OTSD 1XIWC 3AQZA 1MELA 4JPKL 4JKLA 3MV9B 4XOCA 1AQHA 3HC0B 5DRWA 4LL9A 2QPSA 5D5MF 4HPOH 2FYYB 2FECL 1N3NA 2WBJD 4AQ8C 2AJXL 4E9YA 1A7OL 5KSVB 1KGWA 4GRWB 4DP1X 3ULVF 2BX5A 3CFEA 4LBEB 3V6FA 4EI5B 1BFTA 2APWA 5AALA 3P9LA 4UV7H 2QPFA 5L7XH 3VD4A 2OXGB 2G5RA 1TDQA 3MA7A 4HS3A 4OFQA 3EO0B 1UZ8A 4OJYA 4Z0XA 3DBSA 5A40E 5A2KH 4J3SA 1SOSA 5I17A 4OLUH 3CFIC 4LHUA 4M4PA 2JKJA 4LLWB 1UCBH 3CVIL 1N64H 1EXUB 2GAZA 5DK3A 1G0DA 5B1CA 3UTQA 1KJ3H 4KGLA 4AYFB 3VM5A 4HZLA 4XAWL 3VDBA 1EAPA 5DI8B 1NC4B 5D7LA 4HOXA 4Z7OE 1MQKL 3RY4A 1Q9WB 1WUZA 2F74A 3E38A 4QHKJ 3CC5A 4X8XA 3VA6A 3RVWC 2ZSVA 2GI7A 3GXUB 1S46A 1QFHA 4G1EA 4MZ2A 1FWXA 4C55A 1E4XI 3JV5A 2OQJA 2ZIDA 4QTIL 2R0LH 5DR5L 1TVBA 2AGJH 1K5NB 1AZCA 1MFVA 3HZYB 3CLEL 4ZUTB 1UWYA 1HXMA 1N26A 4RIRA 1IGJB 2V9TA 4HD5A 1OP3K 1LMKA 3V4PH 5LNDA 3UTSE 4A67A 3IKKA 3KCPB 2NMSA 3FB8A 2Y69B 4JG0L 1MFAH 5AB2A 3IFPB 4AEFA 1W0VB 4KXBA 1IL1A 1XSKA 2WHVA 3GXFA 4AIZB 2P5EB 2Z93B 3O2VL 1N59A 4PJIA 1L7TH 2BW4A 4P5MA 1ODAA 3NCEB 4WWKB 3PWNB 4XI5D 3TA4D 4GKNB 4LSUL 5CN3A 1TLKA 2WOBA 1JV2B 3QUZA 3BP5A 5BZXA 3L2LA 4LP8A 4A2GA 5ICXA 4W9IC 3RP1A 4I0PB 1JF6A 4QRSA 3CBJB 3EO1B 1U3HA 3G5WA 5EG6C 4AYBA 1CZ8H 2JK5A 4YSAA 3HI5L 4LRIA 2DQTH 1ID5I 4KDTA 4PJEE 1MI5D 4JB9H 1E4KC 4MDJA 3IBOA 4E9LA 1S8DA 3ISWA 1QVOA 1ECYA 1UQSB 1VEOA 3F83A 3LTVA 5DDHA 1ZLUK 1MAMH 4E9WA 3GSOA 3MRFB 1B4RA 2ZNWA 3QDJE 3LH2H 4MHHG 2QGBA 5CD3B 2Y23A 1LO0H 2R27A 4ODUB 1LO2L 4F27A 5EF3A 5EUOA 1XSIA 5DK0A 5DVPA 2QKIA 5GJTL 3U0WL 3WTUA 3BAKA 1HNYA 3GZOA 5IM7B 4L1LA 3LKNA 4OM0L 1RURH 4G43A 4B9FA 2YPVL 1B9ZA 1T1WB 3T6XA 1FCCA 1NDGA 4BQBA 2H1PL 1M6OB 4H4NA 3PNWB 5J11B 4ZUSA 1DVTA 4GG6E 4MCZA 4ZPVB 1NFAA 2W9DL 3VFGL 2A74C 1ES0A 5ID0B 1U8PA 3DTUB 4QHNA 5AZEL 1AS6A 4NRYB 1R33A 2VDOB 4PP2B 3ZL4L 4JR9H 3M7OA 4PCTA 4X6DB 3SQOL 2WCPA 2IAAC 5IZ7A 1O6SB 3KGRA 2RR3A 1INEH 2APSA 4LCCA 4H5SA 2P7TA 2A0LD 3RAJH 5FFOA 1ORSB 1VADA 3GRBA 4GIAA 5DHVH 2Z31D 5IKCA 2VDQH 4ZOBA 3CZLA 1NCJA 1INQA 2AJYH 3KPMA 3O6KL 3TEUA 2KDYA 5CEZL 2CKBA 3TBYA 4EIBA 1PYWA 4HMCA 1T03L 5E8PB 1XH1A 3TA3A 1IAOB 3MJ6A 1Q94A 4LEBA 4PJAF 5FR3A 3Q6FA 4OFIA 5D93C 3BRDA 5BZDA 4N85A 1HL5A 5KYNA 4RWYL 1T4KA 2MEJB 1UEMA 4WFGD 3GLAA 5ACLA 3WKQA 1MFEL 1R5IB 2E6QA 3NEXA 5B21A 2VTFA 1EZUA 1U8LA 1WCBA 1XB8A 1Z66A 1JHLL 5F6HI 3HPLA 3SKJL 1BFOB 4OLWH 2EVJA 2OTUA 1OT2A 2WLZA 3ARSA 1CDGA 4JM0A 4BFFA 3CVBA 5EU6B 5J06A 2CK2A 3ZGHA 2YRBA 5LWYL 4HFUL 4H8WL 1QATA 1JHKH 4HWBA 5GGRY 2A9BA 2ADJA 1CGUA 2MNUA 4W4OA 1NBZA 2W1NA 1CLYL 3C12A 3IRCA 3LIZL 1HC1A 4HGKC 5SWSA 1H5BC 3VGFA 4JQVA 4N2NA 1NAKL 3QIUC 3ZQ9A 3MGOA 1RJYA 4HETA 5ICYA 1I1FA 2CRIA 4J4PC 3ULVD 1FZOA 5AYUH 4IJTA 4JHZA 3QNFA 1CIDA 1E40A 4LXFA 1K4DA 1T3FB 2FECI 3FO2B 4HAFA 3ZUCA 3ZU8A 2ROXA 1PG7W 3RY6C 3HB3B 5CFAA 2Y07H 3UEZA 2WLNA 3O6FB 4NWUL 4LFHD 1MCNA 4MQTB 3ILPB 4XP9L 1E6JH 4P23D 4JJOA 2YMXL 4PMEA 1A7RH 4IMKA 1WH0A 2X0WA 1ZIBA 5FO2A 4HIPA 3MV11 2GK0A 1TZOA 3WN5B 3J27A 1P5UC 1L0YA 1Y6KR 4PW4A 1UA3A 1CG9A 4G8IB 4BCZA 3SE6A 3CK0L 2RFXB 3MLTA 1F4YL 1LWJA 2ADIB 4Z76A 5DC2A 5FYJH 2BDNH 3H85A 4UB0H 1ADQA 1J0HA 1LHZA 5EU3A 1BPLB 3F00A 4XCNA 1HINH 2R0ZH 1COBA 3EZ8A 2QGEA 4ZFOB 1WZAA 5AW1B 1TQWA 4U4IA 5KTEH 2H0PA 4ETQA 5TQ0H 2QL1A 3ARUA 1O9WA 2MKLC 4NQEE 4V1DE 4C83A 2X3CA 1T89C 1KCLA 3KNBA 3MCKB 3EJZD 4CC1A 3NH7H 4KAQL 3PQYB 5DURB 5ERWA 2ZP9A 3P77B 5DQJB 2KYIA 1KB9K 1R5VB 4KKAD 1NGQL 4IMLB 3SSGA 5IROC 3AROA 1K85A 1UWGL 1G9NL 5I6XC 2AABL 2P4AB 3LHPH 4YC2C 3W37A 2FBJL 4IGBC 3JWOL 4WW1B 2JJSA 5C09D 4PLJD 3NGBB 5CZRA 1A4AA 1NOLA 2RAMA 2X7LA 2EXWC 4NKQB 2R4SL 1BX2A 1ADWA 3V4LA 3THMH 3S3CB 1MCLA 2ZG3A 3E1ZA 4LO9A 3TJHD 2EDFA 3QJQB 2C4FU 5HJ3B 2VDNB 1MCPL 4I13B 2XV3A 1R4XA 3ZZLA 3VQ2C 1WWBX 2G9KA 5JPNA 4G8GA 3QRLA 1WBXA 2BP0A 1FE8L 2EYTB 3RB7A 4W81A 1OQOA 2A9DA 4CBPA 2C1PA 4X7TA 1T04A 2VJ8A 2IIJA 3NZSA 4DF9A 1BZ7A 1R5WA 1BIHA 1ZAGA 2OBGA 4IHOB 2QT6A 4GQQA 4HEPA 4L2YA 2EDDA 3L48A 5DS8A 3SGKC 4BDVA 4Q9RH 4ZAKD 4B3VA 2NY7H 1XIWB 3EDDA 4LOFA 2DQFA 4KUZL 4OAWB 1PZUB 3BVVA 4Y5YB 5J5EA 4JKMA 4FQ1H 2X4OB 3EJCA 2NUTA 4Y4FA 5JOFA 5JQ6H 4RRPG 2LAAA 2J8UA 4FEIA 5I19L 3EHBD 1XGTA 3FUEA 1A9BA 5FKPA 5KSAD 5D9SB 2VZTA 3N50A 2ENQA 4QHUA 4NAJA 3ZE2F 5D70H 3AITA 2OZNA 4YSPA 4P3CH 2ZKHH 4YE4H 3IJHB 1ZT7B 3FDWA 3S35L 4HIQA 1Y7VA 1TTCA 2WWMC 3Q5OA 3P0GB 4WFED 1NCDH 5E9AA 5FO7A 4LLAA 4MRBA 3B9DA 1XGQA 5F7BA 4P4KB 4R8WH 5E5LA 2E6JA 4X0NA 4XX5A 5IB3A 1KBGH 3PDDA 1MLBB 1M56B 2UX7A 2AV1B 4CAGA 5J57B 1N2RA 2X4SB 4E41B 4PYHA 3PUCA 3A22A 1F6AB 3MO1B 4CMHB 4K7PY 1NCWH 3ZZ1A 3QFJE 1J0IA 1T6BX 4GQZA 4HWUA 4M6NH 4N9GA 3ULUF 3C5ZA 5I5MA 3SYPA 3DGDA 1HYRC 2YA2A 3BUPA 3OC5A 1BQHA 3QVAA 4KUCF 3RX7A 4BZ1H 1BCIA 1YEEL 4Y2DC 4JDVB 4YSQA 5E1QA 2YUVA 4HC1A 5TE7H 2I07B 1A6AB 4LQFH 4N1EA 5B22A 5L2KA 2V2TB 3WU1A 4PGJA 2WNXA 3U1SH 3QCTL 3WLWD 1Z9PA 3WXVH 2XXCB 5IQ9B 1SJHB 2QFRA 5HI4D 3KLHD 1CD1A 1T66C 1TJGH 2FAUA 3N0PB 3P11H 5CP3H 5D7JD 1B3IA 2IDCA 4QRTB 3D39E 1NEPA 3TIEB 4QTFA 1X7QA 4J3OC 4TVPH 4N5UA 3N06B 2OS7A 4M43L 1DQJA 1A14H 3HG1A 3OB0H 4MJIB 4QRPB 3G6AA 5LCVL 1IM3B 2WAHA 1QTPA 2YD9A 3T4YB 1N7ML 1L0XA 4XNMB 3GSRB 1YY9C 1JOIA 1ZS8B 1L9TA 4NC0B 2JCCA 3OKOA 5GRJL 5TDOA 3FRPB 1FNGB 4K8RD 2WXNA 3WS6A 1F3JB 1NKOA 2Q87A 2I60H 3RWDA 3S5LG 1FN4B 5EORH 4DGYH 3NJJA 1PLCA 4NBXB 4O02A 4IIZA 4Z7IA 4L48A 1D5ZA 3ZKXB 1OXYA 2OMYA 12E8H 4F33B 2DJMA 3TIDB 4XBGB 5LAXA 1QI3A 4CKQA 1KTLA 5EZIL 1MEXH 4F91B 4KO6A 1MHEB 2X2HA 3EYQD 1I7RA 3FZUC 4UMSA 1E28A 1HH9B 4B5ZA 5BW7A 5HHOB 3GO1L 3RIFK 1Z6JT 3VFOA 4GS7C 5C3TA 3UJTL 4HD9A 1UXSB 1IJ9A 3M07A 4L0ZA 4HIIB 4TULL 2WUCL 2IBBA 5I0VA 1XAKA 2IPTL 4KQ3L 4DH2A 4YO0A 3EJQA 4I3SL 4ALAL 5CD5D 3ARFC 2OR9H 4C57C 2C26A 1OAQL 1W16A 1T5KA 1VFOA 4QAMB 1SOKA 1NGXB 2CRMA 3QUKA 3CVHB 2NDFA 4PRHB 4IBSA 3SJVE 1S7RB 4PJ8C 4NHCL 4ZFZB 4FLRA 2MCMA 4D3CL 3QUYD 3TURA 4WFFD 1NIDA 3TVMA 5B3SB 3N1FC 4WENB 1LP9B 3MRPB 3TH3T 4B97A 2NX5A 1QHPA 4AGMA 1OPOA 2A1WH 5D7IA 2EE3A 3U7AA 1VZHA 5HDBE 3X3FL 5D71H 2HVKA 3JV4A 5C2BH 4RDQG 4YHMH 3D2UB 3BVXA 3B8SA 4F2MB 3N1PC 5AL0A 1FHGA 3ULAB 1VSCA 2O5YL 1OKEA 3U4AA 4MA8H 4DPRA 2D31A 4BFOA 1D2OA 3QR0A 2COVD 3U9PL 1ONQB 1TZIA 3MZTA 2VSMB 2XTJB 1DR9A 1XR8B 1IFHL 4GBXA 2JI2A 1ULVA 4L4TE 4UQDA 3BPNB 3VFPB 3KGUA 3MNVA 4YBQC 4MQ7B 5CJXC 1TOXA 4PGCB 3AGVA 5F7FA 4PJXE 5DD0H 3CHOA 3RBGA 4Z77B 3HI1A 3FQUB 5I1JL 3MROA 2O72A 1S7VA 2DTSA 3HMXL 1EDHA 4IBYA 2YD6A 5F9OL 3TS8A 1IVTA 2CA4A 4PV1C 3BKYL 2WK2A 1D9KD 4LMQE 4PUBH 1KJMA 1AFVH 1TMQA 1MRCL 4X8JB 4JPIA 5EU5B 1RJLA 3AUWB 4L3EB 2JKIS 1JK9A 3FPYA 5E8NA 1QW8A 3STZB 5D7KD 3D48R 4XP1H 3G9VA 2Z8RA 1Z5LA 2PMZA 3NFSH 1PX4A 3ARRA 4LSPL 1HQRA 1G4MA 3LPFA 3T0BA 4NC1C 3IMVA 4Z3EA 4HCRH 3ZTJG 5HPMB 2QTVA 3BUTA 1QSFA 4H25A 1MHCA 4FQJH 5F7WC 1H3GA 3O45A 2X44D 5BVJB 2V3EA 1ZDQA 4H8WC 3TBTB 5I8CB 2EH8H 2GTWB 4H26B 2CDEB 3TBWB 2KS0A 3MNDA 2YAOA 4L29B 1S9VB 1FVDB 3LKRB 1AS8A 1MWAL 4YEEA 3FB7B 3DJTA 4HYTB 1IC5H 4PJ9A 2VL4A 5JQIB 2G3ZA 1KWGA 1E65A 2D9CA 3E2HC 4GRLA 2IDUA 4GAJL 4WHTA 5CIPH 4ESKA 5GS0H 2JIXA 4HHAB 4Z78B 3UDWC 1NCGA 5BS0D 1KBPA 2IANB 2DPKA 3MTRA 4M61B 1JI2A 5HYQA 2VR6A 5TPWL 1DQDH 3N44B 1F45A 3K6NA 5BQ7B 3WIHL 4NUGH 1BG9A 1AZVA 2EDHA 3V5KB 4FKEA 4K23L 3B7YA 3Q9QA 4HXAH 3RGVD 1TQCC 5C9KA 1UGKA 5IFJA 3ZYZA 1FNSL 1F3DH 5C0CD 2QVTA 1I3GL 1UWEH 3DX6B 5LGJA 1CDYA 1G7HB 2J2ZA 2MPAL 3P9MA 4NLHA 3F6LA 3LRKA 4EN2A 4PGDA 4JL2A 4FNSA 3ULUD 1KV7A 3KYOB 2UXFA 3Q5TA 1J9RA 3AWGA 4NT6B 2OCJA 5KBNC 1QYGL 3GINA 4KUCD 5MENA 1P5UB 1ZK9A 4NS0A 1DVXA 1YEIH 2WWNA 4F9LC 3U4KA 3ZPDA 5I1CH 4UINH 3N6YA 2D7QA 2ZNXA 3AADB 4NGHH 4UTAH 1I7UA 1TEGA 1SZNA 4RH4A 2X6CA 2QJDA 1IAMA 1RFDH 4FQ2H 2EIBA 2BNQB 4QWWC 5B39B 2J55A 3MRLA 1XF4B 4U6XA 1TU2B 3GXPA 4YE0A 2Y0SA 2VDKL 5DT1L 2E27H 1K3ZA 5T3XH 4HHWA 2CO7A 3BDYL 4HKZA 4BD4A 1B0RA 3BLPX 3MLZL 3IAGC 4G72B 2YK1L 3A47A 4NBYB 5EN2A 5I5JA 1YECL 4Z7QB 2PXYB 2ZE0A 1VGEL 5E6ZA 1OAXH 2NYKA 2XZCH 1NGYB 3UBXI 4DVRL 1CLVA 4FXGC 3EOYG 1DQIA 3VXRD 4Z3HA 5FHBL 1KG0A 1G9NC 5DEFB 3KWVA 2QTEA 2WBWB 5HGDB 1CF8L 3T65A 3JWOC 1C5DB 4XXWC 4HUWA 2E9WA 5T1MA 3UGUA 5ES4B 1HN1A 5DFTA 5FYLL 3VQMA 43CAA 1A7PH 3KPQA 3R7QA 4UILH 4YN3A 3OMIB 4Y4HB 4JGMA 3BZEA 4NAMA 4LKXA 2PTTB 3LS5L 3QC5X 2X4NB 2IV9A 2YD3A 1GAFL 3AM8C 1CICA 1NANH 4IOSA 3DX8B 3JWNG 3IJYB 3UCRA 1VRSA 3LD8C 2UX6A 3MR9A 1A7NH 2X6VA 1JAEA 4Y2OA 4XMXA 5B3JE 4ZSOB 3ZIMA 4NN7B 3SO3B 4QPEA 4GJTB 1YNTF 1GZQB 1BQUA 3UC0L 4DGVH 2H5UA 4JN2A 3R19A 3QI9B 4HDIB 2UVEA 4HV8B 1GGIL 1PSKL 1U3JA 3KGTA 4K3DL 2QBWA 4PJBB 2VUKA 4NZDA 3VVWA 3O8XC 5LLIC 4JPVH 3CPLB 1IGFH 3MJ9L 4Y5XB 5E0FA 1N70A 3C60C 4YMPA 3T0AA 3UCQA 1L9PA 1YEFL 4D0BA 4LP4A 1M2VB 3L13A 1WFUA 1QR4A 4Y16D 5JMOC 2W07A 3MFGB 3WIFA 3C9NA 3OWEA 3JUYA 3VFMA 3GIZH 1U9KA 3F7KA 3EYSL 3O9WA 1JVOA 3F58H 3P4NB 4ANUA 2IAMC 2BVUA 3IFNL 1U8QB 1N8OE 1QKZL 1FL5A 1G9MC 2HLFC 3FQTB 3V55A 1KYFA 4FS0A 3G6JB 4RISL 2KQMA 4WGKA 1LTXA 4H1LH 1UHVA 4HX1A 2X12A 5I16B 2FBRA 1WUNT 2BINA 2GSGB 2HJFA 1DFXA 1R3HA 4OZHE 2LFEA 1O9VA 4ODTL 1SEQL 4Y1AE 4QUOA 2ZOUA 5E08L 4LASL 4WKXA 3A4EA 3WY4A 4FA6A 1FGNL 3LCYA 4DESA 1T1ZA 5AG8A 4MASA 4JG9A 4WI4A 3G5ZB 2Z92B 1CFNA 2E9JA 4X98B 1BEYL 1WZMA 1ZV5A 3LDBC 2UY7B 2DJ4A 2PABA 3V4VA 1NCNA 3OHMB 3GRWH 4WU5A 4APQB 3P0YL 1R3JA 5DUBB 5DD1L 2OYPA 2E7LA 1BBJB 4GXVH 2F9BT 4U6HA 5FCSH 1IGIL 3U7WH 2OJEB 2FX9L 4M7KH 1ZHKB 1NDMA 4HH8A 4JM2C 1VPOL 3EYFB 5FS5A 2DIEA 1NGWA 2OXHB 4K7PL 4MB4A 4NHUA 2CGYA 4R7DB 3ARBD 1QZ1A 4PW9A 2L0DA 3WGUB 1J88A 3MDJA 4DO6A 2BSCA 5T5FA 2EDJA 2X42A 3EDKA 1VCAA 1DQQB 3DMMD 2DEWX 1VFBB 3KPRB 2YQGA 4DCQB 4M8RA 3WL9A 5DGRA 3BH9A 1SDYA 3DX0A 1T6VN 1OCWH 4FMFA 1XQ4A 5FGCE 5I8EB 2WUBL 5DUPH 1VKXA 4Z7WA 3D18A 4DTGH 2Z35A 3O2DH 1JGDA 4Y19E 3AY2A 2O6EA 2VLKE 3QQ3A 4G6JH 4RNRA 2AJSH 1DVSA 2NCEA 2LU3A 3QYNA 3CWGA 1YAZA 3KPLB 1FPTL 4A6YL 3OG4B 4JHVA 1TYEB 5FM5O 3WTWA 4N0UE 3B3IB 3US9A 4KJWC 4H40A 3SDCA 1QOKA 5G55A 1Y6NR 2Q76B 4FQLL 4PRIB 5LNEA 4CC4C 2OPCA 2ZWLT 3VSUA 3F65A 1THAA 1A8ZA 4OI9A 3BDXA 1X5YA 3PWLA 4S1QL 4UDTB 4OKVB 3KPSE 5E94B 3ECQA 5ESQB 3O4LB 2X38A 3OV6A 3T3PF 1GZHC 4GS7B 3ME0B 4HP5A 4PJGE 4Z7UE 4ALAC 4B0MM 4U6YA 3PL6D 2HG0A 1EWHA 3EBHA 4NCC2 1U8HB 1QRNB 4OCNC 5F3HB 3ZT7A 5KVEE 3H7LA 2BY0A 5CLZA 3FO9B 5M7QA 3FU9A 3Q3GB 4PRPE 4XNAA 4KMTL 4XPGL 4QO1A 3Q2VA 2OYMA 4LARL 4DWHA 1BAWA 2P5WE 3BN9D 1G7IA 1DLHA 1XH3A 5IB4B 3NJLA 2J71A 1J5IA 4FHBD 4F24A 2XN0A 4NO3A 2H3NB 1HDMB 2RB8A 2R23A 1RUMH 4XP4L 3HNTL 1HNFA 5HHMB 2Z9TA 3X14A 1GA2A 3VI4E 2Q8BL 1LDSA 1NUFA 4AEHL 4I85A 2FH8A 3QXAB 4P2RB 2KBGA 2CO2A 2HN7B 3RNQA 1JWUB 1DVFA 3SIKA 4MWFA 2BSTB 5KVGH 3AXLB 4AYEC 3T0EC 4L37B 3CBRA 3BXNA 4EN3A 4N0RA 2XPGA 4CNIA 2EAEA 4PY7A 4PG9A 2QQLH 3QRBA 2ZICA 3EF4A 2PPCA 5C6PB 4JFFA 5KJ4A 1E8YA 2F8IA 3WFBL 1EJOL 2F7IA 1W8OA 1S9WA 1UG9A 4ZUWA 4N3TA 1H0DB 4LCIL 2Y7MA 3DK2A 3Q8AA 4JUSA 1E4WH 4XRCB 3CDGA 1FL6A 3HN8A 1SLWA 2FT6A 3PAZA 4QGTA 4UQCA 4NI3A 5IIEB 1CGWA 2DI7A 2B9AA 4HIJA 2X1PA 3HJ0A 1IC4H 3ZYOA 2WLIA 1HL4A 2XV0A 4DW2L 5E6UB 3EO9H 3QDGA 1U36A 4M00A 1J8HE 3JYBA 3QXUA 3RL2B 4QXTA 3VWJA 5TF1L 1V27A 2OTPA 1UUSA 1J8KA 1FQ9C 1GTNA 4C4BA 4PGBB 3TZVB 4XNUH 3QIWC 3MUUA 3TWCH 1R24A 5ANHA 4UF7C 2IADB 3MN8A 1CR9H 2E3VA 4ODSL 4X6CB 4MAYC 1UACL 2XN9E 4AENB 4K94H 4V1DA 2BNRB 5ECJE 1ZLVH 2EKSA 3RX8A 4ODWB 3QNYA 4KXAA 3ZYIA 1AQDB 3KJ6H 2CZNA 4M6OH 3F12B 3NIFB 3OM3B 5ITBL 5K1JA 3MCLL 4AMKH 4D7BA 1QP1A 3MV9A 4QHLB 3HC0A 5CFHA 1PIGA 2PYEB 2FYYA 2NZ9D 2BVOB 3AUVA 4P5TD 3II2A 4DN4H 1FI8C 1LGVA 4F37F 4MA7L 4BINA 3ZJAA 5KSVA 2K3HA 3QCVH 3G5YB 1FYTD 1ROCA 4EI5A 4EOWH 2YGVA 5LXGL 4JPSA 4ZMWA 3RPKA 1FF5A 4FZ8H 2OXGA 2N56A 3EO0A 2CIIB 2WAQA 4XO3A 3VXSB 4WUUB 3ZKMD 4G3YH 1QBMH 4JZJC 2DL9A 3N5AA 2DMCA 2HKFH 3FF8A 1JGLH 4IOIA 4YXHH 4X2UA 1ZLSH 3D34A 1WFIA 1EXUA 1A0QL 2VITB 5IVXB 1XGPB 4PWKA 1AKJD 4AYFA 4KH2A 4OCSL 5DI8A 3ZE0F 1FAIH 2WZ6A 3BIBX 4XNQA 3UBHA 3QORD 4WNJA 4LSTH 1RHFA 3S98A 3LXBA 1OQXA 4F7MB 1A25A 1V3MA 4DGIL 1CJYA 4XMKL 2XY1A 4B9JA 1FHNA 1J86A 3UACA 5K9OB 4XCFH 4XPBL 1K5NA 3HZYA 4WSKA 2D3JA 4ZUTA 4HOMA 3HC3L 3LKPA 4XP5L 2AXGB 1IGJA 2RD0A 5AZUA 4FXGB 4LMQI 3MXVH 2P49B 4OZFB 1T0PB 5JZ7D 3BX7C 1HAUA 5AZ2H 5L9DH 3IDGA 3RI5F 5CBEB 4YBLC 3UTSB 1A3RH 3W2DH 3KCPA 1JPSL 4YDLC 5IVNA 4QEGA 5DZLA 3RUGB 2FIRT 3TBVB 1AR1B 4R6UA 2CK0L 2BHYA 3RZCD 1NFDB 2R2BA 1KY7A 2I5YH 4HEME 2Y5TB 1W0VA 1MDTA 4AIZA 1CFSB 5I2IA 2P5EA 2R8SH 2Z93A 1C5BH 4AGQA 2ZONA 4MD4B 2IDTA 4OUUB 3D85D 4H0GA 3O3UN 2B14A 1DJYA 4MZIA 1YPZE 2ADGA 1A3ZA 3PWNA 4L0PB 4WWKA 5E95B 5BJTB 4GFXA 1KB9J 4ZTOL 3QH3B 3B2DC 1LQBC 1JV2A 5HHNB 3LZQA 2XV6B 3EH5B 1ZVYA 4K3EL 4NP4H 4I0PA 4IKJA 3EO1A 5TDPA 2CGRH 1KJ2B 1I82A 5AAWA 3HMWL 4ELKB 2BVPB 2C3GA 4UT9L 5ESAB 2ID5A 4TNGA 1B90A 3K0WA 3MXWL 5E2WH 1S4IA 2P8MB 3NP4A 4KBPA 1GGUA 1AHWC 4PCYA 5MEOB 1HL9A 2GEEA 1UQSA 1RIHH 3MRFA 3D39A 5I1IH 1U8KA 2VMFA 8CGTA 1FH5L 4OLZL 3TCTA 1PLAA 4L4VD 4FFYL 1OAZH 1QLEL 2NR6C 4HA1A 5C0FA 1AIFA 4ODUA 3U2SB 4N22A 4YH6A 3ARDD 3QUMH 4M1DH 2ITFA 5KVEL 3B9AA 5AVYB 2AI0L 3DYMA 3AU1B 2YOAA 4PCSA 3OMZA 4U1GC 1OCOB 4AK1A 3N1GC 4NKMB 4BFNA 4JCLA 3CDYA 4AZ8B 3SZ6A 4LLMB 3BD3A 1SXZA 4LP5A 4DO4A 1M6OA 2DLTA 1JFQL 2GSMB 3B3BA 3IMWA 3ULVE 4YWGL 2ED6A 2I9LB 1L9QA 3LNFA 4TLUA 5IBLC 5LXVA 5SWZD 4YHOL 4ZPVA 1BZDA 3NJHA 3CN2A 3BFQG 2O5ZL 5JO5A 4HWZB 5ID0A 4KVPA 5E00B 4JE4B 2WKGA 4GMSL 3O81A 4K71C 4DN3L 5F7HA 4NRYA 1UB5B 4PP2A 5JXAL 2ODIA 4HF5L 4GUCA 4WI0B 4X6DA 1Q9KB 3AWEA 4R0LC 1MCJA 3II3A 2P24B 4HWBH 3BVUA 4YDKL 4FXKA 4PJ7F 1O6SA 1X4ZA 3CN4A 2WBKA 2LVCA 2V33A 4JPQA 3VFUB 1ORSA 1F4XH 1H3XA 4WI8A 3DRTB 1VLXA 1E4HA 1A9VA 2APTA 1ZHNB 3M8OL 4PJDE 5C0AB 3UBXB 4JM2B 5A6MA 1DLFL 1MHPL 3T0VA 4HJ0C 3GZKA 5E8PA 5JIHA 3V0VB 1IAOA 1UOWA 1AO7D 3D52A 4FTVD 5I15H 1MCOL 1MPAL 1SVZA 2AQNA 4OCRH 4ONFH 2JLLA 3WBDA 1HKFA 3CZGA 5JLZA 1KT2B 3FK3A 1RJZB 1FBIL 1R5IA 5C0BB 1JTOA 1NM4A 5JOEA 4JO1L 4U1NA 4POUB 4JFDD 1BFOA 1T7YA 1AI1L 4LCWB 2QFPA 1E67A 4JO3L 2XYCA 3QQDB 1DCLA 2Z7UA 3BFWA 5BRZE 4JN1L 3T8XB 9CGTA 2CCVA 5HXMA 2CDGB 3ARGC 4NQDE 5F7LB 2YXMA 3ZTCC 2J4WH 2YD0A 1PW3A 3BZ4B 4I18C 3U0PB 3E6FB 2B3RA 1OAYL 2HFGL 4OGZA 2VZOA 1T80A 1KCUH 1WPCA 5BRQA 3VXUE 4KTEH 5E5RB 1T3FA 3FOMB 3FO2A 5F88B 2VDPL 4AYSA 4G1MB 1XF3B 5T1LB 3O0RH 4PU2A 3NABL 1SQMA 5C09E 1WS8A 2Q5BA 4G9FD 1RK1A 2R0WH 3FCSB 5AYTA 3Q6GH 3W9EB 1NC2B 4M62H 3K80A 5H37H 4PJCF 3O6FA 2DLGA 4TVPD 2EDNA 2YKLL 4AYGA 1GCYA 3ILPA 1AOZA 1NZRA 4PLOB 1CURA 2P28B 3DHJA 3S37H 1RSFA 2OMWB 2A9MH 1RULH 2Y3AA 5KUMA 1UJ3C 4JG1L 4S2SB 3WN5A 4XBEH 5CF3A 1H3VA 3WTVA 3E80A 4MX7B 5J12C 2HRPL 3QA3B 1TVDA 4BZ2L 4Y9GA 2Z34A 4DEWA 4G8IA 4JRYB 2F5BH 2RFXA 3Q43A 2ADIA 3AMLA 3B2UC 4XVJH 3STBA 2NY4C 3N55A 4GXUM 1JUFB 4YHIA 2NOYA 1JXJA 2WANA 1HEJC 1RU9H 1ODUA 3GF8A 4ZFOA 2LGNA 5GGQH 5CINL 2WZPA 5FF6B 3ZOAA 5J1SC 3ZRCC 3T0EB 1UKTA 2BJMH 3KWWB 5IFAH 2RGSA 2GUYA 3TASA 4ZFQA 2XWDA 1CXLA 2GIYA 3BJ91 3MCKA 4ONGH 3CVDA 5JNYB 4XOEA 4LHUG 1QPPA 1YJDL 5DQJA 4XN7A 3VXTB 1L9MA 5A16B 1Q9OB 4MJ4A 1R5VA 2MOGA 4IMLA 4X4KA 2NXYC 1CC3A 4PJ5B 5IMOB 4TSCL 1G9HA 2YA1A 5CNHA 5GHWH 1RXLA 4J6RL 2CO6A 3GMNB 4WW1A 2NY6C 3LVEA 1KXQA 5I1GH 1QLFB 4NX0A 2OMTB 3S9DB 2O5NA 2FH6A 4XOBA 2HT2D 3OF6A 4ELMF 2WXFA 3UH8A 5BRPA 1FIGH 2MOVA 1H8SA 4UQIM 4QOKB 4MMYA 1DQLL 4JVPA 1IILE 2YAEA 3ATDA 3MJWA 4OBRA 3NCWA 3E0GA 5HJ3A 4Q97A 1XGYL 1L0QA 1ZANH 2XPYA 3CE1A 3F7PC 4ZFGH 2OJZH 2EYTA 3BAJA 2YWYA 4P5KB 1OW0A 4FQXD 2XWTB 3WIIL 4YPGB 5KVMC 3KYNB 4Y89A 4IHOA 1W15A 4YFDB 1I9IH 1XZWA 1VF5C 1KCSL 2YO3A 3UAJD 1ASQA 3PG2A 5I1HL 4AUJA 4OAWA 5F9JB 4Y5YA 1M7IA 4KQ0A 2EE0A 2IPKB 5BMFL 3T2LA 2GC7C 1U2CA 3TO4C 1OALA 5F7DB 2WD0A 5D9SA 3LEYL 4BK8A 4OT1L 2WVTA 1GJIA 3IJHA 4JDZA 1Z2KA 1ZT7A 4OCWL 4P2OD 2VDLH 2QQQA 2WXRA 4XPHL 3ARVA 4YSTA 3TN0D 3GUTB 1NIFA 3ECBB 4M6MH 4P4KA 3OZKA 3V4UL 1P6AB 4WZ9A 3ZK0A 5TDNB 5TGBB 4PPTA 3T2NH 2VUYA 2AV1A 4LCUB 4KRPB 4E41A 2R2HB 1X44A 1RPQA 3MO1A 5C7XL 4XAWH 2XG4B 3EJPA 5IJVB 2BW5A 1BZEA