1ECZA

Protease inhibitor ecotin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
142
structure length
142
Chain Sequence
b'AESVQPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTMMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECOTIN
publication title Crystal structure analyses of uncomplexed ecotin in two crystal forms: implications for its function and stability.
pubmed rcsb
source organism Escherichia coli
molecule tags Protease inhibitor
total genus 14
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03974 Ecotin Ecotin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.550 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1eczA00
1SLVA 1FI8C 4IW4C 1EZUA 1ECYA 1XX9C 2Y6TE 1N8OE 1SLUA 1XXDC 1SLXA 1SLWA 4NIYE 1EZSA 1ID5I 1AZZC 1P0SE 1ECZA 1XXFC 1IFGA
chains in the Genus database with same CATH superfamily
4ZFZB 1TJHL 5TDPA 2Z8VC 4KTEH 4WO0A 4ZTOL 2G0LA 1EO7A 2BERA 4K7FB 1D5BA 3VFNB 4EEEA 1NCWH 5KS9A 5HTSA 4AGLA 3T04D 4MA8L 3WUWA 4GRWE 4OM0L 1UASA 1X7SA 1MFCH 1WFMA 2ZE0A 1P5UB 4UZUA 1IM3B 2NY5C 2R29A 1H0DB 3MJ9A 2DLEA 4OGYH 5DEJA 1N70A 2UXFA 3ILQD 5KYXA 3ESVF 1UG9A 5AOIA 3BX7C 2MFNA 4YSOA 2HKFH 4OCYH 1E9PA 4R4FH 1RK0B 5T5NF 5I5IA 3ULSA 5CUSL 3B43A 3FRPG 3M1CA 4X0KA 5D1XA 2O5YL 4U1SA 2HLAA 3L7FB 3Q8AA 4FG0A 2F53B 2IEPA 3KDMB 1BEYH 1GS6X 2AF2A 4Z7WA 3CLFH 4GMTH 3WNPA 3P9LB 3RNKB 3KLAB 4IS6A 2TRHA 5HDOA 1WWBX 4JQXA 2BMKA 3D39D 3FU7A 1NCGA 1EANA 4OF0A 5DJXB 4XNZB 5A2LH 3K6OA 4NO0D 3O4LA 1X6LA 4P2CG 3EFOB 1QLEL 1OAYH 1SUJA 2OMXA 2DI9A 2BP8A 2NX5D 2VITB 2VMCA 1NGQL 3SZ6A 4EDXA 1K4DA 4JFEE 1D9KB 1UKSA 1N19A 1M2VB 4GFXA 3ULVH 4QRPD 1ZY9A 4NFBA 5FYLD 2ICEC 4PJDE 3B9VA 3WFHB 4UUJB 3ZKMD 1WITA 3TO2A 1MCCA 4BFOA 2CUHA 3O45B 5CCKH 5JO5B 3OTTA 1MJ8H 4FKHA 2XVLA 4Y19E 2IDFA 3NIFB 3FOLA 1GGIL 1R6VA 4UU9B 3OHXA 3S96A 3BHBA 1RHHA 4RETB 1J18A 1HWGB 2WQSA 4HSQA 2CRMA 5C08D 2BNRA 3GI9L 4NZUL 3LRSB 1XF1A 3SDXA 5CZXD 3HC4H 1GC1H 5IHZB 4GINA 4O9HH 5J3HD 4KNSA 4P9ML 1IQWL 1JF5A 5E08H 3TZVC 2EDJA 5AW2B 1J1OH 2AEQL 5IMOA 1CLYL 1XF3B 1KEGH 1EHAA 3VQ1C 4HKXB 1Y7VA 3UJJH 3FB8A 5FHAH 5IM7B 1CFNB 1SYVB 2WQWA 2VDOL 4P3WA 1JPGA 2YZ1A 3OR6B 1U8MA 2VKXA 2QQKL 3CE1A 5BVJA 3FTVA 4OFQA 2XSKA 4KJYA 2CO6B 2HRPH 4AXWA 2BCKA 1UZ8A 5JQ6H 3CFNA 5ID0A 4B6ZA 4JRXB 4PJXB 2A9BA 3VD7A 4N8VA 3DMMC 1MG2C 4L29B 1BYNA 1IBYA 3KH4A 3VXNA 4DFIA 3H3KA 3VD3A 3O6LL 3SJVE 1JWMA 2VLRA 1J0YA 2R83A 3N50A 2K6WA 4H13C 4PJ7B 2P5WB 7FABL 3MOAH 1EO8L 3TCTA 4IOSD 2Q76B 4OLWL 4YEEA 4UNTA 1ES0A 2RD0A 3AZUA 1V7NL 4UT9L 4L4VA 1ETB1 4Y8DC 1OIOA 2IGFL 3KYKH 4NYLB 1AG0A 2XKNA 3PG2A 3QS2A 2EEDA 3SBPA 5GISL 1W0VB 1E9OA 3Q0HA 1MZYA 1DCEA 3UTSE 1ZA3A 1PTZA 2IPKB 3QEHB 4GKLA 4IRJD 4JM2A 2DDQL 3QCVH 4NDMB 3BZ4B 3FZUD 1PD0A 1NCAH 1VSCA 4Y1AD 3PWUA 4YJZL 4LSSH 4KWUA 1K8IB 3IDNA 5CJXC 3HNVL 2PETA 1NANH 1YAZA 4YH6A 4BE6A 5HYJE 5I16A 2QQLL 2FJGB 4EDWH 5D7HA 3OMIB 1NAKH 4HWNA 4S1DD 4FA7B 3UC0H 3D0LB 3ARGC 3L3HB 4NPKA 2NW3A 1RHFA 1UB6B 1ZTMA 2X1WL 3RIFK 2AEPH 2VO5A 5I6PA 2IO5A 1PVHA 4PJEA 4RGMB 3W81A 3FB7A 3QEUB 1MHCA 1G7JB 1KIQA 4JO3L 1ZSHA 1IGIL 3CNKA 3KM2A 5C6WH 4WHYG 3BKJH 1NKGA 5GIRB 2A74B 2HJKB 4ZUWB 3DVGA 5C0BD 2J5LB 5E5MB 5INCA 1U8IB 4QRRD 4JZJB 1F56A 3MA7A 5DO2C 1J05B 3QW9A 4HJJH 2WUBL 2JFCA 3CZLA 5EC1A 3GZKA 5EOQH 5FHBL 1V8HA 3ULVC 1J5OL 3QEGH 2E7LC 3EHBB 4RNRA 3K6SB 5T5FA 5EEUA 2BPBA 2BY0A 4G8GA 5JNYB 3LZPA 1YNLL 4HT1H 2AZUA 2DQGL 4M6OH 4AOFA 5KTEH 2YEQA 5J8OA 3ULVF 5D7IA 3FUNA 2JI3A 2HVBA 4WO4D 1FNSH 3TL5A 4XPAH 5BPPA 4X4ME 3RL1A 3BDYH 3ENEA 2OMVB 3GSOB 4O4YL 3GMLB 1BAWA 2CKBH 4NPYB 1PZUB 4JO1L 4FYQA 1UXWB 2JB6A 3D30A 3GKZA 3V9EA 4Z3JA 2ESVD 4A6YL 2QT6A 2FO1A 2CR3A 1OZTG 3GSUA 3FU0A 1CXLA 3VFWA 3KAAA 3GHBL 4EE2A 2AJUH 2YJQA 3LV3A 4DN4H 5JXEA 1NC2B 5ID1A 1D5RA 3Q3GA 1HJCA 4DUVA 5C3TA 1NAMA 4C47A 3QUYC 4KVCH 4PJBA 3VJ6B 1M3IA 4ZYKB 4MS6A 3B2VH 1W2KT 4X7CC 3LEVL 2X2YA 3LKRB 4MVBD 3GUTA 3AXLA 3GPEA 2JCCB 1V3MA 3DOIA 2VXTL 4AK1A 2FYVA 3CSYB 3B2UD 3ULVE 1A6WL 2Y7OA 5JTWA 3QHZH 1WFJA 2D7TL 3CC5A 2GHZA 2NNAB 1ETZB 1TJXA 2JMRA 3FRPA 2ZCHL 3LEXA 4X7SH 4F2MA 4G2AA 3DURA 4KXAA 1KPVA 1W8OA 5LBVA 4C8XA 1GOFA 3UOAB 4XCCH 2F54E 4JFFE 5HGDB 1B6UA 3M17B 3M46A 4BDVB 1TO4A 1SYSB 4UILH 2ZX6A 3HMWH 4JDEA 4PTTB 1HL5A 4Z7NF 1FRGL 5AG9A 1K85A 2GBUA 2V0AA 4M3JA 1LO3L 3DOSA 4U1KA 4WHCA 3UP1A 1C12B 5EORL 5CWSB 1FIGL 4NKMA 5I1GH 3S6CA 2HAZA 4M3KB 3VRJB 1F3JB 3OF6D 3I6KB 1DVYA 1B88A 2VR6A 4FQLL 3VO0A 5AW3B 2OV0A 1GZQA 3TA3C 4J5VA 4NNYA 4XCEA 2Y2WA 2NXZC 3QPKA 3T3MF 5F7NC 2AMGA 2C1OA 5D7SH 5E6SB 4NC1E 1S7UB 3FUJA 1G6RB 4I1NB 5DURB 2R0LL 3GMOB 4JBSA 1X5FA 1WDAA 4P46B 1P4IL 1LVEA 2E7HA 2FAUA 3PAZA 2R56L 3O9WD 3H7BA 1F11A 2GBTA 4ZUVB 4DSYA 5D8JH 5C09E 3C5ZC 4IHOB 3U30C 1U41A 4WWKA 3V5KB 1FNHA 1IAOA 2HT3D 3DHMA 4MLIA 1UWEH 2QPSA 3VXSA 5ABZA 4DPCX 2H32H 5AWNL 2PPCA 3QFDB 3ML8A 1XZ0B 4Z7NE 3QNXB 1TZHB 3KCPB 3WXWH 3QZPA 5EWIH 2Q8AH 3RAJL 4URTB 3TWYA 3KLQA 4WWNA 4GKNA 4OZFH 1U8NA 4D9QE 5FO7A 5HHME 4R26L 1P1VA 4DKDC 3QXUA 4S0SD 3WFCH 1UCBL 1GZHC 4F7PB 4J3OG 4PJGA 5E0FA 4PU2A 2Q2LA 1CL7I 3BAJA 1RZJL 1CG9B 1QRKA 2P28B 2FRGP 3T3ME 5J7CC 1ITCA 1A5FL 1QPXA 2PO6C 2W07B 3DRTB 5DUBA 5IB5B 4JRYB 4MFHA 4Y16B 3UTPD 1CDBA 3CPUA 3BC9A 2MCPL 3NJJA 3F01A 4XOAA 2Q20A 4D0BB 1TF4A 2V5TA 2WXPA 4OFDA 1OV8A 2ZAHA 4OZ4A 2V2TB 4H1LH 4HLZG 3V6ZB 1BWWA 3IFLH 2XT1B 3TJHD 2CKNA 3GHEH 1MHEB 3OKDA 5IW3A 3SO3C 2KI6A 1FSKB 3T6ZA 1COBA 1S7XA 5D9SB 5FB8A 4LGRB 1A6ZB 3BUYA 4JR9H 5EZIH 3QUMB 3TF4A 4MMYA 3BE1L 3Q5OA 3KLSA 4JFED 4L37B 3X2QB 1RIVH 4FFTA 1N67A 1XO8A 5HDWA 5F0MB 2DOCA 2NDGA 3TO4C 3ASOB 4HUNB 4FLHA 3VMNA 1XAKA 1XD1A 2VDLB 4LMQI 4J8RB 4QEGA 2WGNB 2O6FA 4Y19D 3WS6C 5D2NC 2IANB 4IIQB 1I7ZA 4KJPC 1D5ZA 4QR7A 1MIML 4YE4H 3R06A 1PG7L 3Q5YA 5BRZD 1NIBA 4KHTL 5K9QI 3H0TB 1YMHA 1I7UB 2WOYA 5AD0B 3S35H 2E4FA 3FTSA 2FX8L 2OM5A 3IDMB 4ZMLA 4EMZA 1YEFL 4FZ8L 5TDPB 5KOMC 3MNZA 5E9NA 5L7XH 3VFRA 4UT6H 4YVUA 1D5BB 5B3NA 5KS9B 4G6JL 5L8LB 4HUMB 4NJ9L 5LHDA 1LL1A 3WUWB 2B1HL 1IU1A 3LH2L 1A6VH 3WN6A 3GTNA 2CCVA 4WK2B 4WEUD 3DSNA 2VL4A 4A7GA 4PLJC 4N0YH 3NBNA 2EO1A 5KYXB 4KZDH 2X3AA 1FVCA 2V3EA 1BMZA 1S7VA 2Y69B 1E9PB 4LCUA 4JMXA 4ANVA 4X0KB 5D1XB 4CSSA 4ZD3H 1CDIA 1WAAF 2DWXA 2ERJB 2HLAB 3CZJA 3IJ8A 4U1SB 4YSSA 5AAPA 2IPTH 2N4IA 3ZUNC 3NCEB 1TTBA 1UWXH 4Z3IA 5G2NA 4OT1H 4Z7WB 5E2WL 3KXFE 1UWXK 4LSTL 5G4MA 3U4AA 1BQHG 2WBJA 5CBEA 3SJVD 4KKLC 4IS6B 3LRMA 5DQJA 1SLWA 3H42L 3L54A 2BMKB 1DVFC 4PI0A 1AKJD 3FU7B 2EDHA 5C0DA 1JNJA 3NEEA 3O4LB 1B0IA 5D2NE 2EINB 1GMEA 2OMXB 3FTGA 1CXFA 2BP8B 4ZMZA 3AABA 2WTRA 4EDXB 1K4DB 4PVMA 3RDTC 1FI8C 2Z35A 1PY0A 3CFBA 3OPUA 3FCUB 2ODIA 4PW3A 3S48A 1MREH 1QBAA 2JJWA 4FG6C 4JO4H 5FR3A 1VENA 3AM8C 3UTSD 4UV7L 1AE6H 1RUAL 3TO2B 1YEIL 2YKLL 1AYOA 2H9GA 3O4OC 4IBSA 4MZIA 3FOLB 2QGCA 2YKKA 5E6UB 2VO8A 1A6AA 3OHXB 4HKJA 3BHBB 5B8CA 1LEIA 1RHHB 4KDWA 4GUQA 1R17A 4X6FA 1IV8A 1A14H 1KV3A 3CGTA 3DHUA 4X5RA 3TV3H 4N2KA 1MCOH 2NOYA 2BNRB 3G04A 4CBPA 5C7XL 1CBVL 4H8WL 1WAAE 2BVTA 1P9MA 4KKBC 3CVDA 1YC8A 5HYJD 3SDXB 2R59A 4DESA 4HHWA 1MG3C 3CLEH 1VCAA 2RA1A 4L8BA 1ASPA 3ZT5A 2QLYA 4I7ZC 5E5LA 2Z7WA 3UMTA 2VDNB 4OD1H 3QC6X 2EH7H 1E65A 3L4ZA 3DMMD 4UOW1 4S1RH 3FB8B 2EECA 3OVUB 4M6NH 5C0AE 3PP4L 3TWCL 2Q3AA 4HPOH 3QORA 5BZZA 3JWOL 2GJ6A 3ZQXA 3ZQ9A 2HH0H 1JPGB 2FLMA 2OX5A 3GEWB 5ILTL 1U8MB 2HJFA 4GMSL 3O8XC 4QT5A 5BVJB 4A04A 1UKTA 5BJTA 4KJYB 5SWZA 4AXWB 2BCKB 1UZ8B 1Y1UA 1PZAA 2VQTA 1U0QA 2HYMA 2YAQA 3H9HA 3MCLH 4L1SA 4WHDA 3W56A 5ID0B 4I0KA 4N8VB 4Y4KC 1NGWA 1XGUA 4JHAL 3SDCC 1YYLL 5C0FA 2MKWA 1JZHA 4AYEC 1JWMB 2WWKT 3P2BA 3WY4A 2VLRB 5B1AB 4XXCA 4HWZB 2OR9L 3C2AL 3H6JA 5A1AA 2IBGA 3K46A 1TTRA 1OSYA 2ADIA 5B1CA 4QJ4B 4OFIA 1B0WA 1E7UA 4E9LA 1P6WA 2IIJA 2LV4A 3MMEA 1ES0B 3E0GA 4KAQL 4ZOAA 3NSFA 2DQTH 4L4VB 3GWJA 4WI9A 2Q86A 4B53A 4YHLL 2XKNB 1CJYA 1NIDA 3PWLA 2CMRH 1E9OB 1H5BA 1ZD6A 3RWIA 5KSAC 3UIYA 1ZA3B 3ARGD 2YO3A 3RGVC 4OZIA 1OGTA 4JM2B 3VGBA 4WU7A 4PB9H 4BEIA 4YL4A 4ZMOA 5GJTL 4FQPA 1JHLL 5T33H 1LQSR 3ARRA 3EH3B 3J2PA 3HG2A 3PWUB 4K9EH 2RQEA 3WFEH 3IDNB 1EZSA 1UD8A 1P7QA 3M1BA 1AD9A 5I16B 1YRKA 5EEVA 3WTWA 2VERA 2Z9TA 4N2HA 5DO8A 2VM3A 1EH9A 5FFLA 1TIUA 3NRQA 2AABL 2WXQA 2NW3B 4ALAH 5K93A 4BZ1H 5DO2D 1R3HA 3REVA 2GSMB 2XI9A 3G6JF 4PJEB 3ULVD 4Q7DA 1EZUA 1KV7A 2RCSH 3KBPA 3H9SA 1ZE3H 2K1MA 1MHCB 1SM3L 3IU3A 1KIQB 4OGQC 1MDAA 4LARL 4MCMA 5E4OA 2WIIA 3E2HC 1SHXA 1UYWH 1CDGA 1AIFA 1VFUA 1YN7A 5BMFH 1N7ML 4NIKB 5C2BH 5F7HA 5JYMA 3DVGB 2CKBA 3IPEA 5H37H 3WS3A 2OZ4H 2WBXA 4K94L 4JFFD 5INCB 4ORZC 2Q87A 3VFPA 3MA7B 3FSAA 3GIVA 5EC1B 4G42A 4A2GA 2F7OA 3FYEB 3FAXA 1GYAA 4NXSA 4FQIL 4IHBA 1HZHL 4RNRB 4PTUA 3U9PL 5EIIA 1DSYA 1QSZA 4G8GB 1A1MA 4DGVH 4M8QA 3EYSL 2XWJA 2H0PA 2FGWH 5CSBA 1MFDH 4YDKH 5D7IB 2BWQA 4UTBH 5HD8C 3QI9C 1AQKH 1NCTA 3KBEA 1CFVH 2E7CA 3WN5A 5D1ZI 2FNBA 1YMME 3K5RA 3G6JE 2JB6B 4U1IA 4YR6A 1YO4A 2D9CA 2D3JA 3VA6A 4IU2B 1KBGL 5EUOA 4MJ2A 5I0XA 3GSUB 3E1F1 3VFWB 1IGML 1ZT7A 1K5NA 2MMXA 3CK0H 3LV3B 5C09D 2NT1A 4G6KH 3L9BA 4LLAA 5ID1B 2BP0A 3OAUH 1XHHA 3Q3GB 1HH6A 1NAMB 3RBGA 4PJBB 5C0EA 1HCYA 4ZFOA 1BF5A 2YS4A 5DUMH 3TBWB 2P80A 2OJZH 1NBQA 3GUTB 1HQ4A 3AXLB 4AL8H 4W9ZA 4D9QD 1EHXA 5HHMD 1JGIA 3DSFL 1ULVA 1WAEA 2VSDA 3RGBA 1BYOA 3IDIA 4DTGL 4HGWA 3O0LA 4PG2A 1TUPA 3CU7A 3FRPB 1G87A 3CX5J 4J3BA 1IKFH 4I1RA 4FMFA 3LEXB 4F2MB 2VXVL 3DURB 1KPVB 3LHPL 3HE7C 3HZYB 1AR2A 3AREC 5KG9A 1QKZH 3QUZC 1BQHA 1EUUA 2B0SL 3GHPA 3N44B 4S2SB 3ULUH 3TA3D 1U3HA 2D7PA 4HCRA 5GHWH 2OYKA 5FPIA 5IF0A 2NXZD 4JDEB 1Z1WA 3VXME 4EQ3A 1YNTF 2XZQL 4Z3EA 2XLLA 1DJGA 3DOSB 4LPVA 5DJ2A 3S3CB 1L7TH 1OCWL 4NKMB 5TF0A 2HKHL 3ZL4H 1AHWA 4HHAA 2OMTA 3MAWA 1CPUA 3K2UH 3VGAC 4F91B 1BLNA 3C5ZD 1GZQB 4NNYB 4XCEB 1QTPA 3I84A 3TYGH 4GQQA 1H8NA 2ICWJ 1BJ1J 4NEHB 3HMXL 4C4KO 4TQPA 3BKCL 2C1OB 5JIMA 4HUXA 1E4KC 2CNZA 4NQTA 2ZYHA 4EQ2A 3F05A 4OZFA 1NM4A 3N41B 1SXSA 5GZNC 3KPSD 2QADC 3QYCA 3MBEC 2P43B 2PXYA 3L3GA 4ALAC 4Z78A 3SOBH 4NUPA 3L13A 3MXVH 2PWEA 3H7BB 2BIHA 1F11B 4KFZC 3WENA 4XNYH 4ACTA 4MX7A 2EEFA 3SPGA 3ZE0F 1GR7A 5BV7C 5KUKA 2MOVA 4OLVH 3ZQWA 1IAOB 2A5UA 3VXSB 1QBMH 1TPXB 1F4WH 4MB5A 4YHOH 3ZIMA 4YLCA 1D6EA 1L0YA 2CE6A 2PO6D 2PUQT 3GMRA 3TS8A 1E3ZA 3MLPA 3QWNA 4FP8H 3W9EA 4GKNB 1KDIA 5DYOA 2V8MA 3VFGH 1U8NB 3KHQA 3RPKA 3VVVA 2PP9A 2Y1VA 3BI9X 2ZXAA 5FO7B 4QTFA 4ECNA 1L6ZA 5AKRA 4FNSA 4GXUM 4PJGB 4YSDA 5KBMA 2FB4L 2APSA 1INDH 4BRVA 4F8LA 4U0QB 2YAFA 3GF8A 2LHAA 2MPAH 4AZ8B 5DUBB 2VE6A 4N2OA 3OXRA 3QEQE 3OB0K 1V7MH 4CMHC 5EF1A 4CVZA 2BXZA 4O51A 5E1HB 4E9VA 2FYYA 3KXFD 4ZO6A 3HG3A 4OZ4B 5DHVA 1LGVA 1I31A 3ZE0E 5F6IB 3TO4D 3QQ3A 2WZPA 3H3BC 1OE1A 3FHAA 2P5PA 2O5XH 3OKDB 1OSPH 3QPXL 3VNYA 1S7XB 2X09A 5CIPH 5FB8B 5FW8A 3BUYB 3SGEH 3IGUA 5IZ7A 2N7BA 4L23A 4MMYB 3MI6A 5D1QA 4H8HA 5JMOC 3DYOA 5IUSA 4GG6A 2EICA 3VTTA 3M8OH 1E5ZA 1KLUA 4TSCL 2AK1H 1RFDL 2HFTA 2B9BA 2X3CA 3CPLA 3EDFA 4K2UL 1XGYH 1RP9A 2XQYK 3P73A 1I7ZB 2EAEA 1DVXA 1D5ZB 3NCFB 1SFHA 1PLGL 3FQ1A 3R06B 5H2BA 5L2JA 3IJSA 2W0KA 1YMHB 1IJNA 4KUCF 1F4YH 3ZK0A 2XV3A 3JVGC 3KW7A 4FE9A 3CFCH 3ZZQA 2Z3FA 4KNUA 4JG5A 2B3IA 3MNZB 3KPTA 1M4KA 5FYKH 5TTRA 2F7PA 3WEAA 3NDZE 3VFRB 3TCXA 1IC4H 1CLOL 4DP6X 5C0AD 2KZ1B 3RE0A 1MI5D 3UG3A 3H1ZA 3DSNB 1YYCA 4GAFB 4DP8X 5I0YA 2LU3A 4KKLD 2HWZH 4E5XG 3ZR6A 3E8VA 2WN3A 1DVFD 1FVCB 1S7VB 1WA1X 3BXNA 4UIMA 3FQRA 4LCUB 4IJ3B 2CBPA 4MCZA 2MNWA 3ZKQD 3WNIA 3QIUA 4XP1L 3SB3A 3V4PH 4QWWC 1HCZA 2EXTA 2DWSA 1G1CA 1ZV9A 4HF5H 1O6VA 4OUUA 2CJSA 3OLEA 3RDTD 3SPVA 1BWMA 2WLLB 3PL6A 1H3VA 1AZZC 2WBJB 4FG6D 4JFQA 5CBEB 1MLBA 5DQJB 3SGDH 2KHAA 3ML9A 3QA3A 3U9WA 5C0DB 2AJSL 4Y5VC 3MV8D 1QR1A 3FTGB 4HJ1A 1YN6A 4UMGA 5T3ZH 4GO8A 4A7UA 1KTCA 1QTYT 2WTRB 2ZX5A 3D12B 2Z35B 3CFBB 1JPSH 4LSRH 2CLRA 4NCC1 4P8QA 2O4EA 4OJFH 1KIPA 3S37H 1RVFL 4R90L 4MHHI 4QRUA 1MRCL 2IXQA 3DJSA 1JSYA 5KJ4A 5FAAA 4IJTA 3NFSH 1OTUD 5J12B 3G08A 2H9GB 5FC9A 3T6VA 3MU3A 5B8CB 1A6AB 4HKJB 1XSOA 1LEIB 4UV4H 2VMJA 4M48H 4X6FB 1IEBA 3CVIL 4UQBA 4FLQA 3G04B 15C8L 5D70L 3BAEL 2OR8A 1P4BL 2ZT9C 4JHUA 4ZQKA 4HMDA 2EDDA 5LGYA 3PYCA 2VDKH 1YCSA 3O8XD 3QK0A 4L8BB 3S34H 1G0DA 5E4EC 1Z9NA 3O2DH 2QSCL 5I6XC 1CD9B 2Y7MA 1NCCL 3CVHL 3F62A 4Y4KD 4MCYA 2OYLA 3RWEA 4F57L 3GI8L 4U3XA 3QORB 3EOAB 3SDCD 2GJ6B 1M53A 4JZNA 1NMAL 4GEJA 3UZVA 3B8YA 3GSXA 2OX5B 2HJFB 1XR9A 3M07A 3OSKA 5LGKA 4XN7A 4QT5B 2B4CC 3IFOA 3S3DB 4W4OC 2WZAA 4HS8H 1AGCA 5BJTB 3UGUA 4FZEH 3LDBB 4R83A 4Z7UF 3JWDL 5SWZB 3PAYA 5J57B 1ZJBA 4ODSH 4NQCA 5C97A 3LPFA 3EOTL 3LS5H 4KO7A 1TZGH 4L4JA 1NGWB 1MF2L 3BZFB 1EAJA 4OCSL 4HX1A 1XGUB 1F2XK 5CGYC 5C0FB 1GY2A 1YUKB 3MREA 3F00A 3F5WA 4AUJA 5KSAD 2V2XA 4J3UA 3RGVD 2ZKHL 3S7GA 1T3FA 1T7ZA 2ADIB 4Z7VA 2MNUA 3NJHA 1ET5A 2BVOA 4G5ZL 3B8SA 4L9DA 2F8XC 3QH3A 3MMEB 1JRHH 3Q2NA 3BSZH 2NMSA 4XP6H 3MN8A 2WXMA 2Q86B 1YMMD 1W72A 2DY2A 2XIDA 3CH8A 3BUPA 4GAYA 4HETA 3IMTA 4H8PA 3AG4B 1X5KA 3QYNA 2X5PA 3PWLB 3N1PC 3U7WL 3HW7A 4OIAA 4QYOA 1H5BB 3GZOA 3ARBC 4H8VA 3RWIB 1A6TA 2D03L 3H9ZA 4OZIB 4L18A 4AV4A 1OGTB 3RFZA 4WU7B 4V1DA 1EVTC 2RALA 2NRDA 1NDTA 4HJIA 1NM9A 3V8OA 1ZVNA 4Z7UE 5JW3L 5H37A 4XPGH 1NBYB 1RJCA 1P7QB 1WK0A 4PB0H 3LIZH 2OZ4A 3S36L 3IFPB 1AD9B 3M1BB 2W0FA 12E8L 3OX8A 2VXUH 4DVRH 1I3UA 5LNDA 1BVNP 3ALPA 2OCJA 2WXNA 1N6VA 4ONGL 5GS0L 2PR9A 2PR4L 1R3HB 1S5IH 1PMYA 3REVB 3SE9H 3W9DB 4JM4L 3ASNB 4X9YA 5C70A 2YEVB 3H9SB 1SY6L 3IMBA 2NT0A 1MY5A 3IU3B 4K3HA 4GI9A 4Y2OA 3I02A 4PP1C 3ROOA 1B2WH 3HUJA 2WIIB 5CZRA 3UEZA 5KWYC 2WCPA 1XH1A 1T1XA 1AIFB 1YN7B 3LQAH 1RXLA 4JKPL 5BRQA 5ABAA 4X9IA 2CKBB 3WS3B 4ZG1A 1XSJA 3FTYA 3D9AL 4G7RB 1PF3A 5HD8D 4TNEA 1Q1JH 3QI9D 3RRQA 3VFPB 2TSBA 3SN6N 2HTLC 3GIVB 2WJ7A 3VXQA 4G42B 2Y1YA 3BDXA 5KJRH 2KQMA 4I9WE 1E2VA 2JK5A 4GLRI 3VXMD 4LIQL 3HE6C 3MBWA 4PTUB 1I8LC 1U8QA 5EIIB 2M1KA 4S1SL 3T65A 1A1MB 2A3TA 4M8QB 5FYKE 1FNGA 3GBEA 2CK0L 2XWJB 4LCVA 5A2FA 4NUGL 4QRQA 5HI4C 1QLFA 2R4SH 4B9GA 3P3TA 1MUJA 2CGRL 3ARPA 4ZUTB 3EF4A 2QLVB 4JY5L 3WFDH 1JZ4A 1LMIA 3WN5B 5I9QB 3U9UA 2IG2H 2FWUA 4GW1A 1NSNH 3MRBA 4FQ1L 2XN9A 3FCTA 4JJHA 4U1IB 4YR6B 3WE6A 3Q8FA 4NSKA 5F8RC 4XVJH 5DEGA 3KR3H 4HZAA 5EUOB 2CXKA 3FW6A 1EAPA 1ZT7B 1K5NB 4LNVA 2X88A 1J88A 2EH8L 3EJSA 3X12A 1ZHNA 3HS8A 3G5YA 5JZ7C 2BP0B 3D4ZA 1E4XH 1A9EA 3HI6L 5IJVA 2P26A 4QD2E 3S36X 3P69A 4F37F 1EJOH 1F42A 5BQDA 3DTDA 1ZDQA 5C0EB 2WWMC 2N59A 4N8CH 4ZFOB 5B1JA 1BQLH 4LEXL 3VNZA 2JH2A 1HNFA 4PRIA 3ARED 4EN2A 2R29L 1KGXA 3O3UN 2BY1A 3MJ9L 3QUZD 1HQ4B 1MW2A 2R0KL 3ZL2A 2WXLA 1AI1L 4TUOA 2HFEA 4K8RH 5GQBA 2Q10A 3GD1C 5EO1A 5TQ2H 4IKKA 3BSHA 3IDIB 4HGWB 3MV01 4LASL 2F9BT 3FT0A 2R9HC 1ZLEA 1Q90A 5F7BA 3L95A 4TNWK 4P48A 1N64H 1N0XL 3L08A 3E3QE 4I3SL 1J5DA 5KG9B 2YPKA 5JDSA 5L6YH 4QY8A 2Y7QB 1BQHB 4DGUA 3QEQD 4GQ9L 3ZDWA 3EBGA 4M62L 1U3HB 3C2SA 4BQBA 5IF0B 2V5SA 3Q5TA 4N20A 2ITFA 5F7MC 2VTFA 4ZTPH 4H20L 5J1AA 1A4AA 2APXA 1T1ZA 4BQ8A 5DJ2B 5GZND 2QADD 3HRPA 4XVUC 5L8JB 1AHWB 4HHAB 2OMTB 3FYIB 1QHPA 5EEWA 3Q48A 1BLNB 4HLJA 2RIKA 3T8MA 4I3RL 5IQNA 4G8EA 2VMFA 4DGIL 2VR4A 3DOHA 3SBWA 3ZE1B 4QRPA 4HUXB 5AVSB 1RURH 1S3RA 2F1BA 4A1RA 2FUTA 3A6BH 3L3GB 2PXYB 1G1OA 4L1BA 2WQAA 4Z78B 3QR1A 1H19A 4LSUL 1KBWA 4X4ZA 1QRNE 5L4MA 3LPOA 3IXAA 3QQXA 4MX7B 4IYKA 5HGGS 4AC4A 5C08A 4PBWD 4LSQL 4J2QA 3W82A 4ZAKC 2QKIC 5TE7L 5ACLA 4EZKA 4A2HA 4YHYC 2WZ0A 3LQAC 1AAJA 2WW8A 1HHHA 1JPST 4KOBA 5HI3C 4X42A 1ZANL 1A7PH 4JMNA 4AK2A 1IIKA 4HLEA 1D6EB 1QSEE 1IFGA 2I7SA 3GMRB 2AXJA 1WFOA 1I7RA 3W9EB 3WFBH 4NENA 4LHJB 3LB6D 1E40A 1ONQA 1JE6A 3DLQR 5DYOB 5GGQH 4L8SA 3GC3A 5I74C 1SUHA 4JKWA 1C08A 1UM5H 1RU9H 2HFGL 3MGTA 1QO3A 1XD0A 4UDTA 4X6CA 4XVTL 3NACH 4LQFL 2X44D 4N2GA 1SJHA 5CIPA 2IDCA 1FZMB 5CGTA 3O6KL 5IR1A 2YA0A 4FA6A 5IK3A 3LMJH 4YWGL 1B9KA 1SXZA 5AZ2H 1ZHKA 2VE6B 3OXRB 3PQYE 4KTDH 3EFFA 5ELIA 4GFTB 4CVZB 4O51B 4FA8A 4PM1A 5ISZA 2FYYB 1UOWA 3VSVA 1NLBL 2V3FA 5DHVB 4YK4B 4K3EL 3QQ3B 2D4DA 3OKKA 5B38G 3QCUH 1CIUA 1ND0A 4JO5A 3CMOL 1UWFA 3UAJA 5J13C 1PDKA 4KUCD 1FE8H 3HC3L 5BNXD 1H3TA 5D1QB 5F7WC 3CIQA 4GG6B 5LCVA 4XO5A 2WBWB 4QXGH 3MCYA 5D4QA 5I6NA 3JXAA 2AQQA 2DQJH 4TM9A 1T4WA 1KLUB 1TTFA 2PMZA 2X4OA 1CB4A 3CPLB 4N24A 1D2PA 2D4FA 1AO7A 4JN1L 1RZGA 3THML 4UNUA 3P73B 4Y1AA 1E50A 5DSCA 2FQEA 1ZGLA 2IQAA 4ENEC 1AQDA 5H2BB 5L2JB 3IJSB 4ZO9A 1FN4A 5TQ0L 3WD5H 4F9PA 1NCOA 1MVFA 3V4PA 5E0QA 1I1RA 1Q1PA 4G6FD 1JJUA 1NFAA 4D9LH 1KJ3L 1XV8A 2B3RA 2X1QA 1XL4A 5LBSH 4XC3L 2EKSA 2PPFA 3BKYH 3U2IA 3MX0A 4QWWD 3DJZA 2VDRL 1UM4H 2EVIA 4JPVL 1JZ7A 3OAZH 2A0LC 3SODB 3OAZK 4BV1A 3H3PH 5IQ7L 5KVGE 1EAQA 5HBBA 2ENJA 3BXNB 4UIMB 3FQRB 4MCZB 3TM6A 3OQ3B 3IPBA 3BWZA 3QIUB 3MSPA 4U49A 1RUKH 2ZKXA 4X8XA 2VZ3A 5I71B 1NQBA 2YQGA 1KCVL 4PD4K 3VFUA 4OUUB 3QHFH 4GT0A 1FFOA 2EO7A 4GXVH 3SPVB 2EEBA 5I28A 4HXBL 1YC7A 3PL6B 1WT5A 4JFQB 1X6NA 4XO9A 4PRBA 1MLBB 1A0QL 1AGBA 2A6KB 2FSDA 3QA3B 1JDDA 1KJMA 1WZ1L 3FT4A 1XGQA 2JCWA 1T7YA 2X6BA 2A1WL 1IBGL 1QR1B 1LYQA 4JKNA 1OP3H 2DJMA 1YN6B 4MDJA 3TC9A 1OP3K 1ZKAA 4PI2A 5F8QC 3CZGA 2HMIC 2CLRB 3T6QC 1KIPB 4QRUB 1CWVA 2IXQB 2KZWA 1ASQA 3MROA 3N06B 4XPBL 3PRZA 3G08B 4JFPA 2IOIA 2V5YA 3WHXA 4DOHE 3FQXA 4ZMVA 5DUPH 5DJ6A 2X9WA 1MFAH 2Q7YA 1I8KA 1Q8MA 4X6DF 5IY5B 1JV5A 3U4KA 3HN3A 4R5TA 4ZQKB 3UC2A 3V2AR 4DCQA 4ODHL 2V9TA 4NRXA 4JFHD 3ATEA 5CLYA 2EYSA 3KJ4C 3U36A 2X05A 2EJ1A 1PX8A 3RWEB 4MCYB 5LWYL 1A2YB 3BKML 1SXBA 6CGTA 3UJIH 1Z3GH 4JZNB 5IBUG 3UZVB 3GSXB 1HINH 2ZIDA 3MOBL 4RMQA 1XR9B 3P0YL 3FULA 3IFOB 3AITA 1MCLA 3RB7A 1AGCB 2MH4A 3ABMB 3LIUA 5E51A 4XE0A 3FUFA 2JKNA 1BZ7A 4NQCB 2Q1EA 4DEPC 1E5CA 4I9WD 3T4AC 5IESL 3PJNA 4HX1B 2DLIA 1HKLL 2YHGA 5I1EH 2GABA 4YUEH 2J4WL 4K3DL 1NJ9A 4DK6A 3X11A 3MREB 1UJ3B 1WLHA 1R19A 3F5WB 5F7YC 5KYYB 3ARBD 2V2XB 3US0A 4X6DE 1T3FB 1OTSC 2VXQA 1X5JA 3UYRH 4Z7VB 3MV9E 4TRPH 2BVOB 1KN2H 2XTJC 5CN1A 4YBLC 5KVFH 3QH3B 4PGBA 1CYWA 3P11L 5ADPL 5EF0A 1W72B 3CN2A 2CDFA 4GAYB 1OP5K 3LKSA 3UTTE 4P3CL 1GJWA 3ABKB 1PSKH 1RZ7L 3ISWA 5EH1A 1BFVL 2J44A 1DBAH 4AEHL 1A6TB 3OZLA 5H4ZA 3BPOC 1XMWA 4QF1A 3RFZB 4V1DB 3RY4A 1T5XA 4LP4A 1FGNH 3PY9A 1YVLA 5I30H 4IMKC 1CFQA 3JWNH 2F19H 2B5IC 4PP1D 5AVVB 2FBRA 1JTPA 2KDGA 4Y9CA 1N6QL 1O7VA 1RZKH 2W0FB 5HHQA 3P3UA 4BXVA 4I5BA 1ZK5A 1FFPA 1UXMA 1J1PL 2FHBA 3F84A 3SZKC 1HX0A 4W93A 4GP4B 3WKNA 1DVTA 2JNZA 3QHTC 4ZXBC 4AVKA 4CKQA 2HTLD 3S3JA 3VD0A 1HIMH 3ES6A 4D8PA 4LCYA 3TT1H 2VDQH 2I07A 4HU8A 3MYJA 3HE6D 4Y2OB 3I02B 3BESR 5F96H 3ROOB 3V6BR 1EDHA 3HUJB 3LXBA 2Y5EA 1T1XB 2ZPKH 1KYUA 3F7YA 4HIHA 5HI4D 1TZAA 4ZW7A 2XOTA 3VWJC 1BZQK 2X1PA 3AGWA 3WTVA 4FL4B 5EU7C 1DYZA 3NSXA 1AIZA 3BO8A 3ME0A 1EDYA 3VXQB 2JK5B 4KRMB 4ZFGL 3MBWB 2BWIA 1U8QB 1BQRA 4M9PA 4NN5B 3V5DA 1R5VA 4F9LA 2CGZA 3T65B 2J2ZA 3RY6A 3GIZL 1FNGB 1B0GA 4ZMQA 2NR6C 1WC7A 4QRQB 5JR1H 1OE3A 1QLFB 2VJ0A 1MUJB 4XZUA 5D93B 4HDIA 3MLTA 2G2RA 4ZMTA 4MMXC 5CHNA 3GSNA 1BD2E 5E7BA 3LQZA 3U9UB 4GW1B 4LCWD 3MRBB 2K8QA 1H15A 4P4KA 3WE6B 2XN9B 3FCTB 3EJQA 4HBCH 4CGTA 4OGYL 4JM0A 1QW9A 4YIQB 4NSKB 3V0HA 5DEGB 3KVQA 3FUDA 5KANG 3HS9A 3PHOA 3QWRD 3SBQA 3FTUA 2KC0A 2CBTA 2HKFL 4OCYL 4XP4H 4Z7QF 5K5YA 1EAPB 1QRND 4U1NA 2LE9A 4XVSH 2KQNA 4HK0A 3X12B 4ILDA 5TK4A 1ZHNB 4H44C 3G5YB 5BRZA 2QTEA 1KWKA 3EXLA 3QR0A 1A9EB 1A47A 2QHRH 5AOLA 5IJVB 3ECBA 3NJIA 2R9HD 4GMTL 1YEJL 2D9QB 2GTWA 4W6XB 5ICYA 2X4PA 3ABGA 3IDYC 1YDPA 4KJWC 3TJEH 2FUQA 3UBHA 4Z8FH 3ARDA 4YLBA 4G70B 4PRIB 3VI4F 3US9A 4APQA 4D2NA 4A7TA 2PLTA 4BSJA 5EU7E 3W57A 4KQ3H 4TUOB 4N0RA 2HFEB 1EAOA 3A4EA 5EO1B 1Q4NX 1JTTA 4JVPA 1JZ6A 3EJJX 3L3IA 3LNHA 4L2YA 4LQ1A 3LZRA 2Y1ZA 3L95B 4XVUD 2Y5QA 3K4AA 1IRAY 5AG8A 2J8UF 1JDCA 2YPKB 5CCKL 5JDSB 3LKNA 4QY8B 2JJVA 2EVGA 3VD2A 1DFBH 3PQYD 3TVMC 3WIHH 4B9CA 3WY2A 4NZ8A 2R15A 1YPZF 4K5OA 1FFQA 3MRKA 2EC9T 4QDGA 4L5FL 5DJAB 5J1AB 1T1ZB 3A4FA 1FZKA 4LEBA 1GC1L 1K4CA 2YBGA 4NCDA 1ZLUH 3SDDD 4DO5A 2JJUA 1J1OL 5ALBH 1ZLUK 3QJSB 2VSMB 3CDZA 4TF4A 5KBNC 1KEGL 1RY7B 5EN3A 3VI4E 3T6XA 4KNQA 2IVFC 4G8EB 5AAMA 5FHAL 5F72S 1RZKC 4ZAKD 4QRPB 3LNGA 3WLBA 4E0RA 5HI3D 3P77A 3TZVA 1OCCB 1SXAA 2NY1B 1TKWA 3VYNA 3JTTA 3LSOA 2AVFA 3QJVB 4XMKH 3CIAA 3IXAB 2H5UA 4PCTA 2J8UE 5C08B 2WQVA 2IBZX 4FN0A 4DPBX 1QSFE 8CGTA 1AP2A 3MCG1 3RJOA 4JCLA 1YPZE 1HHHB 4P5KA 3FDWA 5F9WB 2A77L 1B3JA 1BJMA 1KGJA 1A65A 1BHGA 1H3PH 2D31A 1I7RB 2YIHA 4NENB 4PJCE 1ONQB 4JPKL 4L3AA 4I77H 4L8SB 3CAFA 2DWDA 1J5CA 2JELH 1NUNB 4KQ4H 1FJ1A 1C08B 4RWYH 3MKKA 3MGTB 1KELH 1QO3B 4UDTB 4X6CB 1PZ3A 1SJHB 3I3EA 5CIPB 3VG0L 4NQDE 1TO5A 5IR1B 4U1LA 3FU5A 3JV4A 4EBQH 5IK3B 3O6FD 3LKOA 4GIAA 1ZHKB 3QCVL 3ASWA 3EFFB 3SCMA 4WI2A 4YHPA 5I23A 5IROC 4KUZL 2YD3A 4DAGL 1BEXA 1IC5H 4Q56A 4XNBA 4FADA 4F5CA 3VD9A 3K6IA 4IKLA 4YGAB 3G5WA 1M9WA 1HXMB 1O7SA 3OKKB 1U8LA 3R8QA 1NAKL 1ND0B 4MKTA 5C0JA 3UC0L 5IEHA 4HWBA 3BPLC 3L5JA 1PDKB 2L7QA 4K8RD 3SKOA 2IQ9H 3DHPA 3HZ3A 5I8OL 4ENED 2YGVA 3PPSA 3NPSC 5I1KL 4K3JH 3DI3B 1LWJA 3HG1D 5JHDA 3BKJL 4P57A 1AVAA 4FEMA 2X4OB 3MJ7A 3MXWH 2JV6A 2AJZA 2B7DT 5C9JA 1AO7B 1RZGB 4Y1AB 1YECH 4HJJL 5DSCB 4PWHA 2IQAB 1ZGLB 1QUPA 2G2NA 1AQDB 4RFOH 1FC1A 4BWUA 2ZUQB 3F83A 1FN4B 1ID5I 3N91A 3NUKA 4B9FA 1UD4A 3D2UD 2A0LD 4J3XA 3ERXA 3V4PB 3QDGE 3BGFB 3NFNA 1TJHH 3ZDXB 2QDWA 4ZTOH 2EKSB 4XX5A 3U6XS 4XPAL 5MI0B 1KCBA 3MX0B 1L9OA 5E6ZA 5A2JH 3QVAA 4MA8H 3BDYL 4OM0H 4EI6A 4FJZA 2CKBL 4DP0X 3OKMA 1PCXA 3K6DA 3FUIA 3SBRA 3FN0H 5IFJA 2DQDH 3WEOA 1EWHA 2NY6C 1C5BL 4LMQE 1SNRA 2J88H 4YDIL 1REIA 4L3FA 1ZK9A 2HVJA 5CUSH 3A6CL 4BUHA 4DN4L 5F9DC 1HHJA 1FFOB 2JKIS 3K5SA 1VCBC 2HMID 1IIIA 4KVCL 1JNNH 2DEWX 2E6PA 4PRBB 5KVDH 1AGBB 3T0BA 1THCA 3QRFM 4P2OC 2OMBA 3MV9D 1KJMB 3FT4B 1XGQB 5HVGB 1QLEH 2XPZA 3PHAA 4MDJB 1OPGH 4GS7B 2NY4B 1F2QA 1NGQH 3BZ5A 3QUYA 4MXVF 1S9YA 4LOUC 1X3DA 4O00A 4HV8A 4XXWA 1A9BA 4YE0A 3UTTD 3JTSA 4ENZA 5MP6L 4KZEH 4O2CA 4B0MB 2Y72A 4JFDA 4OZHE 4NN6C 2NY0C 3U0PB 1JK9A 1XSKA 3B9KC 4X7SL 2XWEA 4JVUA 3MROB 1E4HA 3DPBA 5IQLA 1U8OA 2R51A 4JFPB 2Q8BH 4XCCL 1D5IL 4W9CC 3MACL 5C0NC 4GRLA 2XYCA 4ZFOL 4WQOA 3WHXB 3QUXA 3FQXB 2CAKA 3ROLA 5K1JA 3GXIA 5FGRA 5DJ6B 3QNYA 2CIIA 2Q7YB 1ZGLM 3FQYA 1I8KB 1WUZA 1AGFA 3L9EA 2LU4A 4QHUA 1JV5B 3MUHL 5BXFA 4DCQB 1TDQA 3CZNA 1IQWH 5F9JA 4NRXB 1YLBB 5I1GL 5TK2A 2AEQH 4QXTA 3BN9D 1CLYH 5SX4I 3TU6A 3PV6A 4KX7A 2EIBA 2EYSB 3U36B 3WXVL 3T0VA 5A40E 4KI5E 3LD8C 1GGUA 4FYSA 3KBFA 4P07A 5D7SL 3QFJE 4J6IA 5I15H 1IO4C 1OM9A 2DM2A 3BGMA 1MHPH 4QHNA 4HCRL 4K5MA 3SQRA 2BFGA 4JHVA 5CR1A 1OTSD 4GNKB 5JW4R 1KBKA 5C0RL 4OGZA 2B39A 2XTJD 4TXVB 1BZ7B 5D8JL 3OAWA 3KS0J 3STBA 1OPOA 5IG7A 1B6DA 1II4E 1M7DA 2XN0A 5GZOC 1NJ9B 4I18A 1ML0A 3HAEG 3O6LH 4UOW0 5LAPA 3X11B 1G7HA 1JK8A 5DA0B 2WYTA 3BIAX 3T77A 2H1PH 3D51A 8PAZA 1UA6L 2Q2EB 5DU7A 5EWIL 2BH0A 4NZRL 2A99A 4TLKA 2YFOA 2BFVH 4NBZB 1EO8H 1K9TA 1IKNA 3KWVA 1E6OL 2J1XA 3NFPA 3FFCA 3EJCA 4HIPA 4OY9A 1V7NH 4PGBB 5FGSA 3L5HA 9CGTA 2WNWA 4KX8A 2CDFB 3LKSB 1RUPH 1UA7A 3WFCL 4B0MM 3KPSA 3TGXA 1UFUA 4RX4A 4Q97A 5GISH 1F3DH 4L0YA 2DW5A 1CXEA 4QF1B 4ZXBD 1BOGA 2DDQH 5E23A 1T5XB 3HKFA 4XNMA 2YA2A 1DVZA 2H6PA 3EUUA 4XN5A 2EDXA 1CFQB 2YA1A 3OPZL 5AW7B 4AW7A 4M8VA 2VUYA 3HNVH 5D7JA 4OLYH 2HVKA 4HH9A 4I0PC 4NI6A 5HHQB 1FDLH 1HZLA 3CFUA 4I5BB 3WJJA 4IKNA 1FFPB 2CIKA 4MWFA 4HIQA 2EC8A 4TN9A 2M26A 5HDLA 1L9NA 5E6IC 5HYSG 2YPLA 1RCYA 2EP6A 4QJ5B 3NJVA 2WXFA 3U2SB 2DYPD 1JGLH 2B2XL 1KB5H 4D8PB 2XG5A 4LCYB 4JE0A 3ATBA 4QHMA 2I07B 2FEDC 3MYJB 4AGNA 4H2CA 3JBG7 1RIVL 4OV6F 3EDDA 2BHUA 4DWHA 1IGIH 4H0IA 2COQA 1QHQA 2NR6D 3F7YB 4HIHB 1QUNA 1ZLDA 3MRIA 1OF0A 3S5ZA 4GIOA 3CLWA 1S3KH 3OM3B 1WWAX 3S88H 5CM1A 3BO8B 4D9RE 3ME0B 1A1NA 2G3XA 3BAIA 5FHBH 5FDWA 4YE4L 1J5OH 1ZT4A 1Y0LA 4H26A 3WGUB 4PJ5E 3AG2B 4G82A 5D1ZC 4LSPH 1JVLA 3V5DB 1R5VB 2R39A 3S35L 1KGCE 2J2ZB 1YNLH 2PWDA 3DPDA 4PBDA 1FFNA 1B0GB 3W11C 2WV3A 5I17A 4ZI8A 1WC7B 1DJWA 2GQHA 5JIQA 4XZUB 2IWGA 4HDIB 3MLTB 5ABDE 1NA8A 2G2RB 5DMKA 4GAGH 4B41A 4K07A 3GSNB 4JHWH 5CHNB 4FKEA 5F1OB 2P7TA 3QAZC 4LVNC 3T1FA 5MEPA 3LQZB 4JO1H 1H15B 2E9GA 2ZYRA 4P4KB 1ACYH 1TG8A 3DGGA 4FEIA 1ZSDA 4N0YL 4KJWD 3EJUA 4ZOEA 2AW2A 1NC4D 3PHOB 4YC2C 3RX5A 3QG7H 4A6YH 3C6LA 4U1NB 4YSAA 4Q9CA 2UWEF 4HK0B 5AB2A 4Y9FA 2GEQA 1KTDA 3JV6A 5BRZB 2I69A 4LVHB 1J8RA 5ETUA 3LY6A 3ECBB 3VDCA 2YAHA 2GTWB 2H7WA 3CV5A 3VXTA 5ICYB 2X4PB 1SOQA 1YDPB 4D3CH 2QR0A 4TLSA 1MDTA 3ARDB 2CWRA 1ED3A 3GSQA 4APQB 2P5EA 1HJBC 4F27A 4XO4A 3ZDZF 3TVMD 4KRLB 4DP7X 1C5DA 4F93B 1T89C 4A39A 3MLVH 2D7TH 5E94A 3L3IB 2XQBH 4MJ4A 3AWFA 4NQDD 2VLME 4JO4L 4U1HB 1KC5L 1ODAA 3OGCA 1NCJA 3COOA 5L0QB 3E6HA 3OJMB 1IGYA 1NBZA 3LKNB 4G7QB 1ZEAH 1WISA 1FFTB 3BP4A 4B3VA 3N1FC 1NMCB 5DJ0A 2QMJA 4BZ2A 1A14L 5FDYA 4Q14A 3WKMH 1MCOL 3E38A 3MRKB 2UWEE 4N2IA 1LO3H 3IAQA 1K4CB 3LKQA 5HDBF 1J5IA 3ILEA 5E9DE 3RVUC 5JUEL 3MV8A 3A6OA 3VG9C 4CMMA 3CDZB 2Z65C 4OD1L 1UKQA 5D4JA 2KPWA 3MLXH 4CJ0A 2FJFA 2EH7L 2X0UA 4L1LA 6PCYA 1HQRA 3ZDZE 4M6NL 3MVSA 2R27A 3WLBB 4E0RB 2HH0L 2PW2A 4BWWA 3P77B 1TQWA 3TZVB 2R0LH 3UTSB 1TKWB 4FMKA 1NFDA 2FWSA 3BVWA 3CVBA 3X3FH 4HUCA 2IWFA 3JTTB 3LSOB 4MNGE 4F7EA 4K15A 1T21A 3MCLL 3D3VA 5IUCA 4KK9C 3BP5A 1F02I 5ADOL 4DJMA 1BM7A 1AP2B 5IVXF 4MRCA 3K72A 5AWNH 3T0EC 3TV8A 2C9AA 2E27H 3QDGD 4P5KB 5DF0A 5GS2D 2KZKA 1UACH 3VUAA 2CR0A 3NZHL 2D31B 1ET7A 5IBUB 5KVEL 1XGZA 1DJHA 3CSTA 1DBMH 5IROD 2DWDB 3ZHFA 1FJ1B 3SDCA 1VEMA 2E7DA 4R26H 2XWXA 2Y6SC 2EIMB 5E24E 3EDJA 2AQRA 4XPHH 4U1LB 3JV4B 4J28A 3LN5A 4JKKA 5KSBE 3LKOB 3RU8L 4MA1C 3AT0A 4PB9L 4XCNA 3SCMB 4YHPB 2MEJB 5T33L 4AJ0A 3DECA 3ZTEA 4K9EL 1R34A 1TYRA 3WFEL 2NQ3A 1L9PA 3WE1A 4AZ8A 3IJ7A 3ATDA 4CSPA 4MD0A 3QULA 3BQVA 1U8LB 4NQEA 5C0JB 4N5EC 5IEHB 3GRWH 5IVXE 1W72L 5BOZG 2CBQA 3VXRA 1QQDB 3S8FB 4BZ1L 1Z9PA 3SKOB 1CTMA 3BE1H 1FYTA 1WIUA 3GSRA 3LNDA 3LVEA 2RCSL 2R1XA 4N2AA 3MV7E 2D3LA 4KFMA 1TQSA 4Z7OF 5LVEA 4UOZA 3T0EE 4EN3C 3AS0A 5JHDB 1UYWL 4P57B 5E2VH 1E6JL 3MJ7B 1S7SA 2VL5A 5CINL 2AJZB 3ZGHA 1EERB 3FXIC 2GUYA 1KCWA 1UATA 2OZ4L 5C9JB 4G6AC 1L9RA 4NQSA 1OY3B 4NUMA 4F3FA 4M7JL 3BUIA 2FJHA 1MIMH 1L9TA 1PG7H 5HYSA 4BGLA 1RIUH 5F0JB 2MQGA 5GSVA 3T3PB 5ANHA 3FNKA 3Q9QA 1HESA 2EADA 4JO2H 2FX8H 1GCFA 3OL2A 1CYXA 1XF5A 2NY6D 3NFNB 4FZ8H 2BK8A 5AW9B 1Q0EA 4MZRA 4MJ6A 3BQUA 4UTBL 4R7VA 3KYAA 3MGAA 5EU3A 4EI6B 2QEJA 3LZQA 2R69A 1ZTXH 3LS4H 2BRQA 3QFJD 4W4NA 3HI1A 4RFNC 3OKMB 4HPYH 3UMNA 3QZMA 1L7IH 4C56E 2B1AH 2Y07L 3UO8B 5IFJB 4R8WH 5IFAL 1MFUA 4P2OD 4Z7OE 2NQCA 1JMXA 2E6QA 2HVJB 3K1KC 4BCZA 2IOMA 1G7MA 4AMXA 1HHJB 1OARH 1E28A 3EZ8A 4G6KL 5DMIH 4LOUD 2BOLA 3ZDYF 1KWGA 4OZGF 1LO5A 2J6EH 4GLRH 3B9KD 4ELME 5DUML 3O3EA 2HX9A 1BFOA 4RISH 2QPFA 4RDBA 3ZX1A 4PWJA 3UPCA 5C0ND 3UTOA 4AL8L 5I75B 1TTGA 5FKAA 1XF4A 2JTYA 2A9CA 4O02A 4QKXB 4LF3B 4Y9BA 2E9BA 3NIDF 3QUYB 3T5WA 1S9YB 3SO5A 1X9QA 3WKQA 4HV8B 1A9BB 3JTSB 3BWUC 4O2CB 4JFDB 5AB9A 1FGVH 1JK9B 2FSEA 3B7UX 5K39A 2K78A 1NCHA 1RUAH 1WA0X 3DPBB 1U8OB 2KZBA 1QKZL 1WIOA 4GRLB 3A4AA 3BWUF 3RUGF 3TOPA 3MKGA 3ULUL 3ROLB 2PPDA 1J1XL 1CICC 5DYFA 5GHWL 1EJ8A 3FH8A 2YXWA 4KV5F 4NFDA 3QNYB 2CIIB 5EG6C 4HJGA 5ITFA 1AMXA 2OJ1A 1AGFB 4H8WH 4HWUA 1OW0C 4QHUB 3N42F 1RZJC 2GYSA 5BXFB 4PJ8C 3HE7A 1L7TL 5F9JB 3PJLA 3C6SA 2AQTA 3ZDYE 2XBDA 3OJDA 3ZL4L 4QXTB 4A7VA 4IIZA 1DSFH 4OZGE 3PV6B 1I8UA 4IEFA 1OD7A 2Z1PA 3PDOA 3TYGL 1XEDA 1Z9LA 2PYFA 2QVKA 3JWOH 5CEYA 5FM4A 1HHIA 5E5RB 3BGMB 3OBAA 2W9LA 4QHNB 4GMSH 4XXDA 1GZPA 4KO9A 2F1AA 3NIDE 4MMZC 1WF5A 1K6QL 3ZO0A 3C60C 3QG6A 3ESPA 3SOBL 1EK3A 2XUWA 5IBLC 3AY2A 4U6HA 5AEAA 4HJSA 1RULH 3OAYH 4D9RD 2NSQA 5GS1C 2ADFH 3L4UA 4XNYL 2N0MA 3OAYK 2VLJE 3QJTB 1E4KA 1YQVH 2XHNA 4LPUA 4OLVL 4PJ5D 1F90H 4JRFA 5IG7B 1M7DB 2H6OA 3RUGE 1Z5LA 1KGCD 3MBEA 1F4WL 2YGQA 4MYWB 3AU1A 4RMVA 1SHMA 1G7HB 1JK8B 2N0KA 3T77B 5FLVA 2R7EA 1K8DA 25C8H 4H0GA 3C2AH 3GJEA 1WFNA 3CBRA 4FP8L 3C5ZB 3ORJA 3KYNA 4C59B 1X4YA 2DI7A 3ZYIA 3NFPB 3FFCB 4U4IA 4GSRA 2N7SA 3ESOA 4F33A 4JFZL 3W5MA 4I0PD 4MJIE 3KPSB 2C9XA 1SBSH 2WUCH 1BBDH 1DN0A 3HZMA 3EYFA 1KB5A 1G43A 3DC0A 1INDL 1HHKA 5E6ID 3UAAA 4CVUA 4JKLA 4R4NC 4Y4FC 2MPAL 1TCMA 1BOGB 1SQ2N 1A1OA 1A7BA 4XNMB 1JHLH 4AJWA 2H6PB 5GRZA 2BO0A 1V7ML 1Q0XH 1F58H 1E9QA 1UGNA 5AKSA 3VGHA 2FEDD 3TBTA 3BSGA 5D5MF 4YSEA 5D7JB 2HVKB 4NHUA 4HH9B 4R5VA 3ETTA 2HA1A 3B4NA 2CIKB 3AC0A 4MWFB 1FH2A 1TQBC 2YPLB 4PS7A 3QQNA 1KXHA 4PD4J 3CUPA 2V7HA 4M03A 3DROA 3W0WD 5IHBA 4P5TC 1VZHA 4G80B 2XG5B 4LKCA 1PX4A 2VMDA 4QHMB 2NXYB 2CH8A 4L4TA 4UINL 1T4KA 1P6AB 5D1ZD 5IJCC 2BS8A 2VLMD 1CYGA 1QFOA 1EGJH 5F88A 4YFLF 3SO3B 3W11D 4FNTA 3M8OL 5J56B 1N7MH 3BD3A 2AK1L 4DHLA 1QUNB 3AMKA 3MRIB 1IVTA 2J55A 2XVGA 1Z9OA 2ENQA 4DPRA 2HP4A 3I9IA 1JZDC 1A1NB 3SIKA 5EU6E 2LU5A 3EO0A 5FOBB 1ZT4B 2XZCH 1XIWC 1Y0LB 4H26B 3WFZA 1X4XA 1QFUL 4EF3A 3KMDA 1F4YL 1FFNB 5I17B 3EYSH 1MCKA 5E9DD 3SY0A 4LCCC 5SX5H 5FYKL 4OQTH 5SX5K 2GBAA 2WLYA 4LFHD 3ZKXB 2VR3A 5DMKB 4BFIA 1IC4L 1ZTXE 4PWKA 4H8WC 1QZNA 2P7TB 2NY3B 5MEPB 3T1FB 1EBPA 1TSHA 2F7IA 3DGGB 2DMCA 1ZSDB 1O75A 2HWZL 2Q5BA 4GO9A 1LDPL 3VQLA 5AW8B 4R96A 3CQPA 2OP4L 1ZA6A 3C6LB 1ACXA 1IGMH 2E7MA 4G8IA 1UXLA 5BUGA 2GITA 3HRZC 1E5BA 4WI0A 3D4CA 4OD2A 3V4PL 2NUPA 1KTDB 3AGVA 3E1ZA 3JV6B 3JWOC 5C07A 1Q9LA 1ZPUA 5ETUB 2CRYA 4PRDA 5EU5A 4Q8BA 5DK2A 4J4PC 1CDUA 1W16A 3VXTB 4D94A 1RI8A 3R0NA 3EIFA 4FYRA 2QR0B 2ZUUA 1CS6A 4Y9EA 4K5PA 2N56A 4GSXA 1ED3B 2P5EB 3Q6GL 4JS7A 1P7HL 2FBJL 5DMGC 1VA9A 2FH8A 1DQVA 3LH9A 3IS1X 1LE5A 5E7FA 5C71A 2WQRA 1C5DB 1EUTA 4Y8AA 5DVMA 1MI5B 5T3ZL 1NCBH 3DSFH 4OUOA 1E30A 5CP3H 4IBZA 3O3DA 5E94B 3CDGA 2AERT 1JPSL 5GGRA 4OJFL 3KNBA 3OGCB 3S37L 1TLKA 2O61A 4AQ1C 3RVUD 2JJSC 3LHPH 4NZDA 4P9HL 1UCTA 1WFIA 1IGYB 1NBZB 3E6HB 3NFSL 5DD3H 1MAKA 5FW6A 4YHNA 5TGBA 3BP4B 2VN3A 5AVTB 4JDTL 1F5WA 4M4RA 1TXKA 4M48L 5DJ0B 4BWTA 4MQTB 5BS0E 3T4YA 3WJLC 4D0DA 4XX1G 1AH1A 2R23A 3LKQB 1HYRC 5DVNA 4A38A 2NDFA 4E41A 3S34L 3QJFA 3O4OB 1N9PA 3MV8B 2VC2B 3PWPA 3TN0C 4MXWH 4AC2A 4BCXA 4CMMB 3HG5A 3KDPB 4X6EA 5CLTA 3L9RA 2FJFB 2Z8WC 4KK9D 1MCIA 4PCKA 4M93C 2Q3XA 1HQRB 4FXKC 4MAUH 3AACA 2OCCB 3HMXH 2A6DA 3BKCH 3MV7D 3T0ED 2PW2B 3QIWC 4G8AC 4OGAD 3OR7A 4KBPA 4FDWA 4XOBA 1NFDB 3C6EA 3CXHK 5HJGA 1UHVA 3UAFA 4RGNC 4PJAF 4RMWA 4F7EB 4PVLA 4BQ9A 3JV5A 3B9DA 3P9MB 2I26N 5GSRA 1T21B 5IOPA 4IDLA 3OG4B 4ODSL 4L3EA 5J0BA 1A22B 3D3VB 4L9LC 5CU5A 5JOPD 3BP5B 2BW5A 3LS5L 1TZGL 4YO0A 1NCNA 2P4AB 1KTKE 2Y6SD 1PKQA 1BIIA 2DAVA 2OBGA 1ILUA 1SBBA 3K72B 5IJDC 5HDRA 2AZAA 4I2XE 4K94C 1I3RA 4HOXA 3AW5A 3GBDA 1W0WA 1G9EA 3CN1A 5FM5O 4RZCA 5EPMA 1DJSA 3H2QA 4FQXA 3NCXA 3HI5H 2VZSA 3OD3A 3IE9A 1GOGA 1I9IL 4WV1A 1JRHL 2DI8A 3SDCB 3GRWA 4XP6L 2XZAH 2ICES 4LSDA 4OVUA 4PJ9A 4EO5A 2PYEA 1EBAA 2VN6A 1YSOA 5CILL 4C56D 5EBWA 3S37X 5T1KD 1MFEH 2FB4H 3D0VA 1OWWA 2JQMA 4X9HA 4MGXA 4N5ED 5DFVD 4ZMAT 4BE5A 5GRUH 3ISYA 1I1YA 2OYMA 3LN5B 1URIA 2OMWA 2DQCH 2YRPA 3DHJA 5HHOE 3SOTA 3ZMEA 4A66A 2BS9A 4XCNB 3GLEA 3HAEB 2NY7L 2CU9A 4PJAE 4UAOB 3R19A 1WD9A 1I82A 2VXQL 4XPGL 4PB0L 4HFWA 4MD0B 3QULB 3QJUB 5D7KE 3FBKA 2VXUL 4NQEB 3ZE2F 1DJYA 3D33A 4BK4A 3U0WL 3HBPA 3TH3T 3QPXH 4Z18A 4G6AD 3VXRB 3SE9L 2BSCA 1FYTB 4R2GC 1WP6A 4KDVA 4ESKA 3EBIA 4RMBA 1XH0A 2TRYA 2R1XB 1TR7A 2FDBP 2TSAA 2KT6A 1RSFA 2VKWA 4PRPA 3DRQA 1P5UC 4B7LA 1UD5A 5A43C 5IB2A 1S7SB 2ZCLL 1RFDH 2JLPA 2VL5B 3RNQA 3CN4A 3TNNA 5AOKA 4NQSB 1BW8A 4F3FB 1OM3H 2AQ2A 3A47A 3L1EA 2FJHB 3V4VA 3CFTA 2CO2A 4GXUN 5HYSB 3II3A 2YPVH 1UADC 4PYGA 4TQHA 5GSVB 3BT0A 4GOSA 1XF5B 3ZN6A 1IC7L 4N68A 5JOFA 1O9WA 3DGCR 3F7QA 4YSRA 4ANWA 2R4SL 4MJ6B 3CDCA 2XWRA 3BQUB 3D52A 2YWZA 2J6EA 5FUOH 3WFDL 5EU3B 3MFFA 5B3JF 3HG4A 4XNZC 1BPVA 3C09B 1C7SA 2IG2L 3HI1B 1NSNL 1F13A 1L5GA 2B16A 1NEUA 3QC5X 1D9KC 4ZDHB 1RV6X 1GH7A 3KR3L 4AI7A 3IGKA 2EDEA 5F7UA 4UQ2A 2DS4A 2E46A 5EBLA 3KLDA 4WK0B 2QV2A 3E9TA 1VAHA 4XP1H 1G7MB 5L2KA 2R4RH 1E28B 3EADA 2DEXX 4FX5A 3SD5A 3N1MC 1RIHH 1O7DC 3U79A 1LO5B 3KYOA 3GSNL 3O3EB 1ORSA 2XY2A 1BFOB 4HH8A 1CQKA 4RLDA 1LP9A 1KF9B 5FKAB 1XF4B 3WY1A 1CICD 1N3NA 4K8RL 4YBQC 4O02B 5IEKB 4LCWA 4HZLA 5AUMA 1MPAL 2DMBA 5IHHA 4ZO8A 4MJID 5K33A 5I1HH 3LPGA 2F53E 5B3JE 4PJ8D 4D7PA 2AAAA 2FSEB 3OWRA 5K39B 4XBGA 1N64L 3IMWA 1P5VA 2A9NH 1SF3A 4DGYL 3OLIA 5EULV 3N85H 5HYEA 5L6YL 1JOIA 4MD4A 4L1TA 3S2AA 3W39A 3CSFA 3WU1A 2LLLA 2NLJA 3CVIH 5ITFB 3DJ9A 1TLMA 4HJGB 15C8H 5DJDA 3P4MA 3MUY1 3BAEH 5D70H 1RK7A 4M1CC 1P4BH 4WTWA 2DIAA 5DWUH 4JQIH 4ZTPL 2ZP9A 5A3IC 1ADWA 1VIWA 3HE7B 5FWQA 4JGJA 2RTTA 3C60D 5T1LD 3C6SB 2YMXL 3OJDB 5BO1H 5IBLD 4IEFB 5EA0L 2VABA 1DBJL 2QSCH 2I9TA 3B6SA 4RMTA 1NCCH 4F57H 3PDOB 2PYFB 3GI8H 3GQFA 5MENA 2J20A 1HHIB 2Z31A 1RURL 4N2NA 1O7DE 2Z4QA 3QR2A 3FO2A 4XXDB 1GYVA 1GZPB 3QXDA 1YEHH 4XO8A 3MNVA 3QG6B 1I75A 4PJ7F 4QXVA 1NCIA 3MLSH 3JWDH 4U6HB 1LTXA 1MQKH 1FNAA 5EU6D 4ISVA 1TTUA 4JJOA 1CDJA 1MF2H 1A3RL 2VZTA 1KIRA 1Z5LB 3MBEB 1PIFA 3AU1B 1WHOA 4U1JA 2R7EB 1K8DB 4Y4FD 4R7XA 2Q9OA 3GJEB 5BV7B 1HSAA 2FZ3A 4HK3N 3C8HA 2YUWA 1G6RH 3WFBL 4A68A 3NCMA 5A6MA 5BUAA 3KYNB 4G5ZH 4JANA 1OAUL 3IGAA 5DJZA 2ZONA 3S3SA 4F33B 1RU9L 4RGMC 4JRXE 4PJXE 3NACL 4EIGB 4I4WA 1AOZA 3KJ6H 1ZIAA 3U7WH 3MUGA 1DN0B 3HZMB 4LVOB 3EYFB 1KB5B 4Z0XA 5IJKA 1HHKB 4OR1A 4DETA 3LMJL 4G9DA 1TITA 1A1OB 1RZPA 2A74C 4JCWA 4KRNA 4KTDL 1KZQA 4HS6A 2IJ0C 4P5TD 4B7IA 1EGJA 2J5LC 3T2QA 1E9QB 4PJ7E 2P5WE 3PGFH 2CO4A 3TBTB 5JW3H 4JZJC 3VI3A 1MOEA 1YYML 1ETA1 3BVVA 4NHUB 5AB0A 12E8H 3VH8G 4HIXH 1EFXD 5K9JH 2CHWA 3EHBC 3GMPA 4FFYA 5DD5L 2YQBA 1AS7A 5GS0H 3POHA 2PR4H 3CUPB 2V7HB 4DN3H 4PS4L 3DROB 3V55A 4H5SA 3ZSTA 1A3LL 1CU4L 2FE0A 1IM9D 4LKCB 4PGDA 1XIWD 4L4TB 1SY6H 4CUCA 1T4KB 3AY4A 3P4OA 4E9YA 1BYPA 3CTTA 1Q38A 5A2IH 5F88B 1KNOA 2DQJL 4HAGA 3D9AH 3WI9A 5C0CA 4NQQA 3KWXA 2AP2A 5F1IA 4M5SA 3RZCA 4XMLH 5BS0D 5CSZA 2ENPA 1EX0A 3EO0B 4HWBL 1FG9C 4ELKA 4TPRL 3VD1A 1NZRA 4LIQH 4J39A 1ODUA 5E8PA 3HKZA 1BSIA 1DQIA 3I74A 1AC6A 4S1SH 3QUMH 2TAAA 4E9TA 3SY0B 3V6OC 3LRKA 3LH8A 4JO8A 3BKYL 2J21A 2DMGA 3BW9A 1B9ZA 4BFIB 2VDLH 3OMZA 4ZS7L 3MRQA 2CRIA 2DQUL 4KDTC 4FQ1H 4JFVA 1X7QA 3HG1A 1AY1L 5CGMA 2YMOA 4R96B 1JPEA 4CU8A 1LO0H 1ZA6B 4HMCA 2ZXWB 1EJ6A 4G8IB 2JCCF 1QYGL 3KW8A 2CJ3A 2GITB 3MRPA 4WI0B 2EH8H 4OD2B 2NUPB 3CFDA 5C07B 1Q9LB 1U8JA 3QHFL 1RL1A 3HI6H 3D2UA 1HSBA 4PRDB 4KKCD 3P2DA 2CLZA 1WS8A 4WFHE 5DK2B 5EU5B 2J71A 4RRPG 3INUH 3ILQC 1NMBH 3JWDC 3QNFA 2YOCA 2NSXA 2R29H 3AG3B 3VU1A 3MJ9H 1JHTA 2R0KH 2DWTA 5DJXA 1S5HA 1LE5B 1EZVX 5GRXG 3VM7A 1AI1H 1OAKH 3ATAA 3GEFA 1PCSA 3O3DB 4Z1PA 3CDGB 4LASH 1E90A 1G1KA 5HHPA 1BVZA 1M2VA 3FFOA 4HXAH 4W81A 5GGRB 3KNBB 2CO3A 3RTQC 3TBYA 4Y1SA 2O61B 1PQZA 3NCBB 1W9XA 1JI2A 5D7LA 3V6OE 1TZOA 4AEFA 5TE6H 3TN0D 1MXDA 1EO5A 5TGBB 4YHNB 5I8EA 4GQ9H 5TE4L 4AYMC 4M62H 1VGEL 2OL3H 5J6SA 1M56B 4M4RB 4KOCA 4RWHA 4YXKL 1MW3A 2ARJQ 3RB5A 3T4YB 1MFAL 2EYRA 2JCCE 4D0DB 2WMPA 2R23B 2A7BA 3RILA 4H20H 3QIWD 4OI7A 4WW1A 4MNQA 1IGJA 4NKIH 1F3DJ 4OTXL 5GRJL 1EHLL 4E41B 3QJFB 4RGND 2Z8SA 4YHKH 2YXVA 4NZTH 3PWPB 5KAQF 3GS4A 4WTZA 4F7KA 2EE2A 2J73A 7PAZA 4I3RH 4X6EB 2P8PB 3L9RB 5FECA 4HKXA 2Z7UA 1CTNA 4FTVD 5G4NA 3ECVA 2A6DB 1JZEA 2GK2A 2VERN 2APWA 1Z3GL 1QNZH 3NQIA 4HA1A 43CAA 2IH3B 1HINL 3ZU8A 3OR7B 2D3NA 5GS0C 1X4ZA 5I6XB 2ROYA 4ZOBA 1Z2KA 3P0VL 4WEBL 5GSRB 1XCWA 4WNSA 4J3TA 5IOPB 1GXEA 4L3EB 3Q01A 5EIVA 5JHLA 4Y16C 4YO0B 4LSQH 5FYJH 2GY5A 1PKQB 1BIIB 5I8KH 3IJ9A 4GT7A 5I1EL 1IKOP 2P49B 2VDNH 5M94B 1NOFA 5HHVH 5FF6A 1ZANH 1OLZA 4PV9A 1I3RB 4ZO7A 4BZYA 5GGUA 3SGEI 2IALA 1W0WB 4MBOA 4RZCB 5EPMB 4FQXB 4TRPL 4AH2A 1KN2L 2YRBA 2C9UA 2ZUWA 5KVFL 1FSKC 4WV1B 2RGSA 4Q89A 5ICXA 2HFGH 4WRLA 3KD4A 1WZLA 4GH7B 1XGPA 4XVTH 4PJ9B 3SPJA 2PYEB 1D5XA 1XTMA 4IGBD 4LQFH 3ZT7A 5GS3A 2XPYA 5EBWB 3O6KH 3D0VB 5EOTA 3WO3B 5BO0D 1OAXL 1DBAL 3DIDA 5FX3A 1I1YB 2Y3AA 1HN1A 2OMWB 4EUPG 1J9QA 2C3VA 5JXAL 4PR5A 4R2GD 3RWDA 5L9DH 3KGUA 1TT6A 4OW6A 1AR1B 3SPHA 4IIQC 3NJKA 5DZVA 3FSOA 5KBPA 4XB8A 1IBZA 1AQMA 4HFWB 4E42A 3ARBB 3FMGL 5AVRB 1IM3D 4RAVA 1ERNA 3DTUB 1XZWA 2QZ5A 2ZX7A 4OIIL 3LVTA 4IRJC 1UWGL 2YPVA 4AZUA 2DJSA 3APNA 2A83A 4IMKA 2RACA 3UO1H 1B2YA 1PU0A 4JRYE 2F53D 2D73A 3NA9H 3L2MA 3SDAC 4PRPB 3DRQB 5IB2B 2ZPKL 5GIRA 1O6SA 2X12A 2QFPA 4NAQA 3RNQB 3TNNB 4ZXBA 3O6MH 5KS9F 1IE5A 1NOAA 1RPKA 3D08A 3THMH 2FD6H 1TNMA 4LIQE 3V4VB 1JZJA 1FL3A 2ERJC 4KRPB 3SGDI 1EPFA 5LDSA 1Q94A 5DFWH 5I1IL 4E36A 1D9KD 3VWJA 5JOFB 1KJ3H 5JR1L 1AHKA 4GAJL 3UBXA 4G9FD 1J9SA 4XC3H 4JQXC 1KBBA 3G9VA 1WD8A 3H85A 3MFFB 2EDMA 1DHKA 2IADA 1KDJA 1NGPH 4Z7WF 2UZYA 3LZNA 2IANE 3C12A 5TFSL 3WBDA 3A5VA 4MQXC 4HBCL 4ZMNA 2XACC 1BQKA 3E80A 1L5GB 2XWDA 3A67H 4HP5A 1MCJA 5IQ7H 3D0AA 1JUFA 4UQ2B 3NSDA 4XP4L 5EBLB 5T5FH 1MLCA 2K4WA 2GY7B 4XVSL 2J12B 5L2KB 3FCSA 4YBQD 3FT3A 1MVUA 5L8KB 3FSVA 3V4UH 2CCWA 5KS9E 3U4BH 4LBEA 3OHXC 5ALCH 3DX3A 4HXBH 2BJML 4PEEA 2UZIH 3KYOB 4CU7A 3CFEA 3TJEL 4PRAA 2P48B 4J12A 4Z8FL 1ORSB 3NSJA 2DM3A 4DQOH 1LP9B 4AJYV 1WZ1H 1TSRA 4HEPG 2A1WH 1IBGH 4JQIA 4KQ3L 1N3NB 4HOWA 1BBJA 3EZJB 3W3BA 4LCWB 3F04A 3IFNH 4QRFA 4HZLB 5D1XE 5AUMB 4M1CD 5AVZB 4DEUA 5LUMA 3IB4A 4JRXD 3SDXF 3QARA 5A3ID 4NXKA 5F97E 2YUVA 2DMHA 4Z7WE 4HSCX 1LWHA 4XBGB 4TULH 5IHLB 1P5VB 1KYDA 4UCFA 4XPBH 4HCFA 1NAMH 1SXCA 4QUOA 4MD4B 3CN0A 3W39B 3WIHL 4RRPA 3UCQA 2P5WD 2NLJB 3FQTA 3GTVA 1G4RA 3O4LE 4Q2ZA 3EYOA 3AQXA 1UXSA 3P4MB 4TTDC 2DRUA 5DJDB 1FL5A 2YD9A 2FATL 3ZHNA 4N0CC 1UEMA 1KFGA 3DUSA 2IFFL 4PG9A 3EYUH 3TEUA 3M7FB 3WDJA 2Y5TA 1TQTA 2VB5A 1CR9H 3ARWA 2YQ3A 3ILPA 3NJNA 5IVNA 2RAMA 2RHEA 1F97A 2VABB 4XVOA 3D18A 3B6SB 3MA9L 1JIBA 2BWDA 4MQ7A 3ESUF 4PJFF 2AI0L 3RPBA 5MENB 1H3XA 2Z31B 4YX2L 3MZTA 2Z4QB 2XPGA 3N0PB 4K0OA 3FO2B 3MOBH 3P0YH 2BNRE 2E59A 2F8OA 3QXDB 5J11B 2IMNA 5I19H 3BH8A 1PNCA 3MNVB 5AZEH 2IAMA 4MD5A 4KZCA 3SDXE 1CD1A 1SOXA 1YEGH 3IN0A 5KZCB 2QVTA 4XMKL 5DZPA 2ENYA 4ISVB 4J3SA 4ODXA 3P3YA 4XO3A 1JNHA 1U6AL 1IFRA 5IESH 4NKOA 3KGRA 5JIPA 5FA3A 3V5KA 1DO6A 2VC2L 5JPNA 3NZUA 1U8HA 2J4WH 2VRKA 4FCAA 4U1JB 1WO2A 3ETSA 3TCLA 5DA4A 2EVHA 1QBLH 1H3PL 3DJTA 1HSAB 2FZ3B 4PWIA 2WB1A 4WSKA 4JANB 1BGXL 4OLUL 1UUSA 3EGSA 2JELL 3IGAB 3P11H 4KQ4L 5DJZB 3X1FA 2MRYA 1JGUH 1KELL 3SE6A 2ETWA 4DUXA 1OGPA 4I4WB 1BLIA 2ATPA 4TUUA 1VJSA 3BD5A 1SJVA 3CHRA 3EHBD 3L4WA 3MUGB 4Z0XB 3V0AC 4XMVA 5DJ8A 4EBQL 4G9DB 4OSUH 5J89A 1UEYA 2VLRE 3LRHA 4PY7A 4HS6B 1OE2A 4AITA 1WA2X 2XV2A 3QQDA 3VI3B 2G3MA 4PJIA 4WFHD 4UM8A 5K59F 3WNNA 4LAQH 1AKPA 4L4VE 3INOA 1U36A 4G3YH 3LXUX 4WEMB 4B9PA 2ZWNA 4QTIH 1I8MA 3I9PA 4X6BA 3Q2VA 5IROA 3VFSA 4NHCH 3SPIA 4YS4A 4H5SB 2EIJB 3EJZC 4PGDB 4IBUA 3MRCA 4V33A 3N43F 1G1YA 2OTPA 1NC2D 3P4OB 4NN7B 4K3JL 2GSGA 1KNOB 1J8SA 4LB8A 3S3PA 2ZOKA 1PLAA 2ZCKL 1CCZA 2ZG3A 5D7IF 3TJHC 3DXAD 5C0CB 1ET8A 4NWUH 5E6YA 3IYLW 3T2PA 4H7VA 5F1IB 1E3XA 2A6JA 3RZCB 1YECL 1R0AL 1FLTX 3FPXA 1QP1A 2OKMA 5CSZB 1JZ8A 5FKPA 4ELKB 4QGYA 2KERA 4ZFGH 3MRFA 4PJEE 5E8PB 3QDMA 2KKQA 3LEYH 2OQJA 3UGXA 4BBWA 2CBMA 4OCRH 5K59E 3TEXA 5GRVL 1M7UA 4F8PA 2EUWA 1N6UA 2G4EA 3BW9B 1KT2A 4OFYD 2MJWA 4DP5X 2PCYA 3MRQB 4PJDF 1KXVA 4POUB 1F4HA 5DGRA 1X7QB 3HG1B 1KJ2H 3BJ91 3BUQA 4HW6A 4ES8A 1R4XA 3FN0L 5TJWK 1MCPH 1U2HA 1C8QA 2DQDL 1Q0YL 3OMAB 4YSPA 1ZHLA 3T09A 4ZBJA 4G8GE 2J88L 3RL2A 3DDFA 4DO4A 1SEQH 4XTRD 3MRPB 4R97B 4OV5A 3CFDB 1T7XA 2AXFA 5D7IE 3BP7A 3P30H 1U8JB 4AYGA 1U93A 3D2UB 1HSBB 2FBOJ 4WI6A 2CLZB 4LOFA 3RTQD 1HXYB 1YEJH 4FXTA 2WXHA 1JNNL 4WHYH 5KVDL 2OL3A 2DD8H 2R69L 5DURD 3KPLA 1JHTB 4E9SA 1AQHA 4QOKA 1S5HB 4FLRA 4P46D 1XXDC 3PXJA 1OPGL 2QVMA 3MJ8A 4KZEL 5HHPB 2D7NA 4G11A 4HD9A 2JQZA 3MRLA 3TBYB 2GJZA 4P2OA 3M7OA 1PQZB 5ESVA 4PJBE 5D7LB 1X5YA 5I0ZA 3K4DA 2Q8BL 5FM5M 5BVPH 1QHOA 5I8EB 4B96A 3HOGA 2FT8A 2NCEA 4F1ZA 3D50A 3KVPA 2VN7A 3TEZA 2AEIT 2ZUVA 4EJ1C 2EYRB 4HULB 1F45A 2WMPB 4L5FH 5LLIC 3N41F 4WW1B 4MNQB 4QI3A 1IGJB 2YD8A 4WWKC 3HTLX 4AIZA 3VU2A 5GS0D 4O02L 4CJ1A 1LDSA 3GK8L 2XY1A 2O93L 2COVD 2BNQA 4OJEH 2J56A 4F2ME 1JPFA 3I75A 3Q2CA 5FECB 2RFXA 4JRYD 4Y16D 4IRSC 1PAZA 4ZNEA 5I15L 43CAB 3QS3A 1OO2A 3U0WH 1MHPL 2YFNA 3KJ4B 1IVLA 2WO4A 4ZODA 3WELA 3M1OA 4YNYA 2CRZA 1O5PA 4K5NA 4UZSA 2B77A 1JZ5A 1GPOH 2XBZA 4X5XB 3ZTNL 2UYLA 4PJGF 5E1IA 4MCNA 1S7QA 5FF6B 5HI5C 3UJTH 5I0DA 3AQYA 2A77H 4PV9B 5I6OA 5E4IA 2OA9A 2H1PL 4WUUA 2IALB 3HZVA 4HWZA 5F6IC 4OH2A 5GGUB 1I8AA 5T1DL 4JCMA 2PP8A 1XBDA 2BFVL 2ZXGA 3DV6A 4JPKH 4AH2B 1R47A 2Q6WA 3DK2A 4NWTL 3G3LA 1Z9SA 2IAND 5ICXB 2Q0ZX 3BUTA 1HWHB 5GZOA 1XGPB 4ZTEA 2MPVA 1D5XB 2DJUA 5CJ8A 1RUPL 2O5ZH 3OKYA 3VG0H 3IU4H 1O5DT 5EOTB 4HCGA 5BUPA 2WLMA 3VXSE 2C9SA 1F00I 1XL6A 3AUVA 4P2RA 2XTJB 2MCMA 4YBLB 1NKRA 2O1AA 2C3VB 4XMXA 1SLVA 1OGAA 3SKJH 4PR5B 3RWDB 1VLXA 4F7TA 4ONFL 1N12A 4KUZH 4DAGH 2DMKA 4AG4L 3SDAD 1KGUA 4E42B 4OLYL 4U3HA 2XJLA 3GLDA 3EJRA 4RAVB 1FDLL 2YN3A 5JIDA 3BPOB 3V52H 1SXNA 1DJXA 4U7KA 4PJGE 2MQ0A 3WIFA 3WJMB 2BVPA 4XMZA 2UY6A 4P23C 2QKSA 2A83B 5IQOA 1JGLL 5HYFA 5DEFA 3L4VA 1BXAA 4FCHA 1KB5L 3U1PA 3ARZA 5I8OH 1JZ2A 1G9HA 3IPFA 3VAEA 5I1KH 3ZHLA 3SYOA 2WWNA 4RZKA 1M57B 3DTXA 1IE4A 1O6SB 2KMWA 4ZXBB 5CCHE 2V2WA 1S3KL 3T2NH 4XNXH 3S88L 1OTTC 5FYKU 5EF2A 3VH8B 3NIGB 3O4LD 1KPRA 3VFOA 1HL8A 1FL3B 2YAOA 4A7GF 4MQXD 1ILSA 1Q94B 5E70A 4J3OH 4LSPL 1KBVA 3APMA 4J1UA 3VWJB 3CFIC 2WBJC 1QSVA 5LJYH 3UBXB 1BVKA 1Z9MA 4AV5A 4Y7MA 1AZRA 5AW5B 3TTYA 5DHYA 1XCXA 1WH0A 4GAGL 2IADB 4JHWL 1GW0A 2F68X 2UZYB 2G9HA 2OMZA 3RLSA 4UNIA 3ZTJG 4ADGA 1GC1C 4Y88A 1K5WA 3HHMA 4HLZH 4P5RA 3DKHA 1ACYL 2DQHL 2ZAGA 1D7FA 5FM8A 4PJHA 1X9UA 4IU2A 4FKKA 5DRWA 2K6ZA 3EH2A 3BVNA 1JUFB 1PY9A 1C5BH 2BOCA 3QG7L 1KIUA 4YDIH 1G5GA