1ECZA

Protease inhibitor ecotin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
142
structure length
142
Chain Sequence
AESVQPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTMMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure analyses of uncomplexed ecotin in two crystal forms: implications for its function and stability.
pubmed rcsb
source organism Escherichia coli
molecule tags Protease inhibitor
molecule keywords ECOTIN
total genus 14
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03974 Ecotin Ecotin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.550 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1eczA00
1ECYA 1IFGA 1ECZA 1EZUA 1SLVA 1SLUA 1EZSA 1XXDC 1FI8C 1AZZC 1P0SE 4IW4C 1ID5I 1N8OE 4NIYE 1SLXA 2Y6TE 1XXFC 1SLWA 1XX9C
chains in the Genus database with same CATH superfamily
5EOQL 3VXSD 3GUTA 4NQSA 4YHZH 3TO4B 1UZ8A 1VLXA 3L2MA 4KJYA 3O0RH 4HUKB 4KVPA 4PWHA 3NDYE 2BP8A 3MCYA 3ATFA 4X4ME 1SY6A 4M93B 1S7QB 1WHPA 2FQEA 1CTOA 1TPXB 5BUGA 5A7EA 1E50A 1XGUA 5CSZA 2O1AA 4GY4A 2PWGA 5I1DB 5KN5A 3VQ1C 2Z7YA 3F05A 4GG6E 1RU9H 1MCKA 5EO9A 4G6AD 5CP7A 5H4ZA 2E7CA 1MNUL 4MAUH 5M7QA 1FNEA 4YO0A 4MDRA 3QYCA 1HHGB 3G04A 4KJWC 5CBAB 3MGOB 3DO3A 2DQEH 4OJFH 2XIDA 4Y4HC 3SBRA 3V0IA 3WUWB 3X13A 3QO1B 3Q9QA 3V4PL 1Y7VA 2PWFA 3JV4A 1RK0A 2F08A 3NEEA 4Y5YC 4N5ED 2QKSA 3G08B 5GS0H 3HG1B 1ETA1 4UYQA 3X12B 1WEJH 3OBAA 1CUOA 1RP8A 4JFZL 4G42A 4X98A 1ZANH 3OAZK 1G7HA 2X89A 5DR5H 4F37K 3DJRA 1WCBA 3HNSL 4XMVA 4GIAA 2VE6A 2HH0H 4HAKA 1K5NB 5CSZB 2UVEA 1UB5B 2VLJE 5D6DC 1TVDA 4FOMA 3RIFF 2VN5A 1PY4A 1PLBA 1SMOA 2BP3A 4WI8A 3L3DB 3CTTA 1EV2E 1CBVH 4P3CL 5AKRA 5GS2D 4QLWA 4M93C 2G3ZA 2ED8A 4UUJB 5KBLA 4G8IB 3C2SA 3F6LA 3VI3B 2P7TB 3W11C 5J5EA 1SOSA 1C16B 3O45A 1HKLH 2W59A 3BH9B 4Z78A 5FO7A 1Z3GH 4N9OB 5KUKA 3L3KB 1SLVA 2WB7A 3BGFB 4UT9H 4XP6L 5DDHA 2MHAB 3GS0A 4WHYG 2ZXCA 2J12B 2CJSA 5DJ0A 4LVOB 4QRQB 1AHWB 2YO3A 4TNVF 1J5HA 3MRRA 3TYFB 4JRYE 3UZEC 2J5LB 1BFOA 1M2VA 4PJEF 3S35X 3L8QA 3TIEB 3BHBA 3IDNB 5JORB 3D2UA 2GJ6A 5C0RL 4YHYC 4JO1H 5EU4B 1QTPA 2EYRA 4F3FA 3CBKB 4PJIA 3KPSA 2MKWA 3TURA 4OKDA 5DJDB 5B1CA 2GJ6E 4WUUB 1YY8A 1KLGA 3AREC 3BAEL 3PPEA 2Z7UA 4FLOA 3KPSE 5DUMH 3B43A 5HJBA 3VI3A 3WTYA 1D5IH 3K6IA 1OGTA 4ETYA 4LCUA 3BH9A 5AW7B 5H2BA 1J18A 2Y7NA 1ADWA 1N5AB 1RZIA 1S9YA 2AAVA 3CVHA 1SEQH 3A47A 3IXTA 2PCYA 2ZCKL 1WC7B 1WCQA 3E3QE 3OR7A 4UQ2B 1KXHA 3K74B 2LHAA 1XEDA 3GMPB 2OYPA 3NJNA 1N70A 3Q2CA 4ZNEE 3NJIA 2ICEB 5EUKA 1AD9B 3W9DB 3B5HA 2HJFA 4MNGB 1F0LA 5BNXD 5EZOH 3ZDYF 2XYBA 3ZSSA 3RPKA 4I0PA 4RGND 3B37A 4LP5A 3LXCA 3Q5TA 1T7VA 2G60H 5EU4A 2W0PA 1X6NA 3DBSA 4OGAD 1IGFL 2WVVB 2YARA 2EC9T 4TTDD 1MAJA 4MLIA 5KBNC 1OLZA 1DJIA 4JFQA 3PHOA 4X42A 4KH9A 5I1IL 4XNXH 2JKXA 3F7YB 4Y1SA 3TT3L 3MUJA 1DN2A 1NCDH 4R4ND 4ELMA 5CLXA 1GMIA 1JPSL 2GTWA 2PPAA 4LSTL 3JWOL 3H3BC 1KBGH 1NGPH 4HKXB 1NL0L 3OAZH 4KTYA 4U3CA 4I3RH 2YRLA 1BZ9A 5J6SA 1TTCA 1T0OA 3T77A 3OR7B 4M1GL 1LE5A 3HC3H 3Q6FA 1NANI 2X70A 4K3GA 2DV6A 3T3MB 1AGCA 5EV7A 2NUTB 5IT2H 2E74C 4TQ8A 5E1GA 3GKWH 4QTIL 5HGDA 2HKFH 1G9EA 3RNQB 1AI1L 5HGBA 3KH3A 1TZHA 1GKEA 2RMNA 3CLEL 1MZYA 3O11B 2WUCL 4Y16C 4XMTA 5CD3B 3KBFA 1OPOA 1CGSL 4DP9X 2XTJD 2VDOH 3OB0K 2CKBL 2A6KB 4N1EA 1S7UA 5AAWC 3NJMA 2C34A 1SN2A 2UZYB 3JWDC 4LKCB 2DICA 2NYKA 3S6CA 4FQLH 4UAHA 5DU7A 3IMSA 4OI7A 1IZJA 3Q8CA 1A0QH 1U8PB 4PM1A 4UYPA 2O30A 5A2BA 2E27H 3B2PA 4PCSA 4ZOEA 4FCAA 3VFNB 3PFUA 1NCAH 5B7MA 2C1PA 4HJIA 2FZ3A 4HJ0D 2CH8A 2E9IA 2EXWD 3MA7B 3FQTB 2BSCA 3VI4F 3K4DA 3MACL 3WKYA 5E2VL 1A9BA 2VMFA 3QJHB 4RSYA 3VWKC 4EKJA 2VDQB 4AQ8A 5FOBA 1GGCH 3KXFB 3HNSH 1IEBB 1UD5A 3LNDA 3RUGE 3KYOA 4OVVA 4DPBX 3MNVB 1YEIH 5TQ2H 3H7BA 3EXJA 1TITA 3VXOB 1JD9A 2IH1B 4OD1L 5I1HH 3MV7E 1ACZA 4OFYA 4YZFF 4LHUB 5JPMA 1PLAA 1U8LA 4M8UA 3CSGA 4MA1B 5DS8A 3R19A 5L4IA 2JE8A 4QHPA 3UYPA 2EQDA 4X4XA 3S36L 4ZFGH 2AJSL 4QGTA 3QI9B 2NY3D 2DM3A 2QVIA 4X7CC 1ZT4B 5HVWA 5D7JA 5JDSA 5I23A 2VXSL 1S9KC 3MO1B 2WQWA 1PYWA 3DXAE 5EUOE 3SIKA 1J1XL 1DFXA 1KBVA 3G6DL 3LQMA 4JPIB 1OGAA 3KBHE 3VXMA 5AOLA 4ES8A 2IGFL 3WO4C 2CUAA 5DO8A 2I25N 1VGKB 1E4XL 4BFBD 1AKJB 5AKTA 3D06A 1EJFA 1A7QH 1C8QA 3DJSA 2ZAHA 3HMWL 1YMHB 4OM1L 4U1HA 5J3HC 1C12B 2XVLA 2OXGB 3GBEA 5E08L 1MFCL 5C2UB 4YDJB 3AY2A 1JF6A 1OTTD 2XTJB 3K0WA 3UO1H 2WO4A 4X8JB 3DVFA 3MRGB 1L9TA 1M7DB 1FFPB 5T3XD 2XVBA 4G9FB 5HYJA 3N42B 4V2BA 2WNWA 1QYGL 4O02H 5LCVA 1TIUA 2OI9B 4NP4H 1ZV2A 2ATAA 4XNYL 2NX5D 5E4AA 1ACXA 2VDRB 4KX8A 4IU2B 3FN0L 5G4MA 4QXUL 1SJVA 4HPYH 1J88A 4OLEA 4OUUA 4LDEB 1NEZG 2IFFL 2XZQH 1E8YA 1FZJB 3BAJA 2IANB 4M02A 1CXKA 4Z7WF 4QHUA 2LV4A 2VRKA 3L7FB 3VMOA 5FB8B 1N67A 4UU9A 5C92A 1Q72H 4ODXA 5I15L 2QZ5A 4E5XB 1RFDH 4G1EA 1I8MA 3LTVA 4H20H 5H94B 4FA6A 4MSWB 1H8OA 5JW5A 4WW2B 1FZKB 1IGTB 3T2PA 2Y36L 4DEPC 1F4XH 1QFHA 4G5ZH 4P2OC 3QUZC 3L4UA 4AX3A 4U7MA 4LU5L 2Z0BA 1Z5HA 4OZHE 4GQ9H 3BQUD 4Y4KA 3EYSL 4WIQA 2DL2A 1T89C 4RFOL 4NZRL 1MHEA 4AE1A 3QWQB 1NDGA 3RI5F 3IDJA 4JFHE 4E9VA 4F8QA 1ZOXA 5DEGB 4KJYB 3ULAB 4BDVB 2QQLH 1A9VA 3T0ED 3GSQB 2H1XA 2WSKA 3PHSA 5IW1B 5E6IC 1KBGL 1NGPL 4HG4K 2O5NA 5K69A 1GGBH 3E2HB 4QHNA 3VGAB 3AWGA 4HJ0C 3VXRE 3ZTCC 4TV3A 1PPIA 3AQYA 3PL6D 2VITA 3FZUC 1J8RA 1BM7A 3ZTEA 1FGVH 2XVKA 4PJXB 1H9VA 4YDKH 4P8QA 2GHWB 2X4QA 3OJ2C 4G11A 4LE8A 3TPUB 4NQXB 2R2EA 5C0BA 3RWJA 4GFXA 3IMTA 4AL8C 4PD4J 4CKVX 1RSFA 4IIQA 4ZUSB 4FEMA 4EAEA 1XMEB 2CKBH 1IC0A 5EZLA 2AK1H 5FA4A 4WF7A 2Z0UA 3CVDA 2YKLL 2EVFA 1W8NA 3DX2A 2P5EE 5TPWH 4CW1A 5F8QC 5ID0A 2O6DA 3ISWA 3W39A 5AAMC 4K2UL 2X28A 3CFDB 4GMSH 2R2BA 4ODUA 4EI5A 4NM4L 2FIKB 5DVMA 1E9OA 1XHHA 4LQ1A 4TLSA 5F1IB 5CEXB 3DV6A 5MENE 1DBBH 4ZFFB 1DN0B 3WNLA 2DKMA 2VMDA 5T33L 2DLFL 3ABMB 2A73B 4OCSL 2CO7A 1G9NL 1GZQB 3TCTA 1IGJB 1SZNA 1H3PL 3RWGA 4BHUI 4ONGH 1P2CB 3FHQA 4XX1G 4Y4HA 5AKVA 1FV1A 4FQIH 4NC0B 3WS3A 4M5TA 1OZUA 5I6XB 1M1XB 2BOBB 5I1HL 1M6UA 5A16B 2BZ7A 2AAAA 3Q2VA 2DW5A 1H6TA 5DK2A 3MRDB 4G8GE 1GL4B 2YD5A 2Z8VC 1YC7A 5IW3A 4N86A 3WNMA 3H56A 1OE3A 5CSBA 5DJ0B 4JM0A 1P7QA 1TLKA 4KRPC 4Y16B 3IJ7A 5HD8D 4AGNA 4QXGL 3CFDA 3CVHH 5JO5A 3AM8A 3IDMB 3QZLA 4LF3A 4NQUA 3RUGF 2HG5A 4HKBB 4XH2B 2CSPA 2VXQH 2EP6A 4H8WH 5HJ3B 4BFNA 1J1XH 3G6DH 3JWNC 3EDJA 4XCCL 1JHTA 3QPQC 3UTQB 1T6VN 4IKIA 1G4MA 3WCYA 5JHDD 3KPRB 3LSOB 4A7VA 5AW5B 1A25A 5D93B 1E4XH 4P2RE 4XNMA 1OP3K 4HUNB 3QDGA 3IN2A 2C3GA 2G3MA 4H88H 4IYKA 5E2TL 1MQKL 4OF0A 3IJ9A 1H6FA 4KO5A 4MAYA 5A43C 4X5XB 5J3HD 3SPVB 2NRDA 5E6YA 5E08H 4LEBA 5DURB 2HRLA 4GAJL 3ECWA 1FZMB 1T5XA 4U1SB 2B14A 3EW3B 3RFZB 5A2KH 4O51B 4DGYH 3EJUA 2XQBL 1OTUD 4ZX3A 4UQBA 2P46B 4FJZA 4TNFA 5I1GL 3CPLA 4LCIL 1FL5B 1GAFH 4APXA 5I30L 1PVHA 1VDGA 4FTVD 5D1XB 4FTVB 5I9QB 3RBGA 3W0WB 3W0WD 1AIFA 1GGYA 5I1KL 2Q6WB 2BP8B 3PRZA 3QFDB 2HT2D 5E8NA 3EIFA 1KB9J 5HVHB 1AO7D 1TTAA 2ZKHH 2JNZA 2DYPB 3UP6A 4PY8I 5JPNA 2OS7A 1Q72L 2LLGA 4ONOA 3MV8D 2OJZH 2F53B 4CSTA 4HJEA 2VC2L 3B2VL 3KJ4B 1MVUB 2WXQA 5I6OA 2BNUB 1TLMA 1YN7B 5DHYB 4PUBL 2J3SA 2UWEB 2VQ4A 4J3XA 2X4NB 4RQQB 5GGSB 4WO4D 2AJXH 4U1IB 2CBQA 3S34H 1XIWC 5IBTH 1TQBC 2W38A 2JWYA 1IM3B 2AJYL 2EDYA 4PJ9C 5TK2A 1MW3A 4DOHE 4ZFQA 3SE3A 1DUZB 4XPTL 1U8QB 1MVFA 2E46A 1WITA 4OZFH 3S7GA 5KSVB 5KYYB 3E38A 4AVIA 4DPAX 3KPSD 5L2KB 3LD8B 3MFGB 4QHLB 3E80A 3VVWA 3OPZH 3F6JA 2NY5L 5AW3B 5J06A 2OJ1A 4AW7A 1XCQB 3W82A 1OSZB 2BVPB 4CMHC 3LKOB 5E7BA 3NCYP 3WFHA 4QRTA 4XNXL 3APMA 1XH3A 2WMPB 2AK4E 4LOUD 4HZLA 1BVKA 5HTSA 1I9IL 1NIBA 2ZUQB 4HA1A 2NSXA 5ACMA 1T5KA 3AG2B 4LCWB 3KPQA 4U2ZA 5SWZD 4EXKA 3VXMB 4MCYB 4YDKL 5CFAA 3GMOB 3WTSA 3F5WB 3IK2A 4Y4FC 1E9PA 2D03H 3J07A 5DHVA 2X6VA 2CHDA 1PW3A 4PWGA 3RVXC 1RIVL 4HCIA 1S6NA 4MJ2A 2Z8WC 3SDXB 4GUPA 3ZMRA 4H25B 4X7SL 4XO4A 2EDRA 3I75A 5JHLH 1JVKA 3ZLQC 1HI6B 4G9FE 4K8RH 4R7NB 4GG6A 3VE0B 1A4BA 1WTGT 2ZCZA 3L17A 3VFWA 3HE7B 3HHMA 1ROWA 3U36A 4G9FA 1E8XA 1QUNA 2X9XA 4OJFL 4CVXB 5IGXH 4APQC 5CSGA 1YEDB 4WU7B 4XCNB 5CEZE 3ZE2B 4OFKA 5JHBA 2EIZB 4Z76A 3V9CA 4WSGA 3SBWC 3ROLA 3WE6A 3VA2C 4WQOA 4GRLB 4F7EA 3OC5A 4HUXA 5HDRA 1A0QL 2E8ZA 2BSEA 3DX7B 3IETA 3R4RA 4B60A 3IDIA 4AK2A 1XGQA 3PXJA 1F42A 4LSVL 2Q2EB 1G43A 2OCFD 4OIBA 1K3IA 4OZHF 3EO0A 3LQZB 4E5XA 1CD9B 1AC6A 1JGUL 1QSEE 3IEAA 2YGOA 4BK5C 2D0HA 3NQIA 2VDRH 4F2MA 3CDYA 3VD9A 1F6FB 1R5WB 3CFKA 3IBEA 1QAWA 3N40P 5I76B 3TVMC 1I1FA 4LPVA 5CJBA 1ZK5A 1WCBB 2X4PA 3ARFB 1BVOA 1YJDC 2GBAA 4KQ0A 1A6ZA 3T4AA 3MV9E 3UP1A 2CUHA 3ZQXA 1ZA3B 1LP9B 2YWYA 4FKHA 2ALAA 1NPJA 2XWJA 1DVFC 4IDJH 4LPTA 3FRUB 1I3GH 4B9FA 3ZKMD 1NLBL 4AC2A 2H6PB 2DIBA 4ZTOH 3ETBF 5CN1A 4PRPB 4YPGB 1BXAA 4XC3H 3OSVA 2ZXGA 4WWPA 1KGIA 2FJUB 3FPXA 1ZHKA 3RL2B 1X3DA 5EOTB 3SDDB 4WSKA 2R2EB 1O5DT 5C0BB 2HT4C 3RWJB 3ARUA 3AS0A 4GAJH 5KSBE 3L5XL 5F7MC 3TN0B 4P5TA 1L4IA 1SOXA 5K9QG 2QBWA 4PJIE 3F7LA 5C70A 3W5NA 1WE5A 2V17H 1URLA 3LV3A 4QHKJ 3AREB 2V5RA 2D9QB 4X7TA 1IIIA 1VSCA 3LQAL 4XAWL 3RIAK 3TIEA 1G7MA 2ZKXA 3LNHA 1MFCH 1TO5A 3IB4A 4QRQA 4F9LC 3Q6GH 3VWJB 2VR3A 1D5IL 3ZHLA 3TEYA 1T1WB 3ARGA 1B3IA 4FA7B 2EICA 4IJTA 4JO3L 3M6DA 4WI5A 3FYEB 2O5ZH 2ZOKA 4JN1H 5ACZA 1IJ9A 3ABLB 3MJ7B 1DN0A 3QT2A 4UIKL 4XMPL 1D7CA 2B0SH 2ZKHL 5GGRY 5SWQA 4JQXC 4PVLA 5D5ME 2XYCA 2WQUA 4H8VA 5B7FA 2XSKA 2ZG2A 2JV6A 5C09E 5J4MA 1HINH 1H9DA 3OAUL 2VXTL 4DJMA 2BVQA 3EG9A 4WWKA 2XZQL 1XH0A 3HLKA 3LOWA 4AYID 3LRLA 4O9HL 4DP2X 5B1JA 3KS0H 3MNWA 4BFGA 4B97A 3QDMA 3UEQA 3LKPA 4U1MA 4FKEA 2AI0L 3ILQD 1ZS8A 3UG4A 1GC1C 2F5AL 3O3EA 3V4UH 4AQAB 1HQ4A 4LU5H 2DQTH 1JHKH 4Q9QL 1R3IH 2NCEA 3QFJB 3EFOA 1QBML 5IVXB 4OQTH 4U6VH 1NL0H 3CMGA 1OOAA 3DYMA 3DGGB 4NZDA 5EOCL 4LDLB 1A6WH 2FSEA 1TSRA 4JG9A 2XRAL 2FJGB 1GRWA 1XT5A 3TNNA 3GJFH 1OAKL 3RIKA 1IO4C 1ORSA 1JMZA 1R3KA 2ZWZA 1ROCA 3TBVB 1CDGA 5JW4M 3FFDA 1A02N 5DS8B 3HC2A 4C54A 4WI4A 2F18A 2XA3A 4UQ3A 5T5FH 2AV7A 1PY9A 1SXAA 2G5BB 1ADQA 3EBAA 4NZUH 4CSPA 2J6WA 3HJEA 1FGVL 2NYYC 3QIBA 5B8CC 5ADOH 5D2LE 3QNYB 2XWZA 3AQXA 3DHJA 1R0AH 4K8RL 2CCLA 1HSAA 4TSAH 1R5VB 3RDJA 2K4AA 1JK9A 4FQLL 3ZXAC 2MPAL 4GBXB 1AJ7L 3JTBA 1FJ1A 3HS0A 3DSFL 1EO7A 3A6BL 1AKJA 1QKZL 1YMMB 5D2NC 3GSNB 2OMZA 4L4VD 3TOPA 4Z7QF 2A9MH 3VRLF 1A3QA 1DVQA 2ADIA 3RWIB 3T0EA 1MFAH 3D5OF 3EJSA 2QGEA 5BXFB 4TYUA 3QXTA 1UB5A 3IRZA 4YJZL 1YPZF 3VDAA 3GMRA 1LQBC 1QNIA 1FSKC 1WD8A 4YC2B 5ADPH 2XV2A 3LNGA 1U8NB 3DSNB 5T33H 5JO5B 4Y2OB 3RGVB 1W0VA 3MBEC 4PY8J 1HHIB 4OD1H 3V7AE 2XPYA 1C08A 1H0DB 3IE9A 5T1MA 1QNZL 2VZOA 3IAPA 3PCYA 1U58A 5C0GA 2VLME 4PGDA 4U3XA 3ZY7A 3M45A 3KPOB 3B9KD 4BBWA 1KDIA 4AQEA 3II1A 2OMYB 1AKJD 4PHXA 3BWZA 2WK2A 3PQYE 3LKQA 2CKBA 4OLXH 3AABA 2MOGA 1CG9A 1NLBH 2IAAC 1S5HB 2E5EA 1A6TA 2X6BA 3FAWA 5J11B 2GJ6B 2NY0B 4ZOAA 2P48B 4L3ED 2KI6A 43C9B 3WN6A 3ZE0E 3RGHA 4YXHL 1PCXA 2YPKA 1A7QL 5KSBA 4AXWB 3STBA 1KACB 2Q8BL 5CINL 3UXFA 4DP5X 2XTJC 2ALWA 3ETTA 4N6RB 4PJIF 1SHXA 2W8CA 3U7WL 1GOGA 4AYSA 1FO0A 3BAKA 4H88L 1TU2B 3NZSA 1PJWA 4K3EL 4L8BB 5I8OL 4AZ8A 5IB4A 1NKGA 3MV11 1Q1JL 1JI1A 4AG4L 2C4XA 4R83A 4LLMB 2DJ4A 4UQ2A 3C87A 3C9NB 3N1GC 2DLTA 2X2IA 4RZCB 4XAKE 5BVJA 1UXWA 4GNKB 1OAXL 4HPYL 1M7DA 2XBTA 3R18A 5LBSA 1UENA 3JYBA 4G7RB 1D5BA 4E5XG 2VH5H 3HZVA 1Y18B 3QZNA 4PREA 1I9JL 2M83A 4MXQC 4N8CH 4YFLI 5HYSA 5IBLD 3ZYOA 1HINL 4I8DA 5KSVA 3SGKA 1JNNH 3H3PL 3QH3B 3RWCA 5ITFA 3K8KA 4MNQD 5D96C 3F00A 1HK6A 1PZDA 3T2OA 2J73A 4BZ1L 3MLPA 4ZDHA 3A6CH 5C0EA 4MWFA 5C8JB 2XWEA 4RRPG 3BDBA 3DA0A 2Q76B 5A2AA 2EC9U 4TLUA 1N59A 4HHGA 4KQ3L 2VDMB 4Z5RA 3K81A 1MW1A 2AJYH 2YZ1A 3QXDA 4V11A 2J88L 1AZCA 1JZHA 1Z5LA 2IDTA 1ID2A 2CLZA 4GRWF 1B0RB 1MUJB 3ZK0A 1E4KC 3TJHD 1T3FA 4IOFD 3HZVB 3MLUH 4JHWL 2P44B 3W0WA 1EDHA 1Q9OA 1RZJL 3MV01 3FRUA 3L2NA 1MJ8L 3HHSB 4X4MA 4A68A 3UAFA 2LW3A 2DEWX 3K2IA 1KPVB 4NGHH 5IZ7A 3O6KL 4UTCA 1THCA 3GO1L 4FYSA 4ZS6D 5D2NE 3BPLB 4K9EH 4M03A 2YS4A 4U0QB 2EIZA 1RPKA 3TWYA 5I28A 1BOGA 2F53A 4R96A 5IK3B 4AI7A 3QCTH 4ZS7H 1TEYA 2AK1L 2X4UB 3HFMH 5EBWB 3ASNB 1JXJA 4DGIL 4PRHE 5A6LA 3MOQA 4OLZL 3K6FA 2MPAH 4L3CB 5CF3A 2Q76A 2VAJA 5B1JC 3U1PA 5C08D 2JJTC 1KV7A 3MRNB 2NXYD 3DVIA 4F7PB 3EYUH 3SDXE 2PYFB 3TC9A 5I16A 3MUY1 4HT1L 2HX9A 1OB1A 4Y4FB 1DVZA 4Z7NE 2AQSA 1BQKA 2Q10A 5CCKH 2O6CA 4JE4B 3DOSA 1CPUA 4Z6AT 4NUPA 1NCIA 4WK0B 5IIEA 2WZ6A 5DD5H 4FQCL 3L45A 3KEHA 4BUQA 4U1SA 1RZ7L 4JK0D 1RHHA 5DQJA 4Y1AE 5CUSL 4GQZA 1NA8A 1TZGH 4D0DB 1UZ6E 4KVCL 4G7VH 3RPIB 1SM3L 2DQGL 3HIZA 3NIDB 1G1KA 3T5WA 3QYMA 2R4SH 1T0NA 1BZQK 4NCDA 3QCUL 3O4OC 3P4OB 4J28A 1XR9B 4KXCA 3MV7A 4DOHB 3E7JA 3HEIB 3N43B 4J2QA 5HHNA 4PVNA 1EXUA 2X4TA 1IGJA 3RWGB 4H8UA 1I8IB 1TZIB 3HB3D 1DANT 2BCKB 4YEEA 2C4FU 1EHNA 5DZOA 2R56H 4PJ7A 3TA3C 3VFWB 3RHWF 1U9KA 1S78D 1RLWA 2HYMA 5TQ0L 5L7XL 4BWWA 5DA4A 4PGJA 3OKLA 4HZ1A 5IQ9B 3QARA 3UBGA 2GTQA 2AEPH 4PJAB 1EHLL 2DMHA 4LQFH 1K8IA 2UY6B 2V9RA 4AEHH 3P02A 2P24B 1IM3A 4K71B 2YD0A 4CVZA 3MTXA 2WBWB 4Z3IA 4RMBA 1I3GL 3D7PA 3VFTA 2Z8SA 5ANME 5EF2A 1MY7A 1NGXB 1AP2A 5TF1L 4DPCX 4UZSA 3IS0X 1TJGL 2WIMA 2KBGA 2ZSVB 4WTZG 4ELMB 3MV7D 1WGOA 2YLKA 4NQEE 4E9SA 1DL7H 1YUKB 2GEQA 2Y07L 1I8UA 2IPKB 5DEZA 1FZMA 2WKLA 3T09A 1JPGB 3FO2B 2WZPA 1GXEA 7FABL 4L29A 1U8IA 1ASOA 2QSTA 3HG1A 1AGCB 3DNKA 1DEEB 3DBXB 4WDIB 1I9JH 3PAUA 5IR1A 3O3AA 5JIPA 4ZNCD 4G42B 4X98B 5E2WH 2YAOA 3O3DA 2WBKA 3C09B 3VFMB 1K4CB 4KAQH 5M95B 2ICES 4EXPX 3IAQA 6CGTA 2DQMA 4Z8FL 1UEYA 1EFQA 2DB8A 1R3JA 2RACA 3BOVA 3B2DC 3WTTA 1LDPL 1ZGLB 1G7JA 4ODTL 2WO2B 2BW5A 3X1NA 1FNSH 4X7DC 2H0FA 1HIMH 4Y1TA 1AP2B 5FA3A 3VU1A 1OKEA 2EIDA 3H9SD 4MASA 4PYGA 2YFOA 1E3ZA 1GKOA 1CBJA 1KIUB 5DTFB 1WIUA 4Y7OC 2DPKA 4KK6D 1XIWD 1L9SA 2P7TA 3TGXA 5L8LB 5BS0D 2P26A 3VWKD 2H2PC 2JB6B 2KPWA 4MB1A 3SKOB 4I3SL 5D1XE 1CT8A 2OQJA 3FB8B 3W0WE 5JW4Q 4HS8H 1YN7A 5DHYA 5EMYA 1UA6H 3B3IB 1I9IH 1ZT1B 5LHDA 3P4NA 1RZJH 2AK4A 2R0WH 3C6EA 1KIQB 5IWLC 5KS9F 2AGJH 5CBEA 1FYHB 3EYFB 4FZEH 4EUPB 4R7DA 3TYFA 3ELAT 4IBSA 2OZ4A 2A7BA 4M8QA 3VXRA 4NGHL 4DVRH 5K9QI 2HJKA 5IMMA 1O7VA 3HR5B 3RY5A 4DZ8A 2PYEE 2P45B 4A2MA 2FNBA 4LP8A 5BOJA 2XFXA 1IB5A 2PXYB 2IBZX 1MFMA 2VUOA 4U05A 3HZMA 4KFZC 2DYPD 1P5UC 2DKUA 2YAPA 3ATAA 3FTSA 4X7SH 1MI5E 4LEEA 3X1GA 3RILA 3DC0A 4JHVA 4EOWH 3G5WA 4PRHA 1PCSA 3FH5A 3SQBB 3SE3C 3LZFL 4GUOA 4ZUTA 3CDZB 4A2HA 4DH2A 1A4CA 4KKLC 5F7DB 5L9DH 3NPSC 1S9VA 3FQRA 2IC2A 4NDMA 3TFBA 3TO4C 3V0EA 4PJ8A 3A5VA 1E6OL 3N1QC 4ZO9A 5GRZA 2BY3A 4YPGA 1OGAB 2HSIA 5J1TC 2DWDA 4OGQC 5H4YA 1I7UB 5INDA 2V5MA 3VFRA 1TO4A 5C07A 2OSXA 5GSVA 4EN3B 4AV0A 4FNPA 2COQA 3CFJA 3ZHKA 1BYPA 4LLDB 5KW9L 3BDYL 4EI6A 1XR8B 3VNYA 2J8HA 2X3AA 5TFSL 1MFEL 2A0LC 3VFOA 2NQ3A 1HYRC 3EHBB 4KY2A 3DHPA 3FNKA 2EO9A 5GIRB 3N55A 1XGQB 4KGJA 4PRHD 3ARGC 2MTAA 3FQNA 1T21B 4F9PA 3KYAA 3BEVA 4MXWL 2VL5B 3TBWA 5T3XH 3NJFA 3T6XA 2O4EA 3GHEH 2CPCA 1TQVA 3BLPX 1ED3A 2Y1YA 3RVTC 3C12A 1DSYA 1KULA 4P5TC 1U92B 5LVEA 3IDGA 1I1FB 3WXVL 4HPOH 1BBDL 5L7XH 1U3NA 4XT1C 3OGOE 1LO0L 3HPJA 3MODL 2BS71 1MUJA 4LQFL 4ODXB 2UY7B 2XZZA 4XTRC 3U9PL 3D87B 3UO8B 5I71B 3TCXA 2ADYA 1F6LL 4M7JL 4LLDA 1U4FA 1Z3GL 4AEIH 3QJXA 5HJGA 2H3XC 2J55A 3QUXA 2AABH 5FKPB 2F19H 5ANMA 4W93A 1OV8A 3N41F 1UATA 2DOCA 3QO0B 4EEEA 1JGEA 2X89D 3OKOB 1I9RH 4RZCA 3WUWG 3O11A 3L5XH 4GKOA 1A1MB 4AIXA 4TXVB 1ILUA 5CJQL 4OCWL 4ZJ9A 1W80A 1RKRA 5HYSB 4PJFB 4C8XA 3LQAH 5T1LB 5I18H 3GSQA 2BZDA 3OB0H 3S35H 3UC2A 1TENA 1W6WA 5AB1A 4F7TA 1J1OH 5KBMA 4R2GB 1XCTA 3GRGA 4KX9A 3GUFA 3BAEH 4FFTA 4WKZB 1SF3A 2CBPA 1ONQB 3WEMA 2GUOB 3PGCB 3FO1B 3K8LA 2Q20A 3ZR6A 1Q8MA 1AGBA 3ZTJG 4I0CC 3T8XB 1Y6MR 1ZLVK 3MJ6A 3L5JA 2ZOKB 5SWSA 3NN8A 1RERA 2QMKA 2IXQA 2PP9A 1U91B 4ODTH 1FNSL 1T1WA 3ARGB 2MCPL 4YH6A 4HJJH 5DJCA 4JX0A 1DFBH 6TAAA 5EZOL 2J21A 3E1ZA 3GTTA 3T4YB 4Z3EA 4PTUA 4KOBA 3OLIA 4IIQC 4I3GA 4NUJA 2BRRL 5CEXA 2X7LA 1U2CA 2CRIA 1LEIA 5DZLA 4A1RA 3ZUCA 2BVQB 3EG9B 5E4EC 1G7LA 2WYIA 3D3VE 3KLAA 1P4BH 4NO2A 4BUHA 4U7SA 1FH5L 1JXKA 4RAUB 1XDTT 4TF4A 2OMWB 2V2TA 2MPVA 4YHZL 3ECBA 1ZIAA 5ALBL 4I3RL 1RVFH 4QMEA 3KPOA 4O58H 1BYOA 1CLYL 2PYFA 5E8DH 4PGEB 4LBAA 4ODBD 3HCVA 4QTFA 2YC1B 4QO1B 5D2LA 2HKFL 5D7KE 5AQ0A 1BZ7A 4B7IA 1CLZH 5FYJE 5D5MB 3WJMA 4HIIA 1ZTXH 2GJZB 3CLEH 4JDVA 4JZJA 3GXNA 2WXGA 2NZ9D 2R9HC 2HVJB 2YQBA 1TQBB 3GJFB 3QNYA 1WS7A 4LBEA 5TTRA 3SGEH 4W9GC 3HFML 3JVFC 4UT7L 1HSAB 5E5MB 5EO1B 1M7XA 4UQ3B 1OWRM 5F6HJ 5ENWB 4UIMA 4KKQA 3FUMA 3K0YA 1KDJA 1T0NB 5DC9B 1MFAL 2ZKYA 1BQSA 4N6RA 1F2QA 4FXKB 3AJ7A 7PAZA 5EFIA 3HE6B 4FZ8H 4WNQB 4Y2DB 1K4CA 4GB9A 2DRUA 1GW0A 5IVOA 1MFEH 4GBXA 1FZKA 1IGTA 4PW3A 1UH4A 5GZOA 5BV7H 4KDTA 2FO1A 3ZZ1A 1ZHLB 2NXZC 2JKWA 3FQUB 5IEKA 4YDIH 4NM8H 2J8UF 5GJSH 1RZKC 4P3CH 4J3OD 3RFRA 3U4EB 2XN9E 1TZGL 3CZFB 4JW3A 2H6UA 4K73A 4R8WL 1AHKA 4G7VL 3SJVA 1JV2A 4HIIB 5FC9A 1CFQB 3VYPA 4BCXA 1PY0A 4KC3B 3UAJC 4E41A 4HGMA 4ZZFA 5AENA 2W9DL 1QW9A 2UZXA 3RVTD 4Z77B 9PCYA 1MPAL 3DJ9A 3B7RL 4IOSA 3VDBA 2DQ6A 2AZAA 5FO9B 1VKXB 4FABL 5E8EB 4AT6A 4PJCF 1OW0A 3UMTA 2SEBA 4GAGL 3QDGE 5T1MB 3UERA 3PXLA 5KJ4A 1NGZA 5GGTA 1BX2A 1P53A 1XFPA 2FYYA 3DPBB 3GLAA 4DZ8B 4LEXL 5DZAA 1CQYA 1ZRUA 4JFOB 4MA8L 2Q86B 5EBLB 3TJEH 4EIBA 1ZHLA 4BQCA 2NQCA 3UIYA 3VXNB 4OGYH 3JVGC 5EZLB 5FA4B 3VWJA 5JYMA 3MRIB 3KAAA 4QHLA 2QPFA 3HMWH 3WIHA 4QOKD 3TF7C 3PGFL 3CXHJ 4DGWC 4XXCA 4KV5E 5I18L 4E41D 4JG1H 1K9TA 1U93B 5F7DA 1W16A 4YGVB 3NBNA 2YD9A 5I6KA 2DYSB 2Y7QA 4L9DA 2N7SA 4FCHA 4IOSD 3VFPA 1HN1A 3NPZB 4LLVB 1WYJA 5HI5D 5KSBB 1EXUB 3D8MA 3LHAA 1VACB 3MGOA 1DL7L 1ZVSA 2FX9L 4C4KT 4TQEH 3TTYA 2RD0A 3ULVH 5JXEA 4JY5L 4MHHG 5HP5A 1F4WH 2VW7A 1ZSHA 2MH4A 5IQOA 4E2OA 2IQAB 2P42B 3FN0H 3BZ5A 3RPBA 4UOW0 5BVJB 3C6LD 1BX2B 1S5IL 1J7VR 3QNFA 5T8IA 3E0GA 1LK3L 3VM7A 4L48A 3FF8A 4M5ZL 2X6MA 1HI6A 1U8HA 3B2XA 4LLMA 5DD3L 5F6IB 3GTVA 2DQUH 1SEBA 1CT8B 3FHAA 2XDHA 4PJHA 3GT6A 4QF1B 4YXKL 5A2IH 5JW3H 2H3KA 4L1BA 5ICYA 4BFKA 1TKWB 3WFBH 1Y07A 2ZP0T 3TA3D 7PCYA 5J89A 5FCSH 3RNKA 4OH2A 3MQIA 1NFAA 3IJHB 5IF0B 3WIFB 2CO2A 2V5YA 3OAYK 3QHFL 3VFPB 2WVUA 2R69A 1HYSC 4W70A 2NX5A 3STLB 4OLYH 4JPWH 3LRKA 3ATBA 1KJVB 3DX6B 2IPUG 4WUUE 5E9DD 1M7IA 3RGVD 4U0RC 3L3KA 5DVNA 3AMLA 3GBLA 1RVFL 4L0ZA 1N12A 3FTGB 3IGAA 2GC4C 4FXLA 1UA6L 3FPYA 3V0HA 4YVUA 1SXSA 4BFOA 4P2YA 4W4OA 3MDJA 4PI0A 1FJ1B 1MJJB 2XKNB 4PJEE 2CRYA 4M8VA 3WN5C 2Q7AA 4ABUA 2V9UA 4PRNA 1GS7A 5MEPA 4YSRA 3LRMA 3ETSA 3CFJB 2J4WL 3HE7C 4ANWA 2OTWB 2AQ3A 2WLHA 1KXVA 3BQUA 3RGBA 3N44F 4B41A 4PJGA 1KIRB 4FLHA 2HX8A 2ED6A 4NEHB 4G72B 5F70A 2E27L 3MN8A 4YGAB 5BZWB 3LEVH 3IRPX 3LZFH 1QD0A 1ZVNA 4XXCC 1SOQA 4PJGE 2G75A 5IQ7H 5DMYA 4L9LB 4OCYL 5E5UB 3G6JB 4OCLC 4AUUA 4JQIA 2NZ9C 3OMIB 2ROYA 3RGVA 1RUAL 1B0GA 4NS0A 4H13C 1D6EB 1BEYL 3IVKA 4LCWE 2GSGA 4FZ8L 4Z7IA 3ULUF 1JRHL 3MV8E 4AGQA 3DHUA 3TFKC 25C8H 2ID5A 2ZUQC 4XXDB 1KSRA 2NW3B 2FBRA 1RHFA 3FOMB 4ONGL 1N0XL 2FBJL 1MHHB 5FYJD 4GW4A 5KW9H 1WZ1L 5AZEH 1M42A 1KUMA 4NN5B 1UZ8B 4FQIL 3BDXA 5INCA 3R06A 3S37X 2CO4A 1RJZB 1P1VA 4F91B 3FH7A 4LAJH 4A7UA 2N59A 4TTDC 1WZKA 1AYRA 4NOFA 3KPRE 1XGUB 3ECQA 4Z95H 5DHMC 3UAAA 2G9HB 3M8OH 4ZX6A 4MXVF 5LB1A 4FABH 3FUHA 4U31A 2PW1B 4X9IA 2H0JA 3BP7B 3MU3A 4H0HB 1XD1A 1EHLH 5E94B 5ESAA 1AMYA 2EJ1A 4UT9A 1F1AA 3UTOA 4DN4L 5KS9A 4TVPD 1JWMB 4OIIL 3HNTH 3FUJA 3PDDA 3HI1A 4OM1H 1GZPA 3G9AB 5HVHC 4WHDA 2WY3B 4NFBA 3ALXA 1I8IA 2BVUA 2D9CA 4FHKA 4GUPB 4Y4HD 5D7HA 4ZMQA 2CIKA 3I6GB 3TJEL 5L2JA 4PR5B 2CLRB 4M7JH 2EDFA 2OMUA 3MRBA 4AEIL 4EQ3A 2FBOJ 4FLSA 4X4YA 3FO1A 1F3JB 3WFDH 3JTSB 3PHAA 2R0ZL 2VZTA 4JG1L 4NP4L 1XWVA 4DPRA 1QLEB 3QS2A 3FB6A 1IC7H 5FYLL 4E42A 5GS3A 5KANG 3VYNA 2AJZB 4DGYL 5EZJB 2HVJA 1WQVT 5E1QA 5IVZA 2HJKB 5KJ7E 1UASA 4JDEA 3BO8B 1Q9KA 4P99A 2LLNA 1AZUA 4R2GD 3S35L 5JLZA 5C09A 4QHMB 4M5YH 1J1OL 3L95A 5T3ZL 3L3IB 1MWOA 5JHDA 3MMEA 5T1LD 3Q3GB 3UBXI 2ZSVA 3TNMB 5EF3A 1JF1A 1U2HA 1UM6L 3PNWB 1R3LA 3LXBA 2D7TH 4ZO7A 1SOKA 4M5ZH 5DD3H 3MYZA 5D1ZD 5T3ZE 5E7FA 1YAZA 4NNYA 1CDBA 4MAYD 4GQ9L 1HAWA 1A7NH 5AVQB 4L2YA 3KDPB 3NH7H 4PJXE 4BYHA 2IG2L 2IH3B 1SGKA 3VXQA 5I75B 5IQLA 3RY4A 5FLVA 1BIIA 3FQWB 3L48A 5BMFH 3L6FA 2AQQA 4IRJC 1M6OB 5GZND 3WTVA 4BQ6A 4MNQB 3QQXA 4HHAB 4HSCX 5DI8A 3BPOC 3B2MA 4ENED 4CGUB 3RTQB 3CC1A 1SMAA 5EOCJ 4WK4B 2AJ3A 2RFXB 5IB1A 5I6XC 2R0WL 1EO8H 1QZ1A 5J57B 4XO5A 2NSMA 3CCHB 3OAYH 3QCVH 2TRYA 5F72S 3FQXB 4Z7UB 2A4EA 1QPKA 4P2CG 2FCBA 1B4RA 2N7BA 2W94A 5I6MA 1ZLUH 4TLTA 3K1KC 2Q87A 1DEDA 5D1ZA 2FX7H 3T8XA 4WCYH 3P4MA 1TJXA 2BVTA 3V95A 1BQ5A 4BKSC 4BFRA 5ALBH 1FDLL 2F54B 4JHAH 4QCIB 3WI9A 5KYUA 3BUQA 4XPFH 4HWUA 4MQXD 1PZBA 3DTUB 1JVLA 1NCWH 1RUQH 3MRQA 3QZMA 3CFTA 2ZXEB 4NQDE 5L0QB 4F58L 5DVOA 1IQWH 3QORA 2I60H 3VD1A 3BE1H 3QAZC 3FCSB 4KY1L 2BDNL 2BIMA 4D0DA 3VWKB 2HKHL 4HAFA 5GZOC 1RP9A 1JNHA 3CLWA 3V2AR 2YPKB 4PRHB 5D70H 4YO0B 5J0BA 3BDYH 2RA1A 3CSFA 5AAPA 1JRHH 3BKYL 3BVWA 4H26A 3D39E 3QVAA 3VXUD 1EBPA 2V8LA 4DQOL 2IQAA 5I6PA 4DERA 2F53D 2FWOA 4IEFB 2O93L 4M43H 4UT6L 1F86A 4IRZL 4NRZA 5DJZB 2XWCA 4XBEL 5I1JH 1U4EA 4LSVH 2LGNA 2EDHA 2FEEI 1CDHA 4PJBF 3BKML 3AMKA 2K1MA 5FW7A 4UWQB 4XN7A 2CBOA 5A1AA 4OKVA 5FXCH 3PQYA 1J9CT 3QE5A 4AQ1B 1MIEL 4MRBA 1LLAA 1X5KA 2NDGA 1AQHA 2W9LA 2R0LL 4QNPF 1S7RA 5DS1A 1V7ML 4Q74A 4D0BB 2VL5A 5TE6L 5JORA 3BUPA 1ND0B 2HN7A 3TYGH 4AW4A 1EX0A 4ELKA 1IEAA 4JRYA 1E4WH 1KELH 3ASOB 3NAAL 2DH2A 5I1EL 1KJVA 3DX6A 2BSED 2P8PA 4MJIE 1CE1H 4KQ4H 2R0KL 2GIXA 4TRPL 3RL1B 4LKXA 3LRGA 4BCZA 1TCRA 2EZ0D 1OVZA 2IAMB 4L0YA 4S0HA 2VRQA 1Q0XL 2EC8A 3UPRA 2X5PA 5DJ6A 5E2JA 3VFSA 2P8LA 3HG4A 2KHAA 2P9RA 4GBXD 4OFPA 3AROA 2DWSA 2P80A 3NIDE 5IHZA 3K6NA 1D6VL 2XN1A 3T1WA 5L6YH 4LCIH 2E86A 3CHQA 3JV0A 1ZTXE 4R4BB 4YSUA 3A4FA 1MAMH 1P4LB 4DK5A 4YHPA 5F8RC 4X6BA 1K6QH 4OJCA 2YUZA 4PRBB 2CGRH 4XMUA 5G55A 2FO4B 4ANVA 1D7FA 2YXVA 5CLWA 3IXAB 4GYBA 5CMAA 4JO3H 1OE1A 1FFTB 2WPGA 2JK5A 4WNJA 1QVOB 5CGTA 2A0LD 4B9GA 1S7VA 1NC4A 4UIKH 1GPOL 4WJ5A 2B0SL 4PYHA 4JY5H 1G9MH 2O6FA 4RMWA 2DEYX 1VERA 3ZRSA 4EUPG 3ESUF 2XN9D 4J3BA 4YSCA 3ZE1F 1LILA 4HJJL 1FO0L 4X9GA 2YUWA 3QEGH 3WUZA 2WXOA 2YZ8A 4P59L 4UCFA 3V7AG 5MP6L 5EBLA 2B15A 4UIMB 4NJAL 4GEIA 4S0TD 1JXDA 1FNFA 1JWUA 4Q9CA 3CE1A 4JUSA 1BHGA 4G80B 2H9GA 3D6GA 4JKNA 3LXUX 4IHBA 4OFDA 5HYQB 4JO8A 4KRPD 2EH8L 5JW3L 2CKBB 1KTDB 1OAZL 1GSMA 2ENJA 1V8HA 2QTVA 5AW8B 1KJ2A 5HHXL 4MS6A 2LLLA 2APBA 1YEFH 4OQTL 1UVQB 4U6VL 5ETUB 1XB3A 4EF3A 1W15A 3QS3A 5DEJA 2VDOB 1CLYH 3NRQA 5E8DL 3B6SB 4RAUA 1II4E 2R23A 1MHCA 4KI5C 4KJQD 4HWBL 5FGRA 2H2SC 3BN9C 4GQPH 3D4GA 2JCCE 4GO6B 4NUGH 3FS9A 1F1GA 4UM9A 2I9TB 1LE9B 3C8KB 5ADOL 2TAAA 3QSKB 3PWPA 4PJCE 3TBCA 3LNFA 3RFZA 2YLHA 2JLPA 2E6JA 3OHMB 2WN3A 2DY2A 3UOAB 1CE6A 1YDPA 4KV5F 4DFHA 2J4WH 1T7WA 2RQ8A 1KENL 5EC1B 3OKYA 5J13C 1HL9A 2BVYA 4PJ9A 2UZYA 4LKCA 2VQUA 5EUOF 3PHQB 4Y9EA 2BHUA 3FTZA 1SYSA 2EKJA 2BWDA 2XG4B 1NCOA 4RA3A 5DC0A 3WV0A 5TDNA 1JV5A 2WKGA 1G7IA 1XVSA 2XPZA 3QEHB 4NENA 3RG1C 3QHTC 2V7HA 4NM8L 1V10A 1HH6A 4J4PD 7CGTA 1ED3B 1P1ZA 4BH8B 1MAKA 5E5LA 4J4PC 4FEIA 3FQYA 4NRYB 3FCGA 4BRJA 2XZCL 2W9EL 1PTZA 2FBJH 4NKIL 3PWPB 1PFCA 4L29B 1MIEH 1WBYA 3H6JA 3QXDB 3CMOH 3LDBC 4Y88A 4W9LC 5LN4A 2A77L 3SE4A 4A6YL 4JJHA 4KHTH 4NI3A 1DEEA 3DBXA 2F58L 5HYSG 5IR1B 2HX7A 3P9WB 3RDTD 5EU5B 2ZP9A 1E4HA 4LZKA 1RUKH 4PJ9D 4EIZC 1HHKA 1ZA6B 4MJHA 1L7IL 2PTUA 3QO0A 2OM5A 3WGVB 1E4WL 5BW7C 1EEUA 5F9WB 2YD6A 1G1CA 1IGCL 1YPZE 2CG9X 4WI6A 1P9MA 5EEUA 4LSUH 3X2QB 2IBGA 1AS6A 1ORQA 2RH0A 4HIHB 4WI9A 1IE5A 1N0LA 1TMCB 2QPDB 2GT9B 3CX5J 3N5AA 4OZGA 2ESVB 3RURA 3FUIA 3KBPA 1GH7A 5F9JB 4YK4C 2NNAB 3CVCA 5C09B 4P3DA 3BCFA 5GGVH 2MWCA 3TL5A 1EERB 3MBWB 1VB9A 3EJYD 1PX3A 3ARDC 1FN4B 2B1HH 2FJFB 2IOOA 5I2IB 1MCRA 2R29A 2BOCB 1S7SB 5H2BB 1I1RA 1EAJA 5DFVC 5ELIA 4PCYA 3C6LB 3MRDA 5HHME 4I77H 3GIZH 4ADGA 3CN4A 3SDYL 1JP5A 4X80L 5KOMC 4DSYA 3MPCA 2UUDK 1FVEB 4P2QE 5E6IB 5K39A 2ILLA 4XOCA 2CO6A 1SEQL 3SDAC 3MRJA 4L5FL 2DAVA 1J9RA 2NY6B 4R4FH 5D7IA 3TZVD 2A4CA 2Q8AH 3AG1B 1M05B 3BVTA 1IFHL 4P59H 4RGMC 1X6LA 4P3DB 1BQLL 2JQAA 3RZCD 5HHMD 4AVKA 1E8ZA 2ZOLB 4E9QA 5IM7B 1RMFH 3NACL 4JFFA 2APXA 2DQTL 1MVYA 3EJCA 1TQCC 4KHXL 2JJSC 5B22A 3KW7A 2V5TA 2Y06H 3CU1A 3PJSA 2GSIB 2M1KA 4LHQB 3WNIA 4YQXL 4LPUA 5EOQH 5FV2A 3MNZA 4UQDA 3ARBC 4MJIB 5ESQB 5C0BE 4LVEA 3Q43A 1YA5A 4OGZA 3O0RL 4BSWA 3MRKA 5HI4C 2P5WE 1DBMH 1O6SA 1OL0A 4JPKH 1ZAGA 4JHWH 4M1GH 3LZOA 3Q3GA 1DJSA 2LOEA 1RZFL 5F7UA 1U8JA 3OJMB 2GAZA 2QVMA 1XXDC 2KL6A 1L9MA 4Q9RL 5C9JA 4FYQA 4TSAL 2JKIS 3GM0A 4ATTA 5EEYA 1DVSA 2H8PA 4RFNB 4Y5VB 1XGPA 3FL7A 3HLAA 2WUCH 3BVDB 1VA9A 3N2JA 3QIUB 4LLWB 1VADB 1UFGA 2BSSB 1QKZH 2X09A 4WWNA 4AENA 4U1IA 3BH8A 3O4OB 3AXIA 2HT4D 3KCPA 1IFRA 4P4RA 4TKWA 5T1KD 2F1EA 2CALA 2UY7A 3BJLA 4D3CH 5CHNA 3U83A 3VD5A 1OTUC 1RUQL 1XAKA 4BJLA 1IL1B 2A9DA 2D8KA 3EYUL 3QUXB 5FKPA 3OKMB 5DR5L 3DMMA 3QUMH 4UNVA 2I60L 3IXAA 2DI8A 4U4IA 4PSRA 2ZX8A 2ZWLT 1KIPA 2NYYD 2HKHH 3VWJC 2LAGB 4K7FB 1XTMA 1D5XA 5EO0A 3IPEA 5HJ3A 4DQOH 2ZAIA 1X4ZA 3CH1B 1PIFA 5FGCE 1YEIL 4QD2E 1NIDA 1SM3H 1U95A 3E9UA 5KAQF 3HE6D 1RUPH 4LCYA 1XSOA 4G9DB 5I5RA 1CURA 3ABGA 3FUEA 3L95B 4DP8X 4H25A 4WO4C 1T0MA 3VTTA 4J6RH 3BFOA 4LSQH 5EZPA 4AUYA 4D9QD 1G7PB 1NCNA 2GBVA 2KZBA 5DJ8A 5CS7A 1KXVC 3BQUC 1WFTA 4OGAC 2OTUB 3QZOA 4GW4B 5KYXA 1K3ZA 4EUPA 4B9CA 4G1MA 4GKNB 3MV9B 4H2AA 1V7MH 4HUMB 3WN5A 1T2JA 4Y89A 3NK3A 4DIXA 2B08A 1DDHB 3MAWA 5BQ7B 4BQBA 1H6EA 4ZAKB 5AVRB 4FFZA 1OK8A 2HLAA 4JFED 1IV8A 4XI5C 2R23B 1CE1L 3SJVD 4PJBA 2Y7QB 4GBXC 2GIYA 5DUML 4AOFA 1L0YA 1VACA 4AJVA 2B1HL 1J0IA 4NQCB 1EEYB 1HC1A 3UADA 1I3UA 1YN6A 3ZQWA 1URZA 3TO2B 2E6QA 2OK0H 2QSQA 1YQ2A 1G6RB 5EBMB 1UWXH 2EKSA 3QUYD 3ZT6A 2PPCA 4PLKC 1D6VH 2OMWA 3SDYH 3QEUA 3HMXA 4KJPD 3CX2A 2PWDA 4N8CL 4NNXA 3VXSA 1B88A 1NFIB 4M5YL 3WKPA 3FBQA 5JPMC 3TIDB 4PEEA 1ZS2A 3K6SA 1T4KB 4NQEB 1BSIA 3QIBC 4NUQA 2NT1A 7FABH 2Y5TB 4LLQA 2IFFH 1FL5A 2ODIA 3CDCA 3Q5OA 3OQRA 4PJHB 4WW2A 4YLCA 3DUUB 1LP9A 2BNRE 5KSAB 2WQAA 4L4TB 2ZKMX 5FB8A 2Q0ZX 4KAQL 2Q8AL 3POHA 5ICXA 5DQ9B 1P9MC 3QNXA 4JPVH 2AW2A 3E8UH 4YHMH 2IG2H 4PRIE 3RWEB 2C7FA 4P2RB 4J2XA 3G5XA 3QDHA 5BMFL 3WJJC 1ZTMA 4S1SH 3HB3C 1Z7JA 2Z4QA 3VG0H 2J88H 3I3BA 3C5ZC 3W1ZA 3IDGB 1FYTE 2BJMH 9CGTA 1K85A 1WBYB 4CADB 3N40F 2VDNH 4YHKH 3GSRA 1O75A 3CHPA 4LVNB 4FXKA 4GO8A 5DJYB 2QELA 1P4LA 4N2NA 2P5PA 5KOVC 2EH8H 5AL0A 2EDMA 1MLBA 5L2KA 1JG9A 2XKNA 4HS8L 2CCWA 3FRPB 5EEVA 1NM4A 3LKSB 4GKZB 4OFIA 5CILH 3GNMH 5CN2A 3S96A 3L6FB 2EE2A 3H42H 4A2EA 4H1LB 1HNFA 4AH2B 1EHKB 2YD7A 5ISZA 3OR6B 4DVRL 4AQ1C 4JHUA 3A22A 3IS1X 2WO3B 2ITCA 3IU3B 2CRMA 1ASQA 3S5ZA 2RFXA 5HI4D 4JHZA 1SFDA 1SLXA 3MRHA 4JAMB 2OKMA 3S3CB 2CXKA 3N1MC 4HWZA 2D7PA 1NCWL 3H9SA 1N26A 2NXYC 3L1EA 1DQIA 3LZLA 5KSAD 1VKXA 3ZGHA 5F9OL 1IQWL 1JGIA 3FCTA 4HC1A 2CPUA 4QRSB 4D0CA 4EQ2A 5H35A 5D72L 2YD4A 3ZRCC 1O9WA 4CADA 2P47B 4U1GC 3VFGL 1A7PL 3KVQA 4Z3FA 4BFIB 3RQ3A 4BGLA 3FYIB 1BLIA 5K59E 5L2KD 4JO4L 4P9HC 4AYMC 2I07B 1DZBA 1B3JA 1CGWA 5TQ2L 1DVFB 2DLFH 3CFMA 3NPSB 4NO5A 1TJIL 2C7UA 1M3JA 4LEOA 2OI9C 4NKDA 5KG9B 1MWAA 2W65A 2DMGA 3HG5A 1ZEAL 3GGWA 3H54A 3NFNB 3T0EC 4OZIB 4XBEH 5I1JL 5CAYB 4G5AA 1DCEA 2QQQA 2VLRB 5HDQL 2VLJA 4PS8A 3EJPA 1DQQB 1X5LA 2JKRM 2GTZA 3SDCA 4B9KC 4L4TE 4DN3H 4E41E 4IJ3C 5DC4B 2PXYC 2HFTA 3HS8A 3QDJD 3V9EA 4P05A 2JCCF 1IM9D 3N85L 1MH5A 5LXVA 2HPOA 2WIIA 1UKTA 5IJCC 2PNDA 5EBGA 1HDMA 2DWTA 4MXWH 1OPGH 1ORQB 4WTWA 1JRHI 4M3HA 5T3XL 5TE6H 2W9EH 1E27B 4R97C 1K8DA 3G5ZA 3EADA 4M5SA 4PJGF 2Y1VA 3QUKB 3TVMA 4L0PB 2M2DA 1NCTA 2PLTA 4TNEA 1LYQA 4A6YH 4AGPA 3PJNA 1Z5LB 2A77H 2CIKB 3L1OL 3ZDZE 4KQ4L 2EE9A 4LASL 1O6VA 1IZKA 1AY1H 4XHQA 2O61A 1GTNA 3APDA 2DIEA 5E1AB 2V6HA 2GQHA 2NQDA 2D0FA 2IOMA 5DJXA 1N6VA 2EVJA 3PV6A 1Q0XH 3AAZA 4HDIB 4Q6KA 4ECNA 2XHNA 4LLUA 3SQOL 5LDUA 2XG4A 2BFVL 3Q1SL 2QHLA 3GB7A 4KDWA 1AZVA 2AXHA 1BFTA 1G6RH 4JZOA 3MV8B 3QDJA 4P2AA 4XWGL 4ALAC 3DV4A 1P1ZB 1AANA 1WBXB 1YNTF 2G2RB 2OR8A 1AIFB 4G7SB 1ZHKB 1UVQA 5ETUA 3V0VB 5JHDB 1S7XA 2IALB 2K45A 3RA7H 4Z7AA 4PWJA 1JF1B 5TGBA 4X83A 1E3XA 1S7WA 1XF2A 3MLTA 4M56A 1NANH 3EH2A 4Y16D 4E9WA 5E4EB 3UJIL 4WO4B 3DO4A 2BWQA 1ZE3H 3EOAA 3QPXH 4NQTA 3OKMA 4N2MA 5IHZB 5FYKU 4NZ8A 2W0FA 1F4XL 2AEQL 3WD5H 3HRZB 4PV8A 3ZYZA 4PJHE 4LF3B 3RE0A 3FQUA 5IEKB 3ESNA 5DHVH 1HIML 5BCAA 1EANA 5IHLB 1WO2A 1D7DA 4ZXBC 2YA1A 4FNQA 4OIAA 4W6WB 2EDEA 2I5YH 2WNGA 4PAZA 5EO0B 1A22B 5MP6H 2R1WB 4FJ6A 3BWUF 3WIIH 4AXWA 4JMXA 4MXQD 4FXGA 4R4FL 5D1XD 2XG5B 4AM0Q 4PVMA 2H41A 1JZ5A 1ECYA 2R9HD 1ES0A 1JDAA 1G94A 4R84A 2ZXDA 1BOYA 1F45A 4Y8AA 4DKEL 3T71A 3JV5A 5DRXB 1AHWC 4K94C 4ZSOA 4R97B 2A6IA 1KB5B 5C9JB 3F84A 5JIQA 1CICC 2ZYSA 3C9NA 4LGSB 1XGPB 3C5SB 4GKSB 2H0EA 1P2CA 4ZSOE 3MOBL 5CEYB 2AXGB 4GKNA 4F1ZA 4IKNA 5LG6A 3ZBMA 3BAYA 3TPKA 1Q4NX 3HRZA 4P4KC 2YWZA 1CD1B 5I8EB 4QXWA 5CP3H 3L3HA 4EOWL 4UOZA 2D03L 4UV4L 2XNAA 4IU3B 4OM0L 4LL9A 1DBML 4JPKL 2A9BA 3QJUB 4G7QB 2EYRB 4AEEA 4PQXA 2HFFA 1IC5H 2LU3A 5CR8A 2AMUA 3WAKA 4JFWA 3FCSA 2AV1A 1FQ9C 1IBFA 4FXGB 3LZNA 5C0AD 3I84A 3V4VL 1CFBA 1K5WA 3NIGB 1I1AD 1EVUA 2DQHH 3IMUA 3NSXA 3HR6A 5JQHC 4TULH 4K7FA 2W81C 2RJMA 3KL0A 3O9WD 1DO6A 1H3PH 1C08B 3KM2A 3O3UN 1N0LB 1IKNA 4KROC 3S3JA 2VDMH 2GBTA 1XF4B 2K78A 3ARZA 4OUOA 4ZQKB 2XA8H 4J3VA 5IMOA 3RX9A 2OMNA 5GRVL 3FK3A 1IGIH 2CLRA 2V9QA 3O6FC 1ZEAH 3BH4A 4TUJA 5I8EA 3QUML 3LKQB 2B8OT 2EUVA 1NCHA 2E7BA 3P11H 2XTJE 2HT2C 4DN3L 5IFAL 1B6UA 1A6TB 5KJRL 2F9BT 4ZAKC 2WQSA 5LKNA 2G0LA 1WFJA 4MJ4A 3Q44A 3WN5B 1QPXA 1JBJA 1PZ3A 3IFOA 4PLNC 3MODH 3U9PH 4OU3A 1TTFA 1RUKL 4YDZA 2Z8RA 4KUCF 3KMDA 4UM8B 1QLRA 3MBED 4X99B 4CMMA 2R1XA 5HGHA 4LESA 1NOLA 2EXWC 4N25A 2I85A 4PLJD 3IFPA 1WISA 2PN5A 1G1YA 1KGXA 4JFYA 5FK9B 3VX1A 2L04A 1WGVA 3BWAB 3MFFB 4FJYA 1Q38A 1QSFD 2A6DB 2ICCA 4AH2A 1FAIL 4OZGE 3ZHDA 2HCZX 4FHBD 3BIAX 3RHWK 2GSIA 4PBDA 5GGVL 4PS7A 5LBVA 3UABA 3F7QA 2OTWA 1GAFL 2VZUA 4OJDH 3THML 3MLVH 1KG0B 4QHKI 5CJOL 15C8L 3MZTA 4N0UB 3B9DA 1E40A 1LWHA 1AC0A 4WFGE 5LXGL 3GIZL 2NTFA 1AZNA 3NJKA 1LO4H 1P7HL 4N2FA 3HAEG 4PJ5B 3KDMB 4NKMA 1PGRB 3LAFA 4G6KH 2XJLA 1DVYA 4NC2B 5F0MB 5C0FA 2OX5B 4AZ8B 4PUBH 4DAGH 2NNXA 3TASA 1OTSC 5DRZB 2MCPH 1U3HC 3SY0A 2AXFA 2VXTH 4FERA 2Z93A 4LB8A 4XP1H 3T3PE 4G82A 3IMWA 5M94B 5JOPD 3W9EA 3OL2A 4E9YA 4HX1A 1BVLA 4JFEA 4FQQB 4WHCA 4AVHA 4BZ2L 1BWMA 1RQ5A 2DQUL 3A6OA 4U1KB 1NC2D 1F4HA 2KQNA 3KPSB 3MJ8B 3BVUA 1YEDA 1JFQL 1YEHH 5LBGA 5EOTA 3SDDA 1A9EA 2O5YH 1ZLDA 4GQRA 4JKWA 4YQXH 5HYJE 1BZOA 3D18A 3NCJH 3IJ8A 5B1AB 1R3IL 4R5XA 4HCFA 4J23A 2VDLB 4LCWD 5DWUH 3VCLB 3O9WB 2BJML 1N5AA 1RZIB 3OKDA 3QRBA 2FWOB 4IEFA 2VDNL 1BJ8A 2DKSA 4NNXB 5DVPA 2EEXA 5DD1H 1OAKH 1ZDSA 4GG8A 1KJMA 2VQ1A 3DX9B 4BK4A 1VENA 1XGTA 1H3GA 1CI3M 4U1HB 5I76A 4KKBC 1UWYA 4HDIA 1E5CA 2Q7YB 3FSOA 1B90A 4KITB 3RGVC 1G87A 3CSBA 4HUUB 3H42L 1X9LA 5EZIH 2WW8A 3JWDH 2EDLA 5HGAA 4HOXA 4CVUA 1X7TA 3DVGA 4WWKB 4ZMAT 3KZ8A 4HIQA 4G7YL 3TA3A 3G5XB 3ZKXB 4B9PA 4EJ1C 3GINA 3RWIA 1AJ7H 1CXHA 2XWJB 1A6VH 1A14H 2VM3A 2EECA 1U8KA 4A2GA 2IDCA 3CSPA 4YBLB 3MMEB 2VDML 5A3IC 3GF8A 5I6LA 3LX9A 5F9OH 4XNAA 1QTYT 3BYYA 4FQXD 5CP7B 4E9TA 3MCKA 4B0MB 3II3A 1DLFL 3DX0A 2PO6B 4IGBC 1FNEB 1JGUH 4UNTA 5KEZA 2OJEA 4UNIA 1PEZA 2IADB 1T04A 3ZDZB 2ENQA 2BSRB 1UJ3C 3M7OA 3SCMB 1W72B 5KBKA 4B7LA 1FBIL 4M7LT 1FI8C 3FB5A 4POYA 1NCUA 4R8WH 2IH3A 3VXQB 3OKLB 4KKRA 4CC4A 1KBBA 4L4JA 1HXYB 1QSED 5JA8B 3WIHH 2HRGA 1F13A 5JUEL 1M1SA 1QHPA 1WZ1H 2YRZA 2MQ0A 2X6UA 2D3VA 3D34A 3FN3A 3UTSD 1D5XB 3L9YA 3WDIA 4ETQB 1KYAA 2IWEA 4JKKA 3B4NA 3WEXB 2O61B 5L4JA 4A39A 1FA4A 3SQBA 1OF0A 4FMVA 3S37H 1J8HD 3ARBA 1H3TA 2YPVA 1B4TA 1AO7A 1MCJA 1OGPA 4XCYB 1HKLL 3UYOD 2PTVA 3I9GL 3AXLA 3B7SA 5D9SB 1AOZA 2C9XA 4FQXA 4IOIB 3CH1A 1TFHA 4NWUL 5AVZB 2OSLA 5CKAA 3Q8BA 1KTJA 3INUL 1N68A 4UUJA 1MRCL 1H15B 5D1ZB 3SGEI 1I3RB 1HHHB 3EDEA 1AQKL 1I7ZA 2C1OA 3ZO9A 4JGUA 1B0WA 4Q6IC 5FHAH 4KJQC 4ZUVA 5IW6A 5AZ2H 2UY6A 4JM4H 3E6HA 3L08A 4MMXC 4G6FB 2VLRA 1S7TA 5F7KC 4S2SB 3CVIL 4WV1B 1F11B 2GI7A 2OFQA 4B5EA 1BIHA 3SQOH 1T89A 4H2CA 5I75C 5F7HA 3HAEH 3Q1SH 4G8GA 3SYPA 3WFDL 1LD9B 1G6RL 1OANA 3EYVB 4JN1L 5EUOA 2XV3A 1QR1A 4TQEL 2OLDA 1OGAE 2F2HA 4DK3A 3QEQD 5J13B 5JDSB 3WUWA 4TPRL 1WZLA 2ORBL 1S5IH 4Q4IA 3O4LD 3I3EA 4UILL 4YMPA 1H8NA 2WYZA 4L37A 4UMSA 3SZKC 3ZDWA 1PAZA 1JL8A 4Y4HB 4JFVA 2AEIT 5AVWB 3HRPA 3ARXA 1EJ8A 3T3PF 2HFEB 4ICWA 1JNNL 1JOIA 3DRQA 2FL5A 5EB9A 2E6PA 1FNHA 4GRMA 5F89B 3TBSA 4ZUVB 4BE6A 4N4YB 3KYNA 4WGKA 5KVGL 4HKJA 2AEQH 3WD5L 4ZAKD 4HIPA 2VLRD 3ZDXF 3EFDH 4HETA 1H3VA 4ICXA 4NBZB 1OW0C 4U6XA 5CN3A 3QZBA 4L8CB 3EH3B 3OXRB 3NUKA 3SOTA 4MHHI 3NH7L 3HR5A 2GUYA 4JL2A 5JMOC 4AMXA 2X1OA 3BP4B 1A6WL 2B16A 4J3WA 1WBXA 4OLYL 2NPLX 4FL4C 4UDUA 5F6IC 1Z9LA 4CJ1A 5DEFA 3DVNA 3UTQA 2WAQA 4W68A 4NHCH 4XX1E 4F7TB 4RFEB 5MI0C 4QRUA 4XRCA 3F6IA 1UD6A 3QXWA 1U30A 1PJ9A 3KYMB 1L3NA 5KWYC 5DQDH 1JHLL 3FO0H 1U8NA 3S4SB 2XTLA 2BNQB 4NZUL 5FYLE 2WB1A 3IKKA 4KKPA 4JEGB 4BH8A 4F15B 1PD0A 1HX0A 1MLBB 3O6KH 4XCEB 4Z0BL 4PJDE 1AI1H 1ZT1A 4Y5VC 4JMNA 4H5SB 4Y4FD 3T0XA 3P69A 4X9HA 2ZYHA 4JFOA 5D7JC 1QMUA 4X2UA 1E27A 4JFFD 1XL6A 1DQJB 4U6XB 1V3MA 3VGHA 4UV4H 1IL1A 2KS0A 1XR8A 3HZKA 1GY2A 1M53A 4DGIH 2HVBA 1SBSH 5C0JB 5D1XA 5IJKA 2WUBL 2GIMA 2WINB 2WWMC 1BPVA 4WEEA 4HT1H 2WOYA 1RAMA 2BNRB 4U3SB 2IDSA 4F58H 2NNFA 1MLCA 2UWEE 3BPOB 4MMYA 1AR2A 1AZRA 2D3JA 3DJZA 4LNRA 1EUTA 3BE1L 1NBYA 1DLFH 3QIUD 1ZVSB 2ATKA 1RZQA 3OX8B 4G6AC 5SWZE 2GT9A 2XWTB 3MACH 4M61A 2ENPA 3V5KA 5DD5L 4A04A 1QRNB 1P69B 3FFCE 3UZEA 3JTTB 5DSCA 5GGRA 2DLGA 1QNZH 3GSVA 2N1TE 5IROD 3BKYH 1BAFH 4UQAA 3AACA 1NDTA 3GUTB 1CMOA 1S3RA 3FTUA 4HUWB 2FEEL 3EXLA 5DMKA 4IIQB 3I50L 1INQA 1SEBB 1AXSA 1I82A 3U48A 2F1BA 3CHRA 1W2KT 2HJLA 4I5BB 1K2DB 3FFCB 4KZ0A 4OLXL 4ZMTA 4YC2C 3EOAB 4HIEB 2OBGA 3JT2A 4JPSA 1L6ZA 1FFNB 5F7BA 4Q89A 4ZFZA 1AO7E 1S3KL 3S36H 4ZFGL 5AAWA 5IFAH 3ZTDC 3EGSB 4G43A 1T7YA 1W6LA 4IBTA 4R96B 5FGCB 3KJ6L 1LNUB 3N3EA 3W2DL 3JWNH 1FNGB 3Q8FA 4JN2A 3QUZD 5MEND 4DP6X 4RGNC 1A66A 1FZOB 5D6DA 1OWWA 4YXHH 1Q9LB 1SYVA 3A23A 4PJ7F 1JYWA 4HOZA 4AEHL 2N1KA 1AQKH 2G3NA 3K2UH 4ZMOA 1LE5B 1DZ0A 2ZG1A 4P9ML 4NQCA 1HDMB 2VQ1B 5T3ZD 3FT2A 3MO1A 1GYAA 4K3EH 4MD0B 4ZFOB 2WCPA 3I75B 4WNQA 4B9JA 4JPIA 4XWGH 3K4ZA 3PGCA 1SXNA 4XVOA 5FFGA 1JYNA 3EGXA 3ZHFA 4AKPA 3ZIMA 3ZE2F 1S2EA 1MJUH 4XBMA 2YSTA 4A7GA 2R2HB 1UUNA 5E6ID 4WTZA 4GAYB 4Z7NB 5DRZA 1XAUA 1TETH 2CQVA 4P4KD 1JTTA 2FATL 3VFMA 1OTTC 5T3ZH 3V5HA 4TPRH 4I0PC 1MAML 2B1OA 4UTAA 4I0PB 5CJOH 4UQEA 2ORBH 3PWJB 1FZOA 1BVLB 2CA3A 2NR6A 2XWXA 5FGBC 2JIXD 2D31B 5LXGH 4RVBA 5AEAA 3WYRA 3L7EA 1T7XA 5EIQA 5BVPL 8PAZA 1NICA 2JJVA 1UGKA 4W9CC 5FCUH 2N0MA 3W81A 2FJSA 1TVBB 4U7KA 3FSWA 2A1WH 4XZ4A 1J8KA 3GRBA 1F6AA 1FWXA 2Y36H 3BMVA 4OUUB 4YSTA 1CWVA 1LDPH 3QP3A 1BYNA 2IAMC 2ZWSA 2YOCA 1WT5C 2BW4A 2V2TB 4P4RB 3WFCH 3OPUA 4XP1L 2OR9L 1O6TA 3EYSH 3MRNA 5I16B 2OQJB 1I8KA 3FB8A 4IGBD 4NZRH 3LPOA 3RAJL 3V5DA 4U2YA 1HH9A 3QC6X 4LO9A 3DX4A 3CC5B 2YK1L 3MLWH 1A47A 5SX5H 3LKSA 3VI3F 1MJ8H 1J05B 2NY0C 3HUJB 5K93A 4NHCL 4RGNB 5GRJL 4GXUM 5E9DE 3NYKA 1OAZH 4GRLC 5GGSY 4RETB 1GW6A 5D4JA 4HULB 3MOBH 3FULA 2OXHB 5AB2A 2AGJL 4IRJB 4ZPTB 2XU9A 2J7LA 5CZRA 4BQ9A 3O2WL 2ZZUT 3DDFA 5DWUL 3RKDC 3CPUA 4ANUA 3IGKA 4Q2ZB 3D69B 3TH2T 1UD2A 4PJEB 1C1EH 3PDGA 1RIUH 3ZKNC 1YMHA 4N8VG 3BN3B 1RK1A 1TQWA 4Q97A 1DBKH 3IT8D 1JZIA 3NCYS 3MRGA 4POUB 4KO7A 4B96A 5KYWA 2DS4A 2N3JA 3QJHA 1W8EA 1OIOA 3D30A 4KY1H 4YHNA 3OHXA 4A2LA 2X9ZA 4NQSB 3TO4A 3UBXB 1TKWA 3CBJB 3JWDL 4QAWA 5FHBH 5ABDE 5D1QE 3AQDA 2NY2B 1RZ7H 1CGTA 3T0EE 4JDEB 3ZO0A 1BCIA 3EZJB 4M29A 3BP5A 3VX0A 3F7VB 5I71C 2DMCA 4KNQA 5C9KA 4XXWC 1G84A 4R0LC 4LCWA 1XL4A 4FKKA 1HHJA 1MCSA 1XSJA 5GS0C 4FRWA 2R4SL 4KXBA 2YEZA 3F5WA 3RVXD 3BEVB 1MQ8A 2YUXA 3FU8A 4Y5YA 1QG3A 4X5XA 1OHZA 3POCA 4LSSH 3T6ZA 4MAYC 1EEYA 5B3NA 3I50H 5LWYH 3FO9A 3BC9A 5IWLA 1CYGA 2OL3H 4X6CA 5HHOE 4HOWA 4XMWA 1FLTX 4F15C 3KJ4C 1YJDH 2LQRA 1NMCB 1OE2A 5IVXF 3UPAA 4RRPA 4X50A 2DQCH 2AEPL 3EHBC 4XPBL 3W2DH 5JUEH 4N2CA 3WXVH 4BDVA 4XP5L 4KHTL 1BM3H 1NMAL 2P4AB 3EJJX 4PN6A 5LO7A 1I1AB 2VDLL 3LN9A 5E8NB 2AJ3B 4N0CD 4KRPB 1INDL 2VUYA 1MCCA 5AOIA 5DUBB 3ZE0B 1TG8A 3D3VD 3MVSA 1E7UA 4IBYA 4P9MH 1QLRB 4MD4B 4YVNA 4HEME 3PWUB 1IU1A 3QUYC 2F19L 4NWUH 4PJFA 1H5BC 3FU5A 3LMJH 3F7YA 3BN9D 5AOJA 2EE6A 2YJLA 2B9AA 2Z4QB 2BHZA 2VLMD 4N8PA 5DZPA 4XXDA 3LH8A 3DPBA 2XQBH 4N2BA 3QIWD 3E3QC 2A6JA 4FG4A 5I1GH 2CLVA 4KMQA 4JRXB 4KK9D 3QGVA 4Z7OE 2DQDL 3TN0D 1E30A 1LO4L 1U8OB 3GKZA 1L9QA 3JBG7 2W0FB 4HMDA 5T1DH 4ZD3L 3SPGA 3T4AB 3UEZA 3LKRB 5HYEA 2Y9RT 5C3IA 3DMMB 2DJUA 2BNRA 1ZHNB 4U3SA 2FHCA 4I77L 1IGYB 3WLWD 4BEIA 3U0TB 3KXFE 3QZWG 1R3HB 1NCBL 3L4WA 1A6PA 2J8UA 3WEAA 5GGUA 5FYKE 3RNKB 3EHBD 2X1QA 4OFVA 4S1DC 3PNRB 2BVEA 2ZUXA 2WM0A 4ELDA 4A63A 2Q9OA 2VISA 1NBZA 3APFA 2FLBT 1FVCB 2IAMD 3S34L 5C08A 5DRXA 4AKQA 2ZWNA 2OR9H 3QZWB 2GABA 3CUPA 4TVSa 1U8HB 1NEZB 1OF2A 3GQFA 3L3JA 3RBSA 1DVUA 4UAOB 5JNYA 5G5DA 1HKFA 3H7LA 1A1OA 2X4SB 4NBXB 5TE4H 3VI3E 3NP3A 1W72A 1ZXQA 2EE3A 2VDPL 4GRLA 1S5HA 4FULA 4M6OL 4F7EB 4N2GA 2MFNA 4EI6B 1P4BL 4LDCA 5ACZB 2EDBA 3CX5K 3VXOA 3V79C 1UCBL 2VLJB 3O4LA 1RIHH 3QULA 1PIGA 4LNVA 4P5MB 4MYWB 3OKNB 1FL6A 4KTDH 1G7QB 2ATPA 3QDGB 1KCKA 5AW1B 3CVBA 4NUGL 3D18B 1MH5B 2IAMA 3WOVA 1RZGB 2EAEA 5IVXE 1CU4L 3MUGA 1CC3A 4P06A 3WFEL 5D7JD 5C6TL 5J6HB 3HHRB 4KU1A 3FZUD 1A3RL 4DP1X 3QJFB 4Z0BH 1CS6A 2GW5A 2X4PB 4F5CA 2FEDC 3IVKB 1R33A 4PRPE 3ZR5A 2VZVA 5E4OA 4FFYL 2M26A 4Z23A 1OGAD 1RV6X 2OCJA 1MWAL 2VR7A 5IGXL 2BY2A 5ITBL 2KKQA 1A6VL 1L6XA 1I75A 1A14L 2FO8A 4MB3A 4W1TA 1J48A 3ILPA 3FH8A 4JQVA 3T4YA 1KIRA 2L7JA 3KWVA 3DGDA 3DX8B 2JCWA 1NFDF 5GZNC 1S7UB 1HZKA 1R24B 1UD4A 5F88A 1HSBB 2B59A 2ICWB 5DJAB 2C3VB 3KVPA 1XSKA 5BO0D 1L5GB 4ZRGA 4J3OC 1CFQA 2FJHB 4W4OC 1LEKB 1MF2L 4RGNE 3VD7A 2XZCH 5LWYL 3K5SA 2UUDH 3KXFD 4IKKA 3GHEL 2OL3L 5ESAB 5C0AA 2VJ0A 4IDLA 5DC2A 4K5LA 4YSPA 2WANA 4B3EA 1BAFL 2EIJB 4ORGB 4ZX5A 2YEVB 3AY4C 1G7MB 4GRWB 1TTGA 1XF5A 5DMIH 4NNPL 3EOTH 3SCMA 4UU9B 2GUOA 4L4VE 5ID0B 2VT0A 1BM3L 1CR9L 1NMAH 2XX1A 5AL8A 5H94A 4WZ9A 4DGVH 4X4KA 4LSUL 5CGYD 2C3HA 1MRCH 3LNIA 4HMCA 4LHUA 5JPMB 2QR0A 3D39B 4YXLL 3KPQB 4F7KA 4PJFE 4PD4K 1T66D 3BPNC 3CWGA 2A73A 5FHAL 3BP7A 2BOLA 4X9BA 3BAWA 5AVTB 5CM1A 3U6RB 5GQBA 5I0XA 4LEXH 4X5WB 3JTTA 4N5EC 5AYTA 4DFIA 2QGDA 1DE4A 5MERB 1H15A 1KZYA 2YGNA 3IE4A 5C7XL 1I3RA 2F0CA 1WS8A 4NUJB 5F0LB 3DUSB 1N3NB 3MJ9L 2QFPA 4NRZB 1GR7A 1DQTA 5DJZA 4MJ5A 1F00I 2OSLB 3UG5A 3ULVC 1E5ZA 3Q6GL 4X80H 3REWA 4BD4A 1X5YA 3S3PA 4ODVH 1Q9WA 2AK4D 5AW4B 5CCGE 35C8L 5T1DL 5KVEH 5IFJA 1DQLH 1MSPA 1U8MA 3SO5A 4NQDD 1MJUL 5KYNA 2O5ZL 4DF9A 3V6BR 1TSHA 3Q5YA 4XMPH 5H37G 1A4JB 2GVYA 3RRQA 3CN0A 3QFJD 1TETL 3QUZA 3T65B 2BSDA 5E8PA 2E59A 3DX7A 5D1XC 5I9QC 4AKOA 3FDWA 3D85A 3OD3A 4QXTA 3GWJA 2XQ0A 2JKJA 2J1YA 1LJMA 5CZXD 4QO1A 2BVOA 5B38G 3BRFA 4YHYB 4O9HH 3F65A 3VACA 4NQCD 5JQ6L 1G7IB 1F58L 4XNUL 1GZHC 1LO2H 2BRRH 2F8OA 4YXKH 1VFAA 4R90L 1MXGA 4NJ9L 5F1IA 4XNZB 2AI0H 3MCLL 1BXVA 1UH3A 2XQYG 2OMBA 4H8HA 3SGDH 1ADQH 5GRUH 3EUDA 4RAVA 3R7RA 4KKAD 3P4LA 2MTPA 2DD8L 4WFHD 3IWVA 4S1SL 3FT1A 1KGCE 4TUUA 3I74A 4FE9A 4TUKL 3BT2H 5FFLA 1QBMH 3N91A 4WHTB 1UXWB 1AZBA 4M6OH 3IMBA 5HPOA 2IJ0C 3LKPB 2YGVA 2XRAH 3F7KA 4K0OA 4U1MB 4ZUUA 1GSKA 3CHSA 3UROR 3I6LE 3NK4A 3C60D 1AXSB 5AYUH 3L4XA 5DZ9A 5FDWA 4LLUB 2ZXBA 1J9QA 3OJVC 4Z7VB 3ZPDA 3NCMA 1ZLSH 1AOHA 4YFLF 4EKXA 1XZ0A 4PJDA 3CZFA 4KDTC 5LAPA 2VITB 3UG3A 1YY9C 1NC2A 2KYIA 2Z91B 5EU7C 5JIMA 3VD0A 1U8PA 2ESVA 1NDMA 1W0YT 4MWFB 3BZEA 5FKAA 3BD3A 5C0DA 4D3CL 1E5BA 1S7XB 2E7MA 2IALA 1SBSL 1C1EL 4L8DA 4JG0H 1BAWA 5FO9A 4BM7A 4FNRA 4QCIA 2BC4B 4E0RA 4TQIA 3DI2B 2QLYA 5LG1A 3WS6C 5CZVL 2EYTA 5ES4B 3QUXD 12E8H 1JGVH 5MEQB 5HHPA 1KEMH 3U0TA 3KNBA 1DQJA 1E42A 5GJSL 4GT7A 5ADPL 1W72L 1ZGLA 2OXHA 4AQ8C 3FONA 4IK7A 2QADB 1UWFA 2K9UA 2PW2B 4KH2A 1E5YA 2PMZA 3CHOA 2W9DH 1NBZB 1M7IB 2WD0A 4FTVA 3UC0H 3WDHA 3RZCC 3WY1A 4YGVA 1MFBL 3BSHA 5C08B 3SDXA 1R34A 4F37F 3GMRB 2PW1A 4J6RL 1YECH 4CNIA 5AD0B 3GMQA 2A9AA 5A6IA 3K8MA 1UM5H 3EOTL 2DMKA 3N85H 1WJ3A 4HKZB 2OMXB 4PBXA 3MLZH 3OKKA 5KS9B 4HK3N 5T5NF 1OPGL 4RISL 1D5BB 1QUNB 3GJFK 4CVXA 4KKZA 4XVTH 4U1JA 5C0GB 2Y25A 1CE6B 1WWCA 1NOFA 3VXRB 4MA8H 1J10A 3CXFA 4HFWA 2ITFA 3U9WA 2BMKB 4YXLH 4FQHA 3LRSB 3WHE1 4ZO6A 5EIVA 2Y7SA 4XBPA 2OMYA 3F7VA 4OIIH 2VIRB 3O4LB 2IBBA 1C5BL 5K9KA 3GRWH 1T1ZB 1NMCC 3NIFB 5GS1B 4B0MM 2JJSA 1WAPA 2P8MA 4R3SB 2AV1B 5EZJA 1D5RA 3ARWA 3BQVA 3RL1A 4AMKL 1AE6L 2OL3A 3EJRA 3P4OA 4KGLA 4OV5A 2J5LC 4CN1A 2FT7A 5I8OH 5H37A 1RUMH 1BVKB 5B8CB 3L4ZA 1JI2A 2Y24A 1IC7L 35C8H 5KVEL 4HP5A 2FLMA 2CDGB 2YUVA 4L37B 3UBXG 1F4WL 2BCKA 5LQBH 2EZ0C 3HS0B 3V7MA 5BUPA 1NAMB 2H32A 1JPTL 3GBMH 2XIIA 1JZFA 3QR1A 4EZMA 2L8AA 2VXUL 4ZFOA 2NY2D 2K7QA 3SDAA 3CPLB 3WL9A 5B1KA 4FQ2L 4MVBC 4QRPB 3UJIH 3P2DA 4XBPB 1LK2B 3LIZL 4OZHB 2QSCH 1CTNA 1X5FA 1WICA 1SJMA 4LLYB 2ICWA 4GIPD 2W95A 4YDLC 2UZIL 4YDLB 4B3VA 3AWEA 3MNMA 5D7IE 1F58H 2ENSA 2O6EA 3N0PB 5GRVK 4I89A 1HNYA 1I7RB 3R0NA 3D4YA 2YIHA 4NT6A 1HHIA 3WTXA 4G8GD 3KPNB 3B8YA 4RLDA 4AIZA 1OT1A 1DTUA 1UC6A 3MRMB 4GI6A 1OTSD 3QEQA 2H47C 4PRAB 2ZYRA 1SMDA 2OYMA 2VWEE 1I8AA 3KPMA 3G6JE 3CFCL 3MA7A 5KVDE 2ZCHL 4BHUA 3P9LB 4RSVA 4X4ZA 4ZXBD 3ZSTA 3QEQE 4HUVA 1MRFH 1Z0NA 3UTPE 3UTPD 5CILL 3QQDA 4XN2A 3U46B 4H44C 4BK5A 2AXJA 5IHBA 1CXFA 4JGMA 2IIJA 3FB5B 4UBDD 3NZ8A 3LY6A 1TVHA 2VDPH 4ZMPA 4XPAH 5KYUB 3SQRA 4L3AA 5GS1C 1DSFH 4APQB 1RIUL 1YLBB 2FIRT 5C0JA 4XHJD 3GSNA 2V7NA 4XZUB 2WLKA 2Q5BA 1SQMA 1DBKL 3IYLW 4JHAL </