1ECZA

Protease inhibitor ecotin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
142
structure length
142
Chain Sequence
b'AESVQPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTMMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECOTIN
publication title Crystal structure analyses of uncomplexed ecotin in two crystal forms: implications for its function and stability.
pubmed rcsb
source organism Escherichia coli
molecule tags Protease inhibitor
total genus 14
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03974 Ecotin Ecotin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.550 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1eczA00
1EZUA 1FI8C 1ECZA 1XX9C 4IW4C 2Y6TE 1SLUA 1IFGA 1XXDC 1EZSA 4NIYE 1ID5I 1XXFC 1AZZC 1SLWA 1N8OE 1P0SE 1SLVA 1SLXA 1ECYA
chains in the Genus database with same CATH superfamily
4PJCB 4AYFB 5DRWA 1NSNH 4R3SA 3FTUA 3OAYK 1J7VR 2V7NA 3GK8L 1H15A 4FQ1H 2B59A 2HX7A 2XG5B 3ABGA 3LYRA 4MA7H 3TXAA 3DX4A 3CDCA 5D7EA 3M7FB 4NUGH 1GY1A 3CXFA 1L4IA 3MREB 3VI3B 5KVDE 2NYYC 3CXDL 3KPTA 2DWEB 1QABA 4GS7B 4JM2D 1DZBA 4JM2F 5F72S 3LIZA 3UG4A 3T6VA 4W9EC 1M3IA 4FNQA 1JHLL 2Q8AL 2NY4C 1UFGA 2PW2A 3G5YB 5IW1B 5IMLB 3VWJA 2WXGA 3CXHJ 5F7BA 2PN5A 1XX9C 1X3DA 2N7BA 2RFXB 3EAKA 3SDDD 3S9DB 4U33A 3GSVA 2DQIH 4G6KL 5EBMB 3WNNA 4MNHB 5EBLB 4XAWH 1E30A 5EIVA 3POHA 3GLZA 3OG6B 5F7AA 4F2FA 5MERA 3A6CL 1EHNA 3T4AB 3NCYS 4CGUB 2OMUA 4ELKB 1FCGA 2EIJB 3OLDA 4XP6L 4LF3A 3I6KB 1L0XA 3VXPA 4CMMB 4AE0A 1AI1L 2C5DC 2E27L 2OFQA 3MRPA 4ZPVA 2E74C 4NSKB 4EO5A 5GZOA 3S3PA 3FUDA 5T33H 3PWPB 2JCCE 3N40P 1MFUA 4R2GC 4J8QA 3OR7B 3GHEH 1LO0L 3FAWA 3P73A 4P59L 1U2HA 4AQEB 2EDQA 4LLWA 4YX2H 3WY4A 1BF2A 3PWUA 4FABH 1NAMA 4NT6A 1PJWA 4M8UA 1FL3A 1UXSA 4RFEA 4PV9B 1A8JH 1K3IA 3FB6A 3O2VL 5DHMC 4LGPB 2K6WA 2FK9A 4LCIH 3GJFA 5B1KA 4ABVA 3RB7A 5TDPB 1RKRA 4B3EA 3PS6A 1NCHA 2C3GA 1DBKH 1NGPH 5GRWA 2G30A 2W65B 3H0TA 4N20A 3X2QB 2GSMB 4PJEB 5F0MB 3JTTB 3QJZA 2VDRH 1AO7D 2ADIA 2CGRH 4ELMF 2XA8L 2Z31C 2QTEA 5DHVA 1AGCB 1N2RA 4OFKA 4MCNA 4Q0XL 4YHOH 3OPUA 3F2LA 3DVIA 3CFJA 1KEMH 2ED7A 3Q3GB 5KYWA 2YO3A 1MNUL 2L0DA 3N41F 1RZFL 1FAKT 2J1ZA 4PJ6A 3TVMB 3KLSA 4P5MB 1DQVA 1QYGL 5BS0B 1F13A 3Q05A 3CVHL 4IKKA 4JRFA 3KPPA 4KJQD 3U1QA 4BK5C 5JIDA 3ULUH 1P5UA 3FN9A 2DDQL 5K93A 2I07A 4MXWL 4JQVC 1HL9A 2G5RA 1GY2A 3WNJA 5ITFA 1BAFL 1C12B 2FEDC 3SDYL 4G8EB 3MRMA 4Y5VB 4YDKH 4HK3N 4IKJA 1C16B 4HGKC 3REVA 2CDEB 2VLKA 2YFNA 4ISVB 3EDJA 3Q8CA 3QUXB 2CKBA 1T1ZB 3P40A 4S0SD 5DJ6A 1D7DA 1DBMH 1QTSA 1XXFC 1Z7JA 3INOA 2A4EA 5E6IA 3T0AA 3TPUB 3WIHL 2YOCA 3VW3H 4ABUA 5ESAA 3KPRD 4QWWC 3BP7B 3KPMB 4H44C 4PS4L 4HP5A 5L4FA 4CVUA 3IJEA 4FQXA 2XWCA 4XVTH 5KW9L 4HGMA 1RMFL 4D9RD 2V8MA 3CFDA 3NQIA 5FYLH 5B4MD 2M1KA 4R4NC 1VFBA 1TFPA 4I18B 5DEFA 5C0CE 4AXWA 2YMXL 2YXVA 5FPIA 4JPVL 3H9ZA 2BY2A 2X6VA 5FFOA 3SZKC 1OLZA 2ODHA 2R0WL 3Q48A 1GGCL 2ARWA 4AUJA 3WU1A 3SBPA 3TIEB 4TOYL 1MREL 2AJUL 4J23A 1A7NH 3OKKA 4YGVB 2R0KH 2A6DA 4NI3A 2A83B 4MAUH 1XVSA 1XT5A 1XZ0B 1ZT4A 5F8RC 4N6RA 1FH5H 1FQ9C 4MSWA 1OW0C 4HIJB 2FJSA 4P2RB 1I7UA 2JB6B 1QBLL 5BUAA 3OWRA 7CGTA 1O6SA 1P6WA 4GAYB 4NZUH 4LQFL 1HH9A 3BRFA 1F4XL 5GGVY 3A4FA 1BXUA 3O6KL 4QXTA 3MBXH 4PYGA 1R5IB 4QRPB 5ERWA 1DQIA 1NUNB 1CE1H 4WV1B 2FQDA 4XN8A 3WHXB 4BFEA 1A7OL 2HT3D 5HGBA 3VRIA 3GSUB 1U8JA 2LFGA 2VQ4A 4PJXE 3U4BL 1R34A 2CBMA 2JCCF 1RURH 3MJ6A 4RBPH 5DVPA 5B39B 1P7QB 4OZIB 1KLGA 1LO4L 3CFMA 4BQCA 2CKNA 4WRLA 1R6VA 5BZDB 3O8XA 4YOKA 3WI9A 4X80L 5T1LB 4FEIA 2PXYB 3COOA 3WNKA 4D9LL 2B1OA 2XZCH 4S11A 2GIXA 2Y7OA 3US9A 4MQXC 5BPPA 3LZFL 1I9IL 2X89A 4I48B 4HEPG 3U82B 4ZZFA 3BSHA 4NWTH 4ICXA 1CD1B 3G5XA 1ILSA 3BT2H 5HHNB 1H0DA 4LSRH 3VD0A 1HIMH 2FX8L 4JO8A 3BH8B 5LHDA 1FV1B 1BVKA 2JKTM 2EXYC 3QFJD 4Z9KB 5E8NA 3UC0L 4D8PA 5DURB 3OJVC 1HTYA 2VC2B 2GB2A 4GG6F 4AQ1C 4MD5A 3F7RA 5ESVB 4O2FA 4B50A 4D0CA 2I60H 3KBFA 3KJ4C 4OKVB 1A47A 3H6JA 4NN5B 1L7IL 3K5RA 4XX5A 3P4NA 4XI5C 1T2XA 3TO2B 4CSSA 5CUSL 4QXVA 3QIWC 3AREA 1OOAA 2E7HA 1J05B 4ZO6A 2Z6FA 1T03H 2N56A 4UQ2A 3WIHA 3H3PL 5D2NB 4OIIH 2R29A 4B0MB 4O58H 4B7IA 3KVPA 3ZL4L 5J9PB 4HSCX 3RPBA 4AE1A 4DT2A 5HYJE 4YJZL 1FZKA 3MUY1 3PHAA 4B60A 3WKPA 1QVOB 3SDCA 3HPJB 2QGCA 3L3DB 4PJ9D 4L4TB 3CFBA 4ZMXA 3FCSB 1W2KT 4HEPA 1UXLA 4GKOA 4JRXA 3IDXL 4ZO8A 1OP3K 4IMKC 2MWCA 1G94A 1MDTA 1NGXA 3RVUD 1YMHB 1A0QH 1U95B 2BH0A 2XWBB 5D7JA 5C0CD 2X5PA 5D96B 1QACA 4QHUA 4E9LA 1TTRA 4AYMC 1DFXA 3U4EB 5GGTL 5MEPA 4NHUA 3DBXB 4Y9EA 1IGCH 1Z9SA 5GS0L 3BO8A 5B8CC 2ZCKH 4WU7A 3PJNA 1U8HB 4AVKA 1QEWB 3QORA 4JEGB 1YNLL 3HEIB 4I0PD 4AEIH 2UWEA 4RWYL 3W38A 1BJMA 2BW4A 3KGSA 2WP3O 4OD2B 3TNMB 1XF4A 2OR7A 4WI5A 3SE8H 4AUUA 3TBVA 7PAZA 2CBPA 1T2QL 3A6BL 1TTUA 3KE0A 2EABA 4CILA 4PG2C 2W81C 3KLHC 2ZOOA 1C8PA 3LQAL 3L6FB 3SHSA 2DIAA 4FLQA 2QPFA 2ZP9A 1JNHA 3CVCA 1E5CA 1NCTA 3BYYA 3MOBH 2PR4H 4NAMA 4DP6X 1PQZA 1SUJA 4PJXF 4AYGA 2PNDA 1T4KB 4YEEA 1MJ8L 2EC9T 1B4JH 5KAQG 3T8VA 1LO2L 3P54A 2X4OB 4ONGL 3LMJL 5GZOD 5C8JA 4J8RA 1WC7B 2IFGA 3MCKA 3DECA 5INDA 4N4YB 4Y1TA 1MCEA 2G9HB 3MZTA 2XBTA 2VERA 3I3BA 1F4YL 2UX6A 5I8OH 4L1HA 4OFIA 5D1XE 4PRPA 3NVQA 1UWEL 3HE7A 1JUFA 1TZGH 3CCHA 3ZX1A 4PTTB 4GRLC 3EJUA 2WBJC 4XNMA 4XHJD 4RRPG 5HDQH 2PR9A 1GKOA 1JN6B 4FF9A 1WD9A 4KKQA 4MNGB 3AB0B 5E1AB 1PLBA 3HOGA 4F8LA 1YEKH 3EDFA 1FZOB 3IDMA 4G8AC 1YVLA 4XP1H 4ONHB 1KULA 1B6DA 1KCVL 1SOQA 4N2AA 4OD3H 3MNWB 2UX7A 5KBKA 5BXFB 2EYRB 4HZLA 4QY8B 3VSQA 3CTTA 2QV4A 1KEGL 5IBLD 2K7PA 1JZ8A 4G5ZL 2WOBA 2QKIB 5DHYA 1GMEA 4XMTA 5IJBC 4AQAA 3K0WA 4LL9A 3C60A 4A2MA 1CFBA 3V10A 2ZYRA 2APWA 3VH8G 5IHZA 1U3HB 2FSDA 1RU9L 2GQHA 5MHSE 5K9QI 4NCDA 4NRZB 2JMRA 5I8KH 4KZDL 1I3RA 1JNNL 2AXGB 5L6YH 2XTJE 3HB3B 4FTVB 5IB3B 5HYJD 3ZDXE 1RIHH 4M5ZL 4RMTA 2XKUA 3D39A 4N8VG 4TSAH 2D31B 4Y4FA 5GGVL 1ACYL 2WQAA 4D8OA 5I15H 3U0PA 2F7RA 1P4BL 3WLBA 2K8MA 4KUCD 2XOTA 2BP3A 4KUCF 1DVXA 3HZVA 4JN1L 5E9DB 5KOMC 4QHKI 5E6ID 4ZUTA 5EIIB 5ABDE 2HG5A 2BSTB 4O2EA 4QTHB 1BIIA 3FO9A 1EAJA 1IC7H 5GGTA 2Y7SA 1VKXA 4RISL 4FQXD 3FAXA 4JM2B 4A7SA 1S3RA 3ARPA 3IDGB 4RRPA 3RA7L 3P3YA 4L8BB 4JG0H 5AZ2H 3PP3H 2EADA 3BWUC 4XBEH 1DQDL 1W8NA 5D1QB 5J3HD 3D12B 1K5WA 3WTTA 3PYCA 5JPNC 5IWLC 4YNYA 4EOWH 4KDTA 4C55A 4JPKL 5HY9A 2FEEI 2HRHA 4PRNB 4JKNA 1JK8B 4IKNA 3CHSA 4IRJA 3SDDB 3MLRL 4F9LA 2L04A 1E6JH 2VN7A 1JOIA 2PYEB 2HSIA 1TPXC 1TCRA 4UQIM 3KYMB 3NIDE 5LXGL 2ESVA 3GMOA 4XOEA 1GZPB 4KK6D 1VFOA 5GISH 5AW0B 3QHZH 1MJ7L 4NO3B 2PMZA 1WIUA 4JKWA 5EDXA 3BAJA 1I1AB 4XPTH 3VH8A 2XVLA 4R96B 3WEXA 4BFBD 1S7VB 3UTOA 1OAXL 1I9JL 4Y88A 4FNLH 5FGBA 5KVGL 1F4HA 2WMPA 5CKGA 3V0DA 4P3CL 1Q4NX 1JGDB 4JAMA 2AV1A 5CLZA 5HHMD 4N8VA 3NCXA 4Q74A 1H6FA 1D5BB 1UHVA 2QTVA 3UGEA 3FQ2A 3RYMA 2OZ4L 5F7DA 1NEPA 2DL2A 2P8LB 4W4OA 3BSZA 4WEEA 2ETWA 1AHWB 3AU0A 2X4SB 1TU2A 1AD9A 1ZOXA 3PV6A 2Y3AA 4X99B 3VFWA 2V2WB 2X2HA 5I16B 2HKHH 3O8XD 3KYNB 4X42A 2GK0A 4GS7C 1XTLA 2BERA 4H25A 4L8DA 4PJHA 4Y9GA 3JWNE 4AYBA 3MVSA 4NP4H 2ZF8A 5DMYA 4HIEA 5C9JA 4POUB 2X89D 1EEZA 4L9LC 4HAGA 3PU7A 3QISA 4MB1A 5GSVA 3GI8L 3U2IA 4E42A 5BV7B 5F97E 6FABH 1ECZA 2R1XB 1XZWA 1OAYL 1Y0LA 3ZSSA 1OCWH 4B9IA 2GITA 4CW1A 3HFMH 3N41B 1SXBA 3QE5A 2FWOA 4HXBH 1JRHI 1UH4A 5AW2B 3N91A 3GRBA 4ZUVB 3JYCA 4J1UB 2VW4A 3CSYB 4YSAA 3C5SA 2VZ3A 1TZIA 4BSJA 1NKRA 2EE6A 3KS0H 3WDJA 2J12B 2R69A 4S1QL 4JPIA 1ZTMA 3TNNB 2FATH 3VXMA 2DLIA 1M7XA 1ZD6A 4HS6A 4QXUL 1J0IA 1ED3A 3PF2A 3TJEL 4WFED 4P2OD 4XXDA 1S3KH 2BNRE 1OP9A 3K74B 2RH0A 4XMLL 3WKML 2W60A 3KPRB 3IDYC 4YZFE 4H1LB 4XMZA 3ZDXF 1YY8B 4UM9D 1PG7L 2IDCA 2CDFB 3ULSB 1FORL 1E28B 1SF5A 3BP6A 4XNZC 4PJ5A 2CM5A 3IYLW 1BQLH 4U6YA 4LSVH 1BF8A 4ZAKC 3D33A 2X09A 4QRTB 3GXUB 3JT2A 4KH9A 1QFUH 1KIPA 4HZ1A 3OXRA 3SDCD 4AM0Q 5HXMA 3L13A 4K23L 3OHXA 1RUPL 4HOWA 2R23B 1QHOA 3D5OF 2VH5L 3L8QA 4AZ8A 4JM0A 4XXWC 1DJXA 1V8HA 2QVIA 1KB5L 5KZCD 3IPFA 1QA9B 4UIKH 4JFEA 3UAEA 5I1JL 2E7DA 3UBXG 3F62A 1H8OA 1OGAE 2DTMH 5DWUL 4PRDA 1AQKL 3SQRA 2BSSB 3V6ZB 1TJGL 4WEBL 1P53A 1VZIA 4I13B 1FAIH 2AJ3A 5HHVH 3RWDA 3QXUA 5E4AA 5SX4I 3NIDF 4LSPH 2ADJA 3MRHB 4AG4H 5AOLA 4POZD 2YKKA 3B7UX 3O2DL 4Y5VC 4BM7A 1BG9A 1DEEB 2LAAA 3J8F7 3OKOB 4XP4L 5EU7E 5K1VA 1ONQA 3EFOB 3BKYL 3R18A 4M1DH 1ACZA 3QUXC 1TYRA 4N2BA 5I66B 4L3EE 1A8ZA 1H9VA 3JXAA 4UI2A 3FU0A 4R7DA 2VIRA 3VNYA 4AK2A 4AQ8A 1L9QA 4HOMA 2JCCB 4D0DB 4FFYL 4YO0A 1FJ1B 3LOWA 5DJ0B 4NQSB 5FYJE 4RAHA 3OC5A 2YUXA 1LK3L 2WGXA 4QIRA 3B37A 3RGVA 1RJYA 2SEBB 1PX4A 2HPOA 3OX8A 1P9MA 4NQXA 1F6FB 3G9VA 3L3KB 4PY8I 1A6TB 4AMWA 5F1IA 3L2LA 4JK0D 4I18C 5LO7A 2ENYA 3VSTA 5MP6L 4EUPG 1XQ4A 3EOTH 1FFPB 1BQHG 2Y06H 4JM4L 1FZJA 1BX2A 3H8NA 5EU4B 1UXWA 1JZIA 1KTCA 4X7SH 3WIIH 4HBCL 3CAFA 3UPRB 5AD0A 1KCKA 1DQMH 1I8UA 1IX2A 3UBHA 3K2UL 2A74B 5JPMB 4XAKE 2EDLA 1Y6KR 3UBXA 3M17B 1Q9OB 4WUUE 1MCQA 2A2QT 2GJPA 3ZO9A 3U25A 1B4TA 1XBDA 4JPWL 1T2JA 2HLEB 3FFCA 1N3NA 3HE7D 4QO1B 3D30A 3OGCA 3HIZA 3UAJA 4JQXA 2KQMA 3T8MA 1NKGA 4N86A 2V3FA 5TQ0H 3FZUC 1MCNA 2AZAA 3EBAA 4M8VA 4LLUA 1HE7A 1Z32X 4WV1C 5D9SB 1INDL 4XWGL 4R4BA 3K4AA 15C8H 4CMHB 5J57B 3AZUA 5TE7H 3OD3A 3MV7A 4RAUA 3FCGA 1PCSA 1WT5A 2BVOA 3US1A 2MQGA 2DM7A 4X6EA 4NZRH 1G6VK 5DJYA 1C1EL 5H35B 3Q5OA 4GKZB 5LQBH 2BDNL 4NQVB 1SFHA 4PP1C 3HR6A 2DWSA 4OFYD 4XTRD 3REWA 3TEZA 4YZFF 3VXME 4JO2L 5IOKA 3IKCB 4G43B 4OIAA 2ID5A 4LMQI 3RWHA 1MWAA 3W9EA 4EUPA 4NERA 5FUCC 2XN1A 1BQHA 2WW8A 4N0UA 4YDIH 3EGDB 3MN8A 3N55A 2N7SA 3LH2L 2ZXGA 3ISRA 4LSTL 4JO1H 2EIZB 5C0CB 1ZLSH 1Z3GL 1H3TA 1BM7A 4YXHH 1JMZA 1SOSA 3NDZE 5DZOA 5E99H 5HDRA 4X8GA 4DGWC 4LEXL 4QHLA 1XGPA 2V7NB 4CN6A 2XLLA 4C4BA 2B59B 3G7TA 1EJ8A 1BJ1H 4I77H 4HCGA 5F6IC 3QNYA 4P46C 3OM3B 1Q1PA 3HHSA 1MG3C 4GW4B 3MRGA 5JQ6H 5F9DC 3E38A 1WZ1H 4BH7A 1Q8MA 3QEHA 2WINB 1OGAD 4I0PB 4NNYA 5LAXB 4LLYB 4OQ1A 3Q7JA 3RGBA 1DVUA 4Y4HD 5GSRB 1OQXA 4W9DC 3MLSL 3IRZA 1NMCB 4LAQL 4KKNA 1C5CL 1DDTA 1MJUH 1DBAH 1N10A 1SXZA 2CLRB 1X5JA 2I7OA 3GRWA 3MRJA 3HPLB 4JFEE 4KUZL 1ZGLM 4XVSH 2JQMA 3FQRB 1ZIBA 2G60L 4ONFL 2WV3A 4KKZA 4IRJD 5FM5M 3OR6A 4HCFA 3RL1A 1OAKL 1OL0A 5CBAA 2FJFA 1XXDC 4NRXB 5D2NC 1MI5A 1XTMA 2DI7A 4FFYA 4U1SA 1KG0A 3AADB 4GO8A 4L3ED 5IMOA 3RWEB 1G7JA 3FB8B 3PNRB 5CS7A 1U93A 3CUPB 4PJXB 3W82A 1Y07A 2ZJSL 1XH1A 3BN9D 2HT4C 1FL6A 3MJGX 2DI8A 1OAUL 2IMMA 1GYVA 3VXPB 2XXGA 5IQ7H 2YD4A 2C7UB 2ZONA 4FQHB 5TE4H 1E8WA 3HC4L 1N59B 3I9PA 3DX8B 3ULVE 4XR8C 3NTCH 1DUYB 1RV6X 4OF5A 4HAFA 1HEHC 3KYOA 5AZEL 4D3CH 5KVEH 5D96C 4WIQA 2BNQA 2YAEA 4WW2A 2WXFA 2XXCB 3V0FA 3RU8H 4QAMB 4JPQA 3TA3D 1BVZA 3MRCB 4PWKA 4A6YB 1UOWA 1RUQH 25C8H 4YS4A 1Q0EA 4L37A 1FGNH 5FCSH 3LZLA 4XAKD 2GEQA 1FVDB 2WCGA 3K46A 3EW3B 2W07B 4HC1H 4EN3D 5HDLA 1S5HB 3RDJA 3CFIC 2CUIA 3D85D 2O26U 1F8TH 4LPXA 2PTTB 3LRGA 2XWJA 1SDAB 2YGQA 2ARJQ 1AMXA 1NA8A 1N6QL 3BDBA 3MBWB 1JD9A 4QMEA 5EO9B 5DQDH 1CZ8H 1YQVL 4XO3A 1JNJA 2NCMA 3NAAH 4LFHG 1KBBA 1T3FA 1W8EA 3FOMB 4PY8J 1ZWIA 5IK3A 3RFRA 1VENA 4G71B 2IF7A 5IFJB 2FUQA 4N8UA 3ZMNA 4RESB 1JYWA 3VDBA 3X11A 3QHFH 1IQDB 1QWUA 2VO8A 4MMXA 5GZND 1Q1JL 1BREA 4G8IB 4E2OA 3QWQB 3WD5L 3DJRA 4XE5B 3S5LG 1P5UB 2I07B 3GB7A 3ZE2F 1TEGA 4K94L 4F8NA 5HYJB 2Q76A 3MRMB 3E6HA 3X17A 4LEOA 1UCTA 3OKLA 4OKDA 5D7KE 3VXMD 1ZHBB 5GJSH 4NFCA 4PLKC 1CK0L 2NMSA 2CKBB 4ZK8A 2J2ZB 4JMNA 4TQ8A 2HLFC 7FABH 4Z6AT 3Q1SH 4F2ME 3IBEA 1KBWA 5DQ9B 3SBWA 1JPEA 4GKNB 1SMOA 3QCUH 4BSWB 5AYUL 2OP4H 3VMPA 2ZQKA 2H7WA 1QSFE 3ARFA 1EEYB 2LU3A 4ES9A 5JIPA 5BO1L 4PJ5D 2H6PB 1ETZB 3WUWB 5M7QA 4Z8FH 1FO0B 4DKFH 3QYMA 1GGIH 1JIBA 2XQBL 1K8DB 4B41A 1VFBB 3LEYH 3AY4A 1DZ0A 5DEFB 3RUGE 1ZANL 1OP3H 4NM8L 4L23A 4Y5XA 3DX3A 3BPLB 1SDYA 2HRLA 4FZ8L 4OM0H 4ZSOA 5CZVL 5LGKA 3HG3A 2VOTA 1J5IA 5ID0A 3RTQC 1I8LA 12E8H 5DSCB 3T6WA 1BQUA 2OBGA 3V52H 3HI6H 2MEJB 5CU5A 5F2FA 3MNVB 4JFED 2UZXB 3I2CH 2QKIC 3PP4H 4IBTA 5A6LA 1J0YA 1FNFA 3B56A 2B3IA 2IDFA 2D7TH 4YHLL 3K91A 1DVFC 2GUOA 4DTGH 1U3HC 5D5MA 3SE6A 1O6SB 5C0EB 1G5AA 3CDGB 1HJBC 5C07A 1G1CA 1NEUA 1T21B 2BY1A 4QGTA 3S5LA 5DVOA 3L3IA 4A39A 4QXTB 3HB3C 1CB4A 1R3KA 1WYJA 3SO5A 5C0DB 1AOHA 1HL5A 2WOYA 2X1XR 4P57A 3TWYA 2NNFA 4JRLA 2BVPB 4K3JL 3JWDH 2ATPA 4PRHE 3IWVA 1KOAA 5IG7B 4FKEA 5E08L 1U8JB 3CZFB 4HLZG 3ULVD 2WZ6A 3ULVF 1E40A 4FG6D 2H0FA 4CVXB 2CA4A 1KLGB 5CHNB 1USQA 5I76A 2P5EE 3QDJA 2MOVA 3KYKH 3O8XB 5ESQB 2GC7C 1J0JA 2IALA 3RGVD 3VFNB 5D1XB 5IVXA 1T0OA 1CXFA 3U9PH 3WDHA 4D9QD 2QMJA 4M7JH 2EDMA 5D1QC 3WMSA 3STZA 5T3XD 3ZXAC 4N2NA 3NABL 5DJAB 3ROOB 2P8MB 2D9CA 5LBVA 3AMLA 4GLRI 1P7KB 2ENPA 2XPGA 3MLYH 1IM3A 1A1OA 3G5XB 4AGPA 3EOYG 1U8PB 4LIQH 3AXLB 3AY2A 3UX9B 3KVQA 4MMZB 1P84J 5IIEB 1H0DB 2PO6A 3BAEH 4YC2C 1JZ5A 2CLZA 3KWTA 2WUBL 4WHYG 3DJTA 4XCNB 5E2UH 2BWIA 4FX5A 5JW4N 1EX0A 5I17A 3MRDB 1N5YH 1GRWA 1EPFA 4OLUH 2D0FA 2ICEB 1I1AC 2JJUA 3FFCD 3QEGH 3UAJD 5IGXL 2CALA 4FHJA 4N3TA 4TRPH 4MD5B 3HVNA 4D0CB 3VM7A 3BWSA 4RZCA 5ITBL 2P5PA 1REIA 4HJGB 2CD0A 2DQMA 3G6AA 4P2OB 2FECL 4LSDA 4DUWA 1QWHA 3MYJA 4HLEA 3P4NB 4G9FA 4G1EB 2BNUA 3P2DA 4U6XB 1HWWA 1T1WA 2XTJB 3ZDXB 4LRIC 4NDMB 5FIEA 4UM9B 3MV7D 1GGUA 3WLWC 4UQ2B 5EC2B 3D25A 4JS7A 1XH3A 3B2MA 4L4VE 3HCVB 3ESMA 4M7ZB 1AHWC 1UKQA 3VGDA 3I9GL 3OZ9L 2A77L 3VRJB 3QVAA 4JQIH 3KEDA 1J9QA 3HG0A 1HESA 2Q86A 4Z76A 2WLMA 3TBYA 2QQQA 3PGDA 1J0HA 1QSFD 4ZMLA 1HXYA 4Y1AE 2ZYIA 4TN9A 5LVEA 1T20B 3DYOA 4I4WB 7PCYA 1I8IA 4IHOA 4JANA 3ZQWA 1CYWA 3E9TA 3MRRA 5DUPL 4Z7UE 1I1YB 3RUGF 3SPIA 4EJ1C 2H2PC 4BFJA 1WCBB 2GAZB 3CZJA 4KX8A 2DYSB 1I8MA 2F08A 3BVUA 2WZPA 4Q9QL 3BO8B 3FQTA 1IGJB 3F3HA 4WU7B 3NIDB 1E8ZA 4UT9H 1EHKB 3L4TA 3TFKC 2K7QA 4LLMB 3UJJL 3BXNB 1AQDB 4ZSOE 4RGND 2DH3A 4RMWA 5TE6L 4A7QA 3WHE1 5CEYB 3HS0A 3TBVB 2ENSA 4BIKA 1ZLWK 1MCJA 1UD8A 1T1XA 1X5GA 2HAZA 2Y1AA 4J3UA 1WG3A 4YFLF 5C0JA 4G82A 3TH2T 2QQLH 1DVZA 1RK1A 4ETQB 3VXQA 3S8WA 4LVEA 4UIMB 2VB5A 2NY1B 4WU5A 3GEWB 4YSEA 3TF4A 3WSQH 2QHRH 1YNTA 5IP4A 2XN9A 1MI5D 4MA8L 3MDJA 1HWGB 2ZWSA 5C0FB 1YPZE 3HG5A 4LSQH 2DD8H 2A6IB 1PQZB 2DM4A 1M71A 4GSXA 3TBBA 3MGOB 1TF4A 3WFHB 4U49A 2P5ED 3DSFL 2YC1A 4MS8D 3EYFA 3ZMRA 3CSBA 1MH5B 1DQQA 3NZ8A 2AEWA 2YLHA 3KWWB 5I1CH 3V0HA 1URIA 1GCYA 5EV7A 1A7RH 3H85A 1RZJL 4XCEB 3D3VA 3JVGA 5ACZA 4ZPTB 3NCJL 3VFRB 4HKXA 4KNQA 1KBKA 4KQ4H 3GZKA 2YAQA 4JY6A 3HE7B 1GIGH 1LYQA 1VJSA 5DS1A 1G1YA 1T5WB 1RIVH 5C6TL 5CD3B 2AC0A 2IQ9H 3S48A 1RL1A 5K5YA 3JUYA 3IAPA 4UDTA 3C6LD 1FE8L 4TUKH 1W6LA 4W4NA 4XC1L 3AQZA 3CN4A 4IBLT 1I75A 3I50H 4WCYL 5I5MA 4DVRH 3BH9A 3RILA 5E5RB 5D72H 3ZGIA 2YBGA 4JRYA 3TN0A 2NY3C 1CDUA 2OMVA 4KFMA 4QI3A 2BNRB 1MQ8A 5HVWA 4J3OG 2A0LC 1NBZB 4Y19A 1IVTA 4CC4A 5IZ7A 3QJFB 3RVXC 2IGFL 2QPUA 2C9XA 5DMIL 1L3WA 2VLLB 4L4VD 4YL4A 4NQCE 3KGTA 4G9FE 5C0RL 2ITFA 2BSRB 1EDHA 2AK1H 5AKSA 5EOCJ 2R2EA 1AMYA 4MJHA 4I5BB 4Y16B 1IIIA 3J27A 3VFOB 1Q9LA 3ETTA 4UOQA 4CKVX 4J3BA 4TUUA 4HXAL 5BCAA 3CSFA 4N1HB 1BYPA 5DVKA 5F1NA 2A74C 5JPMC 4WJG3 1T0MB 1FL5A 2KPNA 2IPUK 4WI4A 4L0YA 3RG1C 2OKMA 5JYMA 5EN3A 4TNGA 3T65B 1KSRA 5L4MA 4G1MB 1E4JA 2X4RB 2F61A 4KMTH 2B15A 3FSVA 3HZKB 2HFGH 4W81A 1E4XL 4Z7UF 1OP5K 1VKXB 2GW5A 1OGAB 3WTVA 3IMBA 1LO5B 1OTTD 4G59C 1UOKA 4NBYB 4Y4HB 5DDHB 5AAWA 3UO1L 1A6WL 2C3HA 2FYVA 1BEXA 3CLFL 3PWJA 3R06A 4TL5A 1U6AL 3K6DA 1E4KC 3ZTNH 4U6VH 3WKQA 4PCTA 3NJGA 2CUAA 1RSYA 2B39A 4LDLB 2PCFB 5DGRA 4CMHC 1UEYA 4N0FB 4YEFA 5FDWA 5EEUA 4IRJB 2R2CA 1ZEAL 1RUMH 1NOAA 3D8MA 4BK8A 4L3EB 1J5HA 4LFHD 1KXTB 5I9QB 3IDUA 2CR6A 4TVPE 5KANI 1JFQL 3GJFK 5AOKA 1M6OA 2NDGA 3GMOB 2BX5A 2VDOB 3BDYL 1ZVSB 4WO4A 3ZJAA 3NPSB 5F7HA 3G6JA 3UMNA 5HBBA 2K6ZA 4G11A 3TOPA 4OGXH 1S78C 3ATBA 3O3BA 1FIGL 5HHOA 3SCMB 2R1YB 5C07D 1JI2A 4HF5H 4WFHD 3QZOA 1RERA 1SMAA 3WG7B 1G9MH 1YPZF 4K7PY 2WMPB 3BZFA 4DGIL 1BYOA 3RVUC 2WJ7A 2Z7YA 4GJTB 4OGYH 4UF7C 4ZDHA 5E2VL 5J13B 4HUXB 5L0QC 3NDYE 5ENWA 1UACH 4PU2A 5AAMA 4JCLA 4MQSB 1D6EB 2WAHA 4PWJA 2J8UA 4RWHA 2VC2H 3KL5A 4WDIA 3TA3B 5TH2B 4PRAB 4CNIA 4UNVA 2EEFA 4P48A 6CGTA 4JFOB 3T4YA 5DR5H 5C92A 3GXNA 4LVHC 2IDSA 1EANA 4UNUA 3VFWB 3QDJD 1LJMA 4UNTA 5HI5C 4KTDH 4WUUB 4EN3B 5A7BA 3QNXA 1QUNA 2DLGA 1OGPA 2FLBT 3D85B 5E2WH 1HN1A 1JNLH 2ZAHA 4AYID 4F7PA 2CO4A 2QQKL 4J28A 3LZRA 1NMCC 4Q14A 4NGHH 4DETA 3H6AA 5FCUH 4PJDA 4F7CA 4IW4C 4OCSL 1FNLA 1NSNL 3DIFB 2EE2A 5E8DH 1VHPA 4BWTA 2OK0L 2B1HH 2PKDA 1XIWA 4ZMNA 1IM3D 2A9NH 4O02A 4MA7L 3S8GB 3K6OA 5EA0H 2ZKYA 4HG4K 3BZ5A 3NSJA 2HVBA 2PO6D 1EJFA 4GXFA 1F5WA 4MAZA 4LGRB 3D48R 1IGFH 3OKEB 4JW3A 4YUEL 3KWVA 4XNQB 3ARGC 3ELAT 3OKDA 2Y69B 4PR5B 2D2OA 3LHAA 4Q9RL 3U2SA 4YDJB 2Q10A 2OYKA 1E43A 3QWOA 4PBXA 3VXMB 1YYCA 4V2CB 4KKLC 3O45B 3SIKA 4HS6B 4LZKA 1G9HA 4FI6A 5KSAC 3V5DB 3FH7A 4NQCD 4G9FD 5KSUB 2DQIL 2NSMA 5D71L 2JJSA 1GH7A 3S3BB 2E6PA 3KCWA 2HT2C 1A4JA 5F1KC 3DGCR 3T8XA 4DGYL 3H53A 4MJ2A 1QLEB 1UFUA 1EFXB 3IMUA 2MNWA 3L3OA 2E7BA 3O9WB 4JVUA 1PJ9A 4MJJA 1A1MB 1N6VA 3S3JA 1H3GA 3FHQA 4YXLH 4XE0A 2VM9A 3RFZB 4NUPA 3Q5TA 3RIFF 4DO6A 1X7QA 3GHEL 3BGAA 2J1KA 1YMMA 1Q0YH 2NW3A 1EGJH 3W5NA 1ADQH 2FHCA 2YGPA 3FN3A 3NIFE 4XN5A 4FABL 4KX7A 4DEUA 1B2WH 3DJ9A 1GGTA 4PWHA 4G9DB 5GRJL 1HQ4A 3DYPA 4H8HA 4JFEB 4Y4KC 4EI5A 1DLHA 2OX5A 4LLDB 4XN7A 3N1MC 4LE8A 1M9WA 1WS8A 3HZMB 1KN4H 4PRDB 1JGIA 4ODUB 5J0BA 2JKWA 4WKXA 5T5FA 1DBKL 1K9TA 1SN2A 2WZPD 1KCUH 1B0IA 2NX5A 1NGPL 2QGDA 5KVFE 4MKTA 4AENB 4AKPA 1SQMA 4NPJA 3W2DH 1DQLL 1E9QA 4F33A 3FBKA 2MSPA 2ERJB 5D4HA 3HRZA 2CGRL 2Y6SC 2C9UA 2ISDA 4TV3A 4YHOL 5JMRA 5BUPA 4JFFE 5BQ7B 1KEML 2N4IA 1OPGH 1FN4A 2OL3A 3LHPH 2YOAA 1ZLUK 1E2ZA 3V9CA 3HNSH 4YO0B 5G5DA 1MLCA 2VDQB 1DQKA 3RWGB 4IYKA 2YD0A 3ARXA 3RI5F 4ZNEA 3EO1B 2UXGA 3RGVB 3HN5A 2XN9D 1V27A 4I85A 4F3FA 3MU3A 4NQXB 3PAZA 1N5AB 1Y1UA 2DQJH 3OPZH 4HW6A 4Y9FA 4YDKL 3PL6B 3SPVB 1OY3B 2ZCLH 5E6RB 3L5WA 2JI1A 1ZAGA 3MUJA 1GYUA 1CLOL 4QUOA 3O11B 2HTLC 4KJYB 4M3HA 4PW3A 3U9UB 5KJRL 3CDFA 1EZLA 2DQUH 4LCWA 3ZT7A 1UADC 3X12A 3CLEL 2J21A 1R5WA 1P7BA 5FECA 3K2KA 4P4RA 2IXQB 3QNZB 3ZE0E 2Q6WB 4F20A 2PPCA 3L7FA 1TZHB 2VRKA 3T09A 4OFQA 3TC9A 4XVTL 2H4EA 4PTUB 3D3VD 1F6AB 3ZIYA 3DX6A 5FYLL 1EO5A 2XDHA 2H3NA 2XETA 2O5ZH 1AQHA 1S7QB 4BWWA 1C08A 2E47A 1A4CA 43CAB 1O0VA 5E2TH 4FQ2H 1PD1A 2OMXB 1VEOA 4TUJA 1MHEB 1KJMB 2CGZA 2WTOA 3ZHNA 2VSMB 3QA3A 1R3HA 1IJNA 1HHGB 1P4IL 1A2YA 1O9ZA 1Z66A 3W39B 4A66A 1A7NL 4R4FH 43C9B 3OJ2C 1M1XB 4MAUL 1G7QA 1JL8A 4PFEA 1UVQA 2Q8BH 3UDWC 1THCA 3UEZA 1FH5L 4NQEE 4Y1SA 4FXKA 4JRYD 5ALCH 1TDQA 4X6EB 1JV5A 4FTDA 3SKJH 5DJYB 2OTPA 3D87B 1F0LA 4NZUL 4QRRA 1EERB 4F2MB 4QD2E 1DO6A 3EKCA 4NOFA 5D1XC 3I6LE 2NSQA 1ORQB 4KOCA 1KFGA 5B1AB 2RCSH 3LNGA 1II4E 1QSFB 1I8KA 2YIHA 4Z0XB 4JDEB 3ARRA 3GUTB 3RUGB 4YHIA 1IAKB 4MMZC 3KDMB 4P5KB 1RURL 2I32A 4BA0A 2HUEA 3KR3H 4RMUA 4K7PL 3G5VA 5KG9B 3LKPA 1XGTB 4NO2A 5EZOH 3M46A 3NIFF 1VGEL 3EJJX 3S2CA 2OSXA 4AW4A 1YUHB 2C9VA 4ENED 2XZCL 2X0UA 8FABA 5CSZA 4MX7A 2IAMA 2ICEC 4X6CF 5E5UB 2FT6A 1RZ8B 4HEME 4KXZH 3L3HB 5E6UB 3Q6FB 5H94A 2DQDH 1GZQA 1N7MH 2CO3A 1DJWA 4K3DH 1D5ZB 5CCHE 2FB4H 3CZGA 3V9EA 2I9TA 3CIQA 3LS5H 2R1WB 1XR8B 2XTJC 2NPLX 3GD1C 4KO6A 5EPMB 1HIML 3P2TA 2GYSA 5DQJA 2GTZB 2FJFB 1RPUA 4E9VA 1JV2A 4PRHB 1KG0B 4U6HA 4JFFD 5B7MA 3X13A 2C1OB 3B2UC 2BOLA 1GW0A 1HZKA 4MCZA 4HFWB 4M4RA 4P2QE 2XNAB 2D73A 2I60L 4J3OD 4MLSA 3O3EA 2X6CA 5BV7H 3JV4B 2P5EB 2V2TB 3EJQA 2BSEA 3E8UL 1F18A 4JFSA 2VKWA 3H9SE 1UGKA 4PUBH 3EOBA 1JXDA 1CPUA 1ZDQA 1U8QA 1IGIH 2W88A 4ZX6A 5HGHA 1BFTA 1MRFH 2WXPA 4DP4X 3L95A 4S1SL 1CTNA 4MASA 5MI0B 3FONB 4RSVA 3WNMA 2XYBA 4M8RA 5TQ2H 3NRFA 5EUKA 2X7LB 1FFTB 4ZOEA 4UB0L 1QSZA 4NCC2 1AACA 5DZVA 3A4AA 3ZE0F 3L9RA 4ZJ9A 5T5NF 3GO1H 3CN1A 3W81A 2B4CH 4LCWE 3WJJC 2X70B 4POZC 3V6FA 5DYOA 3LKNB 4UINH 4GT7A 3VXNA 5JOFA 3C6LB 2YPKA 1FGVH 4QRUB 4WWPA 3VX1A 4J27A 4H1LH 1CQYA 5KYXA 4LLAA 1KCSL 2XWJB 2ADYA 2NY7H 1OLLA 5DF0A 3K2MC 3DURA 3VGGA 2XV6B 3QUMB 4ALAL 4H8WH 5L8JB 1MFAH 1T66C 4KK8C 2NY1C 3ATEA 3GC3A 5F89A 5BOJA 4LT7A 3BKMH 5IK3B 5DVLA 4KVPA 1QLRB 5DD3L 2P80A 4MMYA 5I8EB 1MF2H 3WHE0 2F19H 5KVDH 5DC2A 2QFPA 4LLQB 1GYWA 3Q13A 4LK4A 4AEIL 1F1GA 3QPQD 3N85H 1ODUA 2UY7B 3DTXA 3IGAA 2LU7A 4L4VB 4NQED 3OV6A 3EGXA 1MCRA 3SE8L 3UO8B 1OANA 3FRPG 4F5CA 4P07A 5KSBA 1OSZB 5JUEH 2Q76B 1X9LA 3OKLB 3L45A 1BA9A 3MR9B 4X6DA 3JWNC 1NL0H 2IOIA 2FIRT 2HCZX 1YJDC 4Y1AB 5DUBB 3GS7A 3ASNB 3FULA 4QGYA 5DZNA 4G8FB 1EIBA 1L9NA 5HTSA 1AS7A 4HS3B 3MOBL 2C4FU 2HJKB 2PR4L 4GXVH 1MW0A 4Z7UB 4AT6B 2CMRH 5FYKD 1WFJA 4M61A 4YQXH 2Z8SA 2DQEH 3MLWL 4UM8A 4YFLI 3IB4A 2GEEA 4PJFA 2JLLA 4FL4C 4H8QA 2XZQH 2CR0A 3PGCA 1WAPA 2QELA 3HG1A 2VDNB 1IILE 2Y2YA 3ZT6A 4HJ0D 2QT6A 2WGNB 3WNPA 4LKCA 5A6IA 3P3UA 4ZSOB 1BSIA 1PFOA 1DSWA 5E94B 5I8OL 2AV7A 3IJHA 4RGOL 4JGMA 3UTPE 2RD0A 2YXMA 1AZBA 1KTDB 1KJ2A 3GBML 1AXSA 4NNXB 4EI5D 5CILH 4XTRC 3QCTH 4KHTH 5I0YA 5HDQL 1MEXH 1Q72H 3RVTD 1CS6A 1NEZB 4U1JB 3T0BA 4BKLB 1R4XA 1U8IB 4L8CA 3FRPA 4Z3JA 1YPZB 1ZLWH 2AEOA 2ICWB 4XP1L 4BSVA 2A3TA 2AI0L 2FQGA 3D1MC 4Y16C 3S96A 1JZDC 1R3KB 2BHZA 4P2QD 5I1HH 3CSTA 4LOUC 4EBQL 1VGKB 3T04D 3ATAA 2HWZH 4R6UA 5CMAA 3R1GH 1LEGB 4HHWA 5IMKB 1CF1A 1NC4A 2BZCA 4EIGB 5B1BB 2BXZA 3H9SD 3QS3A 3VCLA 1AGEB 1GW6A 4M5SA 9PCYA 1KCLA 4GP4B 1NIEA 3EBGA 3SGJC 2X88A 3L9YA 4FNSA 3HI5H 2O93L 4NRYA 4I88A 3ROLA 2E56A 2WIMA 3FUKA 5L6YL 2FYYA 4YDVB 1RIHL 2H6UA 3AS2A 3ARBB 4MKMA 3S3SA 1A64A 4PJGA 1DJHA 4TSAL 1W0VB 5JIHA 2C9SA 4LCWD 1UQSA 3PAUA 1ZS2A 2COVD 5EB9A 2Y1VA 4O00A 4UTAH 3K2IA 3MRKA 3QCVH 5E8OB 5EU7C 3W57A 4NPKA 1IC7L 5CXPA 2J4WL 2PO6B 1HI6A 4EI0A 5I9QC 2YD1A 2D3LA 4FFVD 3W11C 4ANKA 5HYSB 1SDDA 4KI5E 1OT2A 5AW6B 4L8SB 3NPSC 3EJYC 2WQSA 5AZ2L 4XBEL 4OVVA 3S36H 4WW1A 1D5MB 3L17A 2C34A 3SCMC 4EOWL 3ZZ1A 2BIHA 3ARDB 3FFDB 4GRMA 2VDML 3TZVC 3P0YH 3A47A 4YAQB 4D0BA 1ZK5A 1BAWA 3TASA 4J3WA 3UGXA 2EEDA 4NQCB 1E6JL 3WGVB 3PHOB 4G9FB 2BNUB 3TWCH 1P69B 3GYRA 3EJZD 4GAGH 4IRZA 1IGMH 2P45B 1ZPUA 1SM3H 4JFPA 3QJRB 1LHZA 1NCBH 1HOCA 4G7YH 4L48A 3GSRA 2FZ3A 3LIZH 5BZZA 3SKMA 3CD4A 1V54B 4XPTL 2WSDA 4JG1L 1XF5A 2CIIB 1DCEA 2R9HC 2BHUA 2N1TE 4QRRD 2QQNH 2ZYHA 4AY0A 4JHVA 3IBOA 1F58H 3FT2A 3CBKB 5E7BA 1HXYB 3LZPA 1UD6A 4G7VH 4NKMA 3X1GA 2A73B 4ODTL 5HVGB 4KWUA 3L3GB 4FXLA 3MRBB 2GY5A 2YPVH 4KU1A 5IVZA 4HPHA 5JQHC 1SN5A 4PW4A 1WWWX 2DWXA 3V7AE 1RJLB 3GZPA 4XBGB 2DYPB 2GPZA 1AIFA 3QYNA 4Y2DD 2ICWI 2HKHL 3IDIA 4IOFD 4U0QB 2IH9A 4ZFFA 2CHZA 1I8MB 4LHUB 3IN0A 1VZHA 1YEIH 4TPRL 3PPSA 3FTGB 4JL1A 3CFEB 4NP4L 2IAMD 1ZKAA 2UZPA 2DWTA 1PD0A 1UA6H 1MFVA 1ZDSA 6FABL 3VDCA 3HS0B 5GRVL 1OCWL 1ZV9A 5GRUH 3HFML 4JFDE 4A6YH 3UPCA 5EO0B 1T1XB 4HXBL 2VO5A 1I7TB 4H7VA 3INUH 1L5GA 1PZ5B 1IQWH 1NGYA 1XCQA 1X5ZA 3IFOB 3QI9A 4JFYA 3MV9E 5AFAA 3KPSA 2V9QA 1SY6H 4NC2B 5F7EH 1LDSA 3GMLA 4ACTA 2IADA 4DP9X 4F92B 4LDEB 1G43A 2CIKA 1JTOA 2QJDA 2R7EA 3O9WC 2FATL 5F0LB 5JHMA 3FT9A 3QDMA 5JXAL 3SPJA 2GCYA 4YXKL 4WJ5B 4BWUA 1X9QA 3MBEA 3SGKA 2JJTC 3CJJA 3QG7L 4HGWB 4Z77B 1S3KL 1XSOA 2Z92B 3IFLH 2BSED 3LN4A 3MO1B 4A7GA 5D2LA 1KPRB 3FUMA 3HUJE 1JCKA 3RL2B 2W0LA 2X1WL 2VL5A 4M1CD 4OSUL 5HHQA 1XF3B 4Q89A 5JW3H 3GSXB 4JY5L 3PIQA 3VA2C 4C56A 4QT5B 5D1ZA 5ACZB 4HKXB 4GB9A 2HRPH 4LSVL 3BVNB 3W0WA 2WWNA 5A7EA 3OL2A 5ADPH 4L1SA 4D7PA 3D4YA 4KK5D 4PJ8B 4PJGE 2WXIA 2X2YA 3H9HA 2L7QA 4XNYH 4Z95H 2CKBH 1SHSA 3TEUA 4KI5D 2ERJC 4MS6A 2NY2B 4KI5F 5E70A 3MMEA 2E7LC 1KC5H 1UASA 1CFTB 3DBSA 3HLAB 1U8OA 1YNKL 4QOKA 4CN1A 1CXEA 1TQWA 2F9BT 1ZHLB 1SFDA 2XWXA 5SX5K 3ULVC 2DTML 5EOCL 1FO0H 3GLDA 5H2BA 1L9PA 1E65A 1V55B 5FK9A 3K6IA 4HWBH 4XXCC 3WTWA 3FB5A 4N2OA 3NT0A 5HHVL 3G04B 5K9KA 2HTKD 2O1AA 3GDCA 1X5MA 1M57B 4LSPL 4AG4L 3RLSA 2VCOA 3PL6C 4FEMA 4NEHB 1VERA 3ESPA 3ESNA 4M1DL 2DEWX 3P4MA 1XCTB 1NFAA 3CMOL 2XU9A 4DH2A 4LRNH 3LRLA 4KV5E 1N8ZA 2E6JA 1IKFL 2WP3T 2ZNXA 5F9AC 4EKJA 3BLPX 1P4LA 3HN3A 3TBTA 2CAKA 3MA7A 4PWFA 2O72A 4IMLA 4NS0A 3VFTA 1CDJA 1N26A 1C5DB 2J71A 1DTUA 3NIFB 3F6JA 4EXKA 3GWJA 2JTYA 3QARA 3V0WH 2PWHA 2I85A 3K8MA 3IDNA 5J11B 2C9AA 2Y06L 2FO8A 1HH6A 2EYTA 3EUDA 3HG2A 4GUPB 3S88H 3SY0B 4FFZL 5I73B 1A9EA 4NJ9L 2ZIDA 4X7SL 1CFSB 4PGBB 1QG3A 1R3LA 4B9GA 5I6KA 2YR3A 4KZEH 3BAWA 3HG1D 2W0FB 4GG8B 2W9LA 4PS3A 1CGYA 1DQML 2BRRH 4HUWA 3BWAB 1JPTH 3BQVA 1EZVY 1FCCA 3L1GA 1KCRH 1FSKB 4ORGA 1ZA3A 1JWSA 4FGMA 4HIIA 4ZW7A 5C6WH 3PHQA 1ESOA 1JYXA 4JFFB 3VG9B 3Q8AA 1WAEA 3AACA 1BWMA 4BCYA 1D5RA 2MPAH 2FAUA 2FR4A 4M6MH 3HJ0A 4LCUA 4YSUA 1T04B 5TQ0L 1DL7H 1XAUA 3SE3C 3FN0H 1NZRA 3O4OB 1X6LA 1JAEA 1LWRA 1XMWA 3GSWA 4NXKA 3CE1A 1QTYT 2ZUQB 15C8L 1G0YR 1CGSH 2OTUB 2PCYA 3AC0A 4KZCA 1EZUA 5CJBA 5EU5A 3WN5A 1JZFA 1NANI 5TE7L 1ZLUH 5IREA 5CN2A 1SHWA 5EF3A 3U6RA 1NCIA 5T1MB 3SGEH 4ZFOL 4N0YH 3E6FB 3POCA 4W9FC 1NC4D 3QG6A 3UGUA 4CSZA 1E4WH 1PKQA 1A66A 3HUJF 1IBGL 3ZE0B 2ITDA 3A4DA 4NJAH 3QWNA 4R97B 5IQ9A 3T4YB 2HJFA 1MHHA 4DNLA 2XZZA 2EIEA 2G5UA 2XJKA 2Z31A 3DUUA 2Q1EA 2RHEA 1UM6H 2RA1A 5IV2A 3IETA 2EVHA 5D2LE 3DDGA 2UZYA 4J6RH 2EO7A 5HGGS 4JO1L 5HHPB 1OAQH 3ETBF 4NOBA 4XPGH 4G6MH 1ZLSL 4YXHL 1PZ3A 1TMCB 5IOPB 3LS4H 5E99L 4PJGF 3E8VA 1O9WA 1UD5A 1MFMA 2DQGL 3FSOA 1ZT7B 4BK5A 4URTB 4JQVA 4QRFA 4KKRA 3ZHFA 2IG2H 2ZSVA 1N8OE 1KNOA 1YG9A 3GXFA 5SWSA 3WFCH 1RZIA 4LESA 3K72A 4NQEB 4K8RC 4G6AC 2ZWYA 5KVGE 2B16A 1MJUL 1DBAL 2E8ZA 3HS8A 5IFAH 1DQTA 1DYZA 4XVSL 3DMMC 2WD0A 4FZEL 3BHBB 2EC8A 3U7YH 4JDTH 4GUOA 2Z7UA 3ESUF 3QHTC 1J87A 1F56A 5MI0C 3ETSA 4KJWD 4WFGE 1SBSH 3K6NA 1TTFA 4KJPD 2EDOA 4BFIA 4GQZA 5TF1H 5HGDA 3V7MA 2VITA 1VACA 3PCYA 4WTXA 3OHMB 4L2YA 5TDNA 2ZSWB 4FNTA 4JHWH 4NO0A 3BVTA 4J7RA 4I0KA 3NEEA 3GSOA 5IEHB 1NJ9B 3C6LC 3QEUB 5E4IA 3N1GC 4ATTA 1T5XB 1SNRA 3NTCL 3LKOB 4A7TA 4BRJA 3PUUA 4L1LA 2VDLB 5FKPB 5KVEL 5E2JA 4LASH 4MWFB 4I8DA 1WHOA 2GJ6A 4HA1A 3BJLA 1OW0A 3RU8L 1HS6A 2GI7A 4U7KA 4IS6A 3QP3A 1RUQL 4LVOB 2X40A 4FYRA 3I6GB 1WICA 3RJQB 1FPTH 5ANHA 1UOVA 4HC1L 4L0PB 4H26B 1IAII 2BP0B 3RNQA 2FO1A 3QXDA 2DQTL 4G6JH 2AK4A 1U3ZA 3VFUA 2EZ0D 1F8TL 3JWNH 5IBUB 4EN2A 2OJ1A 1E9QB 2HH0H 3AFLA 4F33B 1U91A 1G9NL 5TTRA 3AGWA 3HRZB 4P2QB 4ENZA 5DT1H 2Z64C 1PZCA 3B3IA 5DQDL 1CZ8L 4QRSA 1D7FA 2G4GA 3NAAL 1BQRA 3IU4L 2AJSH 3MRQB 1BZDA 2F53E 3H9SB 3D69A 3VGFA 3RY5A 1PF3A 4OFDA 3LN9A 3BP5B 2IFFH 1HSAB 2WLJA 1ITCA 5EOTA 4JY4A 1AGDB 5ABAA 5G5DB 5F3BB 4BGLA 1AS8A 4ZUUA 2IBGA 2J6EA 4PH8A 1BPLB 3U0WH 4XCYB 2XY2A 3F7YB 3N1FC 4K4KA 3QI9D 5A2IH 3KPSD 4H88H 1B0WA 5JW5B 1OTTC 3BUIA 2ZAGA 1BXXA 1W0YT 5BVJA 2EDRA 5IB2B 1JPGB 3Q2WA 1LMKA 5DZAA 1U4FA 3L5WB 2C3XA 2HLAA 3QDMD 4HV8A 4QF1A 3KL3A 5GJSL 1HT6A 4YBHA 4BDVA 1AVAA 3GNMH 4X4XA 1WBYB 4KKAD 4LCWB 4M7LH 4APQD 7FABL 4NKOB 1R5WB 5FECB 4G2AA 2VJXA 5EUOA 2BS71 2AEPH 3QCUL 3T2NH 4XNBA 4C47A 4RMSA 3L7FB 3NJHA 1ANUA 2OP4L 5B7FA 1PZUB 4AQ1A 4N9OB 5IB5A 2AJVH 4L1BA 3BUYA 5D1ZD 1D2PA 1NBCA 1SN0A 3HC3L 3NFPB 3H2QA 5HJGA 4DKFL 5I5RA 1GGIL 3C09B 4AOFA 2EILB 5J89A 3LEYL 1HEJC 2GJZB 5A40E 1JGLH 3HS9A 5JLZA 3ZVVA 1QTPA 4QRBA 2GBUA 3AUWB 3O6FB 4HJJL 4OM0L 4FJZA 1CXLA 3NZHL 3QIWA 2IV9A 4X7EC 2PPDA 2Z4QA 5AKRA 1ZGLA 1RD6A 1GVIA 1M4KA 2YK1L 3CZUB 2FDBP 3PLYA 2EE9A 2Q7YA 1J11A 3PXLA 4GQPH 3V52L 4TSBH 3F12B 4QOKD 3WKYA 5IEKA 1C7TA 4DZBA 4HSQA 5HYFA 4RA3A 1EA9C 1JS4A 3I2CL 1G7QB 5SWSE 1UVQB 3DSNA 1L6PA 4FXKB 2D7TL 5E5MA 4UT7H 4RRPM 1JGEA 1ZY9A 2WK2A 1IM9A 4K5NA 4KKBC 4YHKH 2XUWA 4L9DA 5AYTA 5JORA 2JI2A 4XNXH 2P24B 4IMKA 4WI0B 5IB4B 2UXFA 4YHPA 3SO3B 3ARBC 2G5BA 3MOAH 2CJ3A 3FRUA 3OBAA 1PCXA 4Q2ZA 1WAAA 3U7AA 3B6SA 1RSFA 3NK4A 3JWDL 1F1DA 3RBSA 3ZMEA 5ES4B 4ZD3L 1CL7I 2IOOA 1CDHA 3OKNA 1HHJA 4OF7A 2Z91A 4TVSa 2WVSA 4JMXA 3BW9A 2L3BA 4NHCH 1T7WA 5B8CA 3J7HA 3S8FB 4K3GA 3II3A 1E8XA 3SB3A 4Y2DB 3VD1A 2FL5B 2NYYD 3MACH 1F2QA 2E6QA 4E9TA 3DHMA 4L8SC 1OD9A 3U9PL 1XSIA 2VR3A 5C0BE 3KLQA 5GRYA 4R90H 3CVHB 2NY4D 4PGCA 3PDOB 3ARDC 1ZVHA 2XV0A 3MLYL 1R47A 1N18A 5CJXC 3SGDI 5TJWK 2JKLA 4PG2A 4WSKA 5T1DL 4Z3TA 4XNDA 4LIQL 1GCFA 5AVYB 3DUSB 4AM0B 1FC2D 3MRLA 2I9TB 3BAEL 1QSEE 3CZSA 3U48A 4U1NA 4XRCA 1NM9A 1UA7A 3QC6X 1RP9A 4JFQB 5E2UL 4A67A 4XVUD 5GGSY 1J8RA 4ZMVA 3N9GH 1N5YL 3EZJB 1A3RH 1JFHA 4OLUL 4X6BA 1J9SA 2Y07L 3QEGL 3GZOA 4TRPL 3SJVA 4M4RB 3C9NA 1CCZA 3TEWA 3DK2A 2VXUH 2AS5M 2KT6A 5LDSA 3FO1B 4R2GD 1G7MA 1MFCH 1OM3H 3GRGA 5GS1B 1W0WA 2X2IA 3EOBB 3LKRA 3BAXA 3MJ7A 4OD1H 1U8QB 2B0SH 5HGHB 1LE9A 4HCRH 4NQDA 4JN2A 1PG7X 2GVYA 2WKGA 2WBJA 4WSJA 2PCPB 4HWZB 3GMQB 2Y0SA 1B9KA 8CGTA 1K2DB 4QTIH 3FPYA 5FYJU 1KF9B 4JG5A 2GSGB 2R69H 5T8IA 4JUSA 4BD4A 3EJSA 4O51B 4AW7A 4W9IC 4Q52A 3THMH 5CLYA 5HYQB 4X4KA 3DNKA 4IJ3C 4P3DB 2BMKB 4K5LA 3V6FB 1X5HA 2Z31D 3OSVA 5FKAB 3AG1B 2OSLA 3FJTA 3V6OE 3ZW3A 1QKZH 3VE0A 4AVJA 3WIFA 3B8SA 4LNRA 5IMMA 3V4VA 1M42A 3TYFA 4PJAA 3IJYB 2CK0H 1YECH 3IXAB 1BJ8A 1FFOB 3ZKMC 2YMTA 1TVHA 2VUOA 4P4KA 4JZJA 4U7SA 1FFRA 4GINA 3S34H 2BIQA 3JWOH 2BCKA 4V1DA 1AIZA 4OZ4B 1GHFH 2FEDD 4EVNB 1OAZH 2QPDB 2GUYA 3CG8A 3SDAC 4GH7B 5SWSD 3TBCA 2AXFB 4OZHA 1AGFB 3EGXB 3LY6A 3QAQA 3MV8A 5F3HA 1S9KC 4LOVA 4JVWA 4TTDD 2R0ZH 4WFFE 3TBSB 4R5TA 3B9KA 2XI9A 2APTA 2Y7QB 3D4CA 2QQLL 2APBA 4QWWD 1A3LH 1B90A 5DRZA 4HX1A 1XGRA 5IB1A 1UJ3B 1ZHKB 4EE2A 5I1AB 2QHRL 5KWYC 3L3JA 3DI2B 2F54E 3EF4A 3RURA 2F74B 2QPEB 3OKMB 1UM4H 3KXFE 1SLUA 1NBQA 4LSQL 2DD8L 4R4ND 1CU4H 4IBSA 3CFKB 4FLOA 4J3VA 4KMQA 5C0AE 3ZDWA 1TNNA 1U58B 3L4ZA 5JPNA 4M61B 5DK0A 1LQBC 5FO9A 4UM8B 4JDZA 4PJ8C 1BFSA 5ICXB 3TIDA 1IMHC 3RNKA 4HUMB 3V5HB 4GBXB 5MENA 3ME0A 5IM7A 4H8PA 2VLJE 1ZA6A 3NGBC 4PV8A 3AT9A 4KNSA 2NY2C 2WYHA 4AMXA 5HVHC 2ZNWA 3ULVH 5DMJB 5C0BD 1JF6A 1O7SA 2ZX6A 2VDQH 3P11H 4LPYA 1BZ9A 2OMYA 3ILEA 2DZEA 4PJIE 3KPQB 5L8KB 2EECA 2GJ6D 2Y1YA 1A7QH 3BYTA 4K9EC 4M7LT 3IU3A 4MDRA 1KJ2B 4JFDB 1GIGL 4OUOA 2OQJA 5T3XH 4GT0A 2XIBA 2YEZA 1JF5A 1NGZA 4ZO7A 3MA9H 1A1NA 1NCGA 2EKSB 2MIZA 2BW5A 1OWWA 2IQ9L 4MJIE 1LNUA 4I2XE 5CLTA 1FA4A 3MV9B 1TQUA 3DVNA 4MDJB 5LXVA 4TUKL 1HZLA 4NUJB 4G42A 4PJCA 4AYFA 3C12A 2H0JA 3I50L 3MCLL 4DVRL 1SZNA 4HQQH 1G7HA 1P5VB 3QXVA 3TEYA 3BRDA 4KGLA 2D0HA 4X50A 1NC4B 3VI3A 1GGYA 2JB5L 2DWEA 3HUJB 4RGMC 1CLVA 2XZAL 5CAYB 1BZOA 3ARQA 1M05B 4HG4J 4MQXD 4OLYH 5J11C 1G0DA 3PDDA 4L9LA 3G5YA 4JQIA 5IMLA 1RAMA 5DVMA 5IW1A 1JZ6A 1WA1X 5JHAA 1IO4C 4X5RA 1E3XA 1RZGB 5DZLA 4UTBA 3VXTB 3SE4C 4DCQB 5F96H 4F24A 3J2PA 2RFXA 4U1IB 2WWOA 1FVEB 4J4PC 4B97A 4Q8BA 4PJGB 3F5WA 3W37A 1WUZA 5EBMA 4G83A 1Z9MA 2WXJA 4MNHA 4KAQH 1N0XH 3D0LB 5EBLA 2BVYA 1DP0A 4XPFH 4S0TD 4HFUH 4MDIB 5AUMB 2Y3NA 2EXYD 3T4AA 3QYCA 1C9SA 1RXLA 4ELKA 3I6KA 3RP1A 4KMTL 4CMMA 3R19A 5LGHH 2HFGL 5E6SB 5JHLL 4GQQA 1NDMB 4CC1A 4P9HH 1PBYA 3MLVH 4NSKA 2CHNA 4U05A 4Z3IA 4XMUA 1G1KA 3OVUB 4UT9A 4ZTOH 1K8IA 2VRQA 3OR7A 3VGEA 1WA2X 4AQEA 4XI5D 3ZTNL 3KM1A 5CIPB 2ZUQC 4KO7A 3QIWD 2OMNA 4G7RB 4D0BB 4PV9A 3D0VA 2C1PB 3VXUE 2BVQB 5JXEC 2L7UA 2ARJB 5FGCE 3VSUA 1MHPH 4GKSB 4ZAKA 5TDPA 1KDIA 4F7MB 4WK0B 1S9WB 1HOCB 4KROB 3QZBA 3US0A 4R97C 5DJ8B 2FZ3B 3MRFB 4PJEA 1R75A 1N4XH 3LNIA 4OGXL 3JTTA 5HDBE 2DMGA 3QQ9C 1XF5B 3H7BA 1IM9D 4HF5L 2BS9A 1AFVL 1G4RA 1AGCA 1UWXH 1G9ML 4XXWA 2Q87A 3QQDB 3A4EA 1T22B 2A9DA 1CD8A 3FCTB 2MCPH 3Q3GA 5CZXC 2RJMA 3VWJC 1TEYA 4N3UA 2XBZA 4WEMB 4AL8H 1UACL 2UVFA 1I82A 5SV3A 4TNWF 4P5MA 2PWEA 1SEQH 5FLVA 5BS0A 2VC2L 1OARH 4AIZB 5IVZB 4HJUA 3ES6B 3MTRA 4PHXA 2EDFA 2G2NA 3QFDB 5DR5L 2VZTA 1C12A 1KFAH 1E6OL 1AIFB 3TS8A 1QEXA 1JZ7A 3N04A 4Y5VA 4KTDL 4ZFFB 4PJIF 3QPQC 2CDEA 4Z7NE 3VG0H 4ISVA 1ZSDB 1JNLL 5CLXA 3QUXA 2P8PA 1T1ZA 3NQKA 4NGHL 4NKDA 5DO2C 5FCUL 3TPUA 1JZJA 4OFPA 4NIKB 4EF3A 3O81A 5E8DL 5B39G 4L2LA 1H3VA 3BP7A 3KPMA 4MJID 2ENJA 2A9NL 3KLHD 4KRMB 3ZKND 4XO8A 1J1XL 1M2VB 1HHKB 1IGFL 2OJZH 3IGFA 4I18A 3QI9B 4LXFA 1KT2B 3VB9A 4ZQKB 2EDBA 2JJVA 1RZPA 3VI4A 3ASWA 3LPOA 4ESKA 4W9CC 2EXWC 2XJLA 3Q1EA 3SOTA 4I1PA 4UQBA 3SJVD 2BLFA 1HCZA 3BN3B 2FVNA 5E1IA 5E6YA 3TIEA 3MLUL 3IF1B 4HJ0C 1HX0A 1CGTA 4W9KC 3QUMH 1FFNB 4OW6A 3UG5A 4APQB 3DDFA 3GGWB 1ET5A 4YGVA 2A83A 1D3CA 2V9RA 5D2LB 4KVCL 1XZ0A 2CGYA 4UV7H 5I19H 4P2RA 4TQEH 1VA9A 3RPIB 3W56A 5CGYC 2JB6A 2Y23A 1DANU 4KMLB 4QAWA 4NQDD 5CO1A 2KHAA 4GRLD 5F1OB 4WEUD 2WBJD 4KNUA 4FQJL 2HVKA 1JPSH 1WIPA 3ZLQC 2KKQA 4KKCC 1R5IA 4QRPA 1NLBH 4WV1A 1EBPA 4OTXH 1JVLA 4OZGA 3IRCA 3UYOD 3WHXA 4IOSD 4Y89A 4YXLL 1UTDA 1YAIA 2JCWA 3SQOH 4F91B 5IQMA 3GSUA 3NSCA 1S7RB 5L2JA 1Q0YL 4NC1E 1FHGA 2ORBH 4OV5B 1ADQL 1BBDL 5B39A 4OZIA 1P7QA 4XN9A 2CRYA 4XB3A 5BZDA 3FB7B 1PY9A 4U0RC 3B7SA 1KZYA 3JUZA 4XO5A 2OI9B 3CC5B 4PMEA 5T1LA 3UCRA 1KN4L 1JD7A 4Z7QE 2D2CC 1EHAA 1ZTXL 3VAEA 3VXUD 1KCUL 2B08A 1KIQB 4RDQG 4FG0A 4R5XA 3FPXA 5D7SH 4I48A 5FFLA 5IFHL 3MNZB 4V1DD 2VDNH 5DUMH 3MZGB 4S0HA 2DQCH 2WY3B 4HJTA 2NY5H 1CD1A 4E9QA 2NY0B 1P2CB 5HHNA 3FUFA 5DMGD 1MCPH 2EXTA 2MTPA 2N01B 3GXTA 3MV8D 5HDBF 3BH8A 1CBVH 3QRBA 1FV1A 3LHPL 3GSNB 1LILA 3TBTB 3MA7B 4F37F 4YLQT 1QMUA 4IMLB 3MJ9A 5T1KA 3X1BA 3OLEA 4FFVC 2LLLA 2IPTH 4GW1B 5ESVA 4L5FH 1DLFH 3VYNA 2DQJL 4OKVA 2YARA 3OPZL 2ZCLL 3U1SL 3EJTA 3BWUF 1SOKA 4EEEA 3IDNB 2X28A 5C6PB 2FJGA 4K73A 1MY5A 3BGMB 2EYTB 4P49A 1P4UA 2VR7A 2X12A 5B1CA 3TO2A 4M43H 2DQUL 3O6FC 4M62H 5MEND 2H9GB 2CM6A 4KDVA 1J05A 3KG5A 4YR6B 1JDDA 1S7UB 1HE8A 3QJTB 4Z7NF 3BEVB 5D2NA 1VDGA 3ABZA 1RCYA 5J9PA 3HNTH 2EINB 1B0GB 1MCCA 1J48A 1E50A 1YEFH 3FTSA 2RR3A 3DRQB 4UQ3B 5AL8A 1QVOA 2AABL 2F53B 3HPJA 5ECJE 1RJZB 3L3DA 4L4TA 5GS2D 2O5ZL 4U1KA 3FCSA 2DMCA 4NX0A 3DXAE 4FYSA 4HOZA 1HEZB 4LCUB 5AW5B 4WAFA 3IMWA 2ZXEB 3RIKA 2XWTB 4R2GB 4BZ1H 1YMHA 4FQ2L 2H41A 4LKXA 5DD0H 4OCRL 5J6GA 5FA4A 5EU5B 2AGJH 3KNBB 5LJYH 2H26B 1QPXA 3DBXA 5AWNH 5EO1B 2R8SH 1L7TH 3MLZL 5LGJB 5ALCL 3C6SA 1KB5B 3BGFB 1S7TB 1CVRA 3RWFA 3SKJL 1U8HA 3VI4E 3QG6B 1QEWA 1QBAA 3EFDH 1IJ9A 5C9KA 3GM0A 5MEQB 4OD2A 1MOEA 1OCZB 1I3GH 2YRLA 3QUGA 3PXJA 4OCYL 5ICYB 3X14B 5CBEB 3ZRSA 2Z31B 3JV0A 2UZYB 32C2A 4EQ2A 2XXFA 2CO6B 3L6FA 3M7OA 1EGJA 1QZ1A 4HKJA 5HHXL 3RZCB 3WBDA 3QFGA 1MRCL 5GGQH 4UMGA 3AREC 3TJPA 4YHYB 4Z7AA 3RVWC 3HZ3A 4RBPK 1AE6H 4UU9B 3VDAA 3SSGA 5EZOL 4WGKA 3ZRCC 4KXDA 3FO2B 4OZGE 1T4KA 3GMNB 3X3FH 1IC4L 3FTXA 2IC2A 3CBRA 5SWSB 2X6MA 4PD4K 2X4OA 2KBGA 1A5FH 1WBXA 2KZ1B 3HHRB 4L4JA 4Z7QF 5IHUH 2V6HA 3OQ3B 2E5EA 1U2YA 1WC7A 1BVOA 4A2HA 3LXAA 1WIOA 4EZMA 2G9HA 4K3DL 3QXTA 2OR9L 5EIIG 5GS1C 1HDMB 3UBXI 3LS5L 3ZOAA 4OLWH 2WPGA 4C59B 4X4ME 5TFSL 3F7PC 3S35H 5C3IA 2C9RA 2UY6B 4Z0BH 4WHYH 1NUDA 1G6RL 4PTTA 3O6MH 4W6YB 2AQ3A 2CZNA 3CSPA 3DVGA 1UZGA 4TVPH 1JN6A 4ZAKD 4NAJA 4QHPA 3O0LA 4M02A 5J12B 5BV7L 5E1AA 5AALA 3QORC 1FZOA 2O6CA 5BMFL 4ONHA 3BZEB 4X6FB 4HJIA 2YUVA 2NY6B 3MNWA 2AQQA 2V17H 2G3ZA 3ERXA 4JKPH 5C0BB 3SE9L 4BQ8A 2EYRA 5AOMA 3ILDA 1IGIL 4QY8A 3TBWA 5SWZA 4LLVB 5I6MA 1MRFL 1NPUA 3ZY7A 3RWIA 2WXNA 2QKIA 1U21A 3F7KA 4GIOA 4A2FA 2IDUA 3OAZH 1TNMA 3HI1B 4W9JC 5BS0D 2VISB 4FYQA 1U3HA 3MCG1 5IKCB 1QSEB 4NRZA 2HRGA 1YEGH 2AXGA 2XQYK 4DO5A 5I30H 3GO1L 3I02B 5CNHA 4FTVA 3UIYA 2B4CL 4XX1E 1DE4A 5IB3A 1FVCA 3BQUB 4UINL 3QXDB 2WC7A 4NENA 4BRVA 2D31A 3DARA 1JPST 5I1KL 2LU4A 3QUXD 5D7IE 4ZW6A 2G75B 4FJ6A 2NY7L 5E9DA 3FHEA 5EIIA 3UP1A 1F42A 1OF0A 2BSTA 4QTHA 3Q0HA 4FERA 4QRSB 4H8WL 4KI1A 4ZMQA 5A6MA 4PLNC 3VQ1C 3VFMB 1UJ3C 2P47B 3F05A 3D69B 3QRFM 4JM2A 1ES0B 1DSFL 1MF2L 3IDGA 4PMFA 3OG4B 2XACC 4L8BA 1LQSR 5D1QA 4E9SA 3IJ8A 3N85L 4WNQA 4FMVA 1OSPH 5B3SB 3T9WA 3NESA 3JV6B 4N2LA 3NRQA 5JUEL 4GBXC 4PRNA 5C7XL 3HMXA 1JK8A 4UQ9A 4P0DA 4KTEH 5C0NC 1S9VB 1A4BA 4EMZA 4LCYB 1I53A 3R7QA 5DMKB 1NL0L 1BPVA 2PYEA 3OF6D 3L4UA 4CL7A 3HC0B 2FUTA 4X4XB 5L88L 4G7QB 3KYMA 4E0RB 5TK2A 2O6FA 4XPBL 3Q8FA 4ZOCA 1QRNE 1JJUA 1GZPA 2WKOF 4TYUA 1HINL 5I1DB 2YRPA 3QUYC 4BHUA 5KN5B 1I1AA 4R96A 4YQXL 4AQ1B 1S7VA 2WVTA 2DQEL 3C60C 3BUDA 3G5WA 4FP8H 3RWCB 1IZKA 3FZUD 1IFHH 3M45A 4QPEA 4RSYA 1DJYA 2BP8B 2Z93B 1JGDA 2NT1A 3OC8A 1X5AA 3K5SA 3CX5K 4BZYA 1D5BA 4H1LG 1UG9A 3GXMA 2F8OA 5F7MC 4Y4FC 2R2HA 2P8LA 1J1OH 1AHWA 4PY7B 3HTLX 4X99A 5IEKB 2V2WA 3ZTEA 5I16A 3KYNA 5CILL 4PP1D 2QVKA 1HCVA 4KHTL 1MEXL 1Q72L 3AS3A 4M00A 2AQNA 2L8AA 5F93C 5GS0C 1I4FA 4ELMA 4BV1A 1LDPH 2X1QA 4JCMA 1MCSA 4BFGA 4OAWB 2ZUTA 3KXFB 2Q3XA 1ZVYA 5C0AB 3E1F1 2EVJA 2YWYA 2JK5B 4X4YA 2XX0A 4N22A 2HWZL 4HMDA 3R1GL 4MNQE 4ZUVA 2VLJB 4J1UA 3CSYA 4F9LC 2J1WA 2UXTA 3WNIA 1KN2H 4FXGB 4XMVA 4JFHE 4P46D 4ANVA 2F6AA 2R59A 4NLAA 1RIUH 2MQCA 4J3OH 3C6EA 5BRZE 3QJUB 3DIVA 2DQHL 1JPFB 4YE4L 1WFOA 5T1KD 3LQAC 3HI5L 1DFBH 4PJIB 5E5LA 5TPWH 3TNNA 3TO4B 1CDCA 2BJMH 2K0RA 2YGNA 2XCMC 4DW2H 2AANA 4DAGL 4F58H 4ZX3A 5SWZE 2DW5A 3NA9L 1MFDH 2HB0A 2EIDA 3KPRA 4XMPL 1D2OA 4H1LA 4I2XB 4MJIB 4TSCL 1YY8A 3ULSA 2CDFA 1D5XA 4UTAL 1E28A 2GI0A 4GSDH 3NJJA 3ZTCC 1TLKA 2YD7A 3ZQXA 5D7IF 2BFVH 4XRCB 3ZR5A 3T3ME 4QRTA 5J8OA 5LG6A 2H3KA 3ASOB 4JR9L 4CVZB 3B2XA 4OGAC 2KZBA 2HT4D 4KROC 3S36L 2F5BH 3NCEB 5E00A 5GHWL 4HS8L 3PP3K 2Q9OA 1MCOH 3QWRD 3P0YL 2NUTB 1QA9A 1SJVA 4A55A 3BE1L 2NNCA 4NZJA 2X3BA 4NN7B 3T2QA 2DJMA 3KBPA 2QDWA 3JTBA 2G0LA 2HFEB 4GAGL 4HBQA 1IGML 4PSPA 5A2AA 2VWEC 2BSSA 2KMWA 3MJ7B 3V6ZA 5I6XC 2IGLA 4IKIA 4G7YL 3CLWA 4GRLB 3OWEA 2WBJB 2EICA 5CP7B 5DZ9A 2KYIA 5FW8A 3ECWA 3L81A 3LIZL 4U3SB 2O30A 3O41B 1QRND 5I1EH 3N44F 4P5RA 5GGRB 1WDAA 4X5LA 3OKOA 2QQNL 1IC5H 1FC1A 3M1BB 4QXWA 4NKIL 4FOMA 3EFOA 3QGVA 1F58L 5ILTH 5I66A 5FLUA 2ITEA 5EN2A 4G7VL 4PJ7E 2JCCA 4S1DC 1J5OL 2YFOA 5DJ0A 5A2LH 4NQSA 5C2UB 2OSLB 2NLJB 3EO9H 1YN6B 4Q6IB 5I6PA 2UUDK 4NNPH 3WIFB 4YK4B 4G3YH 5I18H 3V4VB 1FNAA 5FYKH 2WXLA 3QIUD 3MKGA 3CN2A 4XN2A 2SEBA 3DROB 4NWUH 1ZRUA 2M26A 3L3KA 2CLVB 3CFQA 5IJKC 3VXUB 1DQJB 1CTOA 1FFPA 5FGCB 5J7CC 1KELL 1Z9OA 4GI6A 1FNHA 3I74A 4XP5H 4H2AA 2VDLH 4LVNB 2YKLH 3M07A 1URZA 3L2NA 1UA6L 5AW1B 4N1EA 4PLKD 3UPRA 5HDBB 1NAML 3OHXC 5F3HB 2A74A 5GRUL 2HLFD 4APQC 5JPMA 3AXIA 2DBLH 2H32B 3A22A 4A6YL 3M17A 1BF5A 1Q9OA 1MVUB 2X6AA 4PM1A 5E51A 1Q9WA 1IQWL 4GG6A 4QO1A 2X4QB 3BCFA 3SYCA 4ELME 5DFWH 5F7EL 3TP4A 1X9UA 3SPCA 4KITB 4YSRA 3N1PC 4UAOB 3IMTA 4OJAA 4PQXA 3CVBA 5GGUA 5D9SA 5BRZD 1E4KA 2IWKA 5EIQA 5F70A 4JDZB 3STLB 1U36A 2CG9X 2Y5TB 3H4FA 2Y7MA 4A2LA 1DSYA 3IFLL 1B4LA 1JSYA 1XL6A 5FF6B 4Z7NB 2OL3H 3RTQD 1X44A 1J8SA 4NBXB 2V0AA 1MSPA 5LBSA 4MJ5A 5SWZD 3DIDA 2IPUG 5E9NA 5JW3L 3CFUA 4XC3H 4GKZA 3T77B 2P52A 4K7FB 2EJ1A 4NQVA 4UTAA 4YVNA 3V95A 5IHBA 4UZGA 5FS5A 2HRPL 3IKCA 4G43A 5ADPL 1DVFD 1OCOB 3IU3B 4F1ZA 3CXDH 4KK9C 1U3HD 4NM4H 1LXMA 4HD9A 3VYPA 3MJ8B 2E75C 4HWNA 2YRZA 5KS9E 1N64L 2X41A 4HK0A 2CKBL 3T3MF 3HB3D 4LPCA 3G6DL 5H37H 5C0CA 3NCBB 2P26A 5AB1A 2NY0C 2YEQA 1KC5L 3CPLB 1OPOA 2N59A 4B5EA 5HYIA 4HIPA 4HIQA 1O5PA 3WEAA 5E9DD 2JELL 2AKRB 4HU2A 4G6KH 1G7HB 5IW3A 5CGMA 4GW4A 2K9UA 4HWBL 1YAZA 2WINA 3CZNA 3M86A 4I0PA 1S6NA 4LLYA 5LAXA 1ID2A 2VQ1B 2YS4A 5GSRA 1F1AA 1UH3A 5I0ZA 1AI1H 4WSGA 1QR1B 2CJUH 4LMQE 9CGTA 3M1OA 2CLRA 1YC7A 2D7MA 2YSSB 1J86A 5D1QD 4HWEH 3MCYA 3HPLA 1OD7A 1PZSA 4L9LB 3FQRA 2QSTA 1AKJA 2XG4B 2ATKA 1XCWA 2W0PA 4P59H 4LRNL 3VQLA 2RTTA 3F5WB 3IN2A 4NRXA 5FR3A 3RWEA 2PYED 4ONOA 2GY7B 1TTAA 4KKPA 3SKNB 3FB8A 2UYLB 2YPVA 3BZ4B 3NFSL 4YWGH 4K7PX 1JMXA 1LMIA 4LARL 3CUPA 1FDLH 4PJXA 2XBDA 3ARGA 3BP4B 3EF7A 4PJ7F 4XVUC 3SKOB 4BQ6A 4C4KT 5ACLA 3GI9L 4XPHL 3VWKB 4NZDA 3Q2LA 1WWAX 1I1AD 2ZD0A 2C7UA 4FQHA 5JNYB 2R2BB 4MHHI 1N59A 3S88L 3DX8A 4KRPB 3VGHA 1ZIAA 4Z7QB 5CWSB 5CD5C 4PN6A 1DUYA 2NUPB 5ETUB 2XA8H 5KSAA 2IDTA 1K8IB 3VM5A 4NYLB 4KZEL 2DQFB 2VXQH 4HLJA 2L4OA 4YGAB 2BRRL 1BZ7B 1CLYH 2E7MA 4ODWB 1RFDH 3IDYB 1KLUB 1NM4A 2VW7A 3CFCH 3EH2A 4UILH 3SPHA 1KCRL 3FT4B 3AG2B 5HPMB 3BIAX 1RZKH 3D0VB 3MC0A 3MRCA 2VNCA 3WLWD 4A6YA 1RZFH 4XNZB 3JQOB 3WUWG 3BGFC 4XZUA 4ZAKB 1PZAA 1FVDA 3CVHH 3MUGB 3SD2A 5CKAA 3K6SB 2MPAL 1EK3A 2W07A 1LEIA 4M6ML 1S5HA 1SY6A 3APFA 3P0VL 4HUKB 3SDYH 1DL7L 4B9KC 3FN0L 2PTTA 3TCTA 1NDGB 2FECI 3IS0X 3HA0A 3H7BB 3MBWA 1E5AA 1VFAB 3GF8A 5EO9A 4AIEA 1RUKL 1CGSL 5I74C 5F9WB 2ZUVA 3QULB 3FOMA 1NCUA 3L4WA 1CFVH 5KYNA 4OF3A 4PIRF 3DTUB 4GG6E 2H2PD 2VXVL 4W6WB 3RZCC 3AQYA 3EUUA 5IFJA 2CH8A 2H45A 1T7XA 3VFVB 4YHYC 1IQDA 5JR1L 4F57H 4G8IA 3Q2VA 1E4WL 2UZIH 1FFQA 3DA0A 1L6ZA 2A9BA 5C71A 2MMXA 4NN6C 5EZIH 4PW9A 4N6QA 3P77B 3ET9F 3RHWK 1KGYE 3TFKD 5HYJA 4TLUA 2F1BA 2SODB 4GQ9H 3IK2A 2W59A 4ERSH 4MCMA 4JPVH 2BCMA 1UM6L 4WI6A 1AZUA 1ZHBA 1S5IL 4J6RL 4HKZB 4A2DA 2WQXA 1BBJA 1OAQL 1Z5LA 3CWGA 2P8PB 2R0WH 3OLGA 4XPGL 2J2ZA 1GGCH 4TTDC 5IQLA 4HUUB 3DXAB 4NKDB 2GFBB 1MREH 5KS9F 4MZ3A 5DQ9A 2R29L 3FQUB 4GKNA 1MN4A 5EU6E 4BSWA 1KCWA 1SHMA 3ORJA 4DGVH 2MPVA 1OT1A 3L1OL 3WEOA 1FNEB 1EEYA 2CSPA 2H6PA 1ETZA 2IG2L 4JE4B 3WUWA 1FO0A 3HBPA 1QBLH 1E7VA 1K8DA 1MZYA 4HWBA 3WFCL 2K3TA 2F1AA 5J12C 3CBJB 1XB6A 1AZNA 3VI4B 1YYLH 4BA8A 1RUAH 5IFAL 3KL0A 1BZ8A 4XNUH 3QR0A 4X7TB 4UMSA 3LCYA 2NY6C 5DS8B 5FO2A 3ZZLA 1CICB 5DSCA 2M83A 4HDIA 4JDTL 3U7YL 5BUGA 5DFTA 1J0KA 2A6KB 3MNVA 2UZXA 2GBVA 4ZMWA 1NC2D 1LO4H 3FF8A 4YFEA 1LP9E 2WQRA 4JBSA 2GTWB 4KC3B 4FFWC 4FLRA 3DKHA 4X5WB 3CDGA 2JKIS 5TF1L 5C0EA 1T21A 5CZRA 4D9LH 4RAVB 1XO8A 1L6XA 3UC2A 5ICZB 4Y0GA 2HVKB 3QJHA 2WTRA 4FC3E 5HGAB 4AKQA 4PJBE 3LZFH 1I9IH 4NFBA 3OTTA 5C0DA 3BQUC 1BXAA 3VMOA 3ZUNC 4OZGB 2KL6A 3ULAB 3EH3B 4EPSA 2BVPA 1JZGA 1USZA 4WI3A 5IG7A 3E3QE 5L2JB 3CZFA 4OT1H 3UDWA 3GPSA 5IUSA 4Q4EA 3BUPA 2NY3D 2FX8H 4OCXH 4CVXA 5TGBA 4X9YA 3U46B 3BUQA 3G3LA 5CHNA 1EXUB 1PGRB 3K80A 2YAPA 5ESQA 2P28B 3DRTA 2A0LD 3VFNA 4PVNA 5D1XA 4Q97A 3F58H 3ECVA 3RVXD 1B9ZA 1FPTL 2DLFL 5C7ZA 1IFGA 5FOJA 3ARFC 4XVJH 3N43F 4PRBA 3F64A 2D7PA 4FE9A 5DJAA 3ROOA 2P8MA 4IK6A 5DJZB 1IEBB 1P7KA 2HH0L 5I1IH 1L7IH 3QZMA 4UDUB 5DT1L 1U8PA 3AXLA 2GSIB 4Y5XC 4MMZA 4QRQA 3SKUD 4AV5A 3MFFB 5IIEA 4XN4A 4DK6A 5CFAA 2OMZB 3H3PH 1I8LC